Citrus Sinensis ID: 048651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MALKSSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGTIAA
cccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHcccccccEEEEcccccccccccHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEcccccccc
cHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHccccEEEEEEEEcccccHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccc
MALKSSISVLLFCAVLKLmtgddasgITIYWVQNGIQstfmetcttsnydfvnlafcppleiidikscqAKGVKVMLSIEggagnyylsfSEDARQVADYLWnnflggqsssrplgnavldgidfgieggtiaa
MALKSSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGTIAA
MALKSSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGTIAA
******ISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQS**RPLGNAVLDGIDFGIE******
****SSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFG*EGG****
MALKSSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGTIAA
MALKSSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALKSSISVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCPPLEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGTIAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
P29060 291 Acidic endochitinase OS=N N/A no 0.895 0.412 0.503 1e-32
P51614 301 Acidic endochitinase OS=V no no 0.940 0.418 0.503 6e-32
P17541 292 Acidic endochitinase OS=C N/A no 0.970 0.445 0.444 7e-30
P19172 302 Acidic endochitinase OS=A yes no 0.977 0.433 0.461 9e-30
P23472 311 Hevamine-A OS=Hevea brasi N/A no 0.813 0.350 0.515 2e-29
P29024 298 Acidic endochitinase OS=P N/A no 0.962 0.432 0.434 4e-29
P36908 293 Acidic endochitinase OS=C N/A no 0.805 0.368 0.488 1e-28
P36910 293 Acidic endochitinase SE2 N/A no 0.925 0.423 0.466 1e-27
P29061 294 Basic endochitinase OS=Ni N/A no 0.820 0.374 0.467 2e-24
P29025 493 Chitinase 1 OS=Rhizopus n N/A no 0.649 0.176 0.454 3e-15
>sp|P29060|CHIA_TOBAC Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=1 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 97/147 (65%), Gaps = 27/147 (18%)

Query: 8   SVLLFCAVLKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFC--------PP 59
           +++LF   LKL  GD    I IYW QNG + +  +TC T+NY  VN+AF         P 
Sbjct: 10  ALVLFLRALKLEAGD----IVIYWGQNGNEGSLADTCATNNYAIVNIAFLVVFGNGQNPV 65

Query: 60  LEII---------------DIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNN 104
           L +                DI++CQ +G+KVMLS+ GGAG+Y+LS ++DAR VA+YLWNN
Sbjct: 66  LNLAGHCDPNAGACTGLSNDIRACQNQGIKVMLSLGGGAGSYFLSSADDARNVANYLWNN 125

Query: 105 FLGGQSSSRPLGNAVLDGIDFGIEGGT 131
           +LGGQS++RPLG+AVLDGIDF IEGGT
Sbjct: 126 YLGGQSNTRPLGDAVLDGIDFDIEGGT 152
This protein functions as a defense against chitin containing fungal pathogens.
Nicotiana tabacum (taxid: 4097)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 4
>sp|P51614|CHIT3_VITVI Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE=2 SV=1 Back     alignment and function description
>sp|P17541|CHIA_CUCSA Acidic endochitinase OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P19172|CHIA_ARATH Acidic endochitinase OS=Arabidopsis thaliana GN=CHIB1 PE=2 SV=2 Back     alignment and function description
>sp|P23472|CHLY_HEVBR Hevamine-A OS=Hevea brasiliensis PE=1 SV=2 Back     alignment and function description
>sp|P29024|CHIA_PHAAN Acidic endochitinase OS=Phaseolus angularis PE=2 SV=1 Back     alignment and function description
>sp|P36908|CHIA_CICAR Acidic endochitinase OS=Cicer arietinum PE=2 SV=1 Back     alignment and function description
>sp|P36910|CHIE_BETVU Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 PE=1 SV=1 Back     alignment and function description
>sp|P29061|CHIB_TOBAC Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P29025|CHI1_RHINI Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
255580195 298 hevamine-A precursor, putative [Ricinus 0.977 0.439 0.587 1e-38
224064085 298 predicted protein [Populus trichocarpa] 0.977 0.439 0.574 3e-37
255541742 296 hevamine-A precursor, putative [Ricinus 0.977 0.442 0.575 3e-37
225454383 298 PREDICTED: acidic endochitinase [Vitis v 0.977 0.439 0.587 5e-37
297745368 457 unnamed protein product [Vitis vinifera] 0.977 0.286 0.587 7e-37
225454387 298 PREDICTED: acidic endochitinase-like [Vi 0.977 0.439 0.567 4e-36
125557999 297 hypothetical protein OsI_25670 [Oryza sa 0.977 0.441 0.567 7e-36
27817953 297 putative class III acidic chitinase [Ory 0.977 0.441 0.554 2e-35
119393870 298 class III chitinase [Casuarina glauca] 0.910 0.409 0.565 3e-35
224127788 300 predicted protein [Populus trichocarpa] 0.977 0.436 0.548 4e-35
>gi|255580195|ref|XP_002530928.1| hevamine-A precursor, putative [Ricinus communis] gi|223529487|gb|EEF31443.1| hevamine-A precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/155 (58%), Positives = 105/155 (67%), Gaps = 24/155 (15%)

Query: 1   MALKSSISVLLFCAV-LKLMTGDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCP- 58
           MA  S+IS++ F +V L L+ G +A GI IYW QNG + T  ETC T NY FVN+AF P 
Sbjct: 1   MASGSAISLIFFISVVLTLILGSEAGGIAIYWGQNGNEGTLAETCATGNYAFVNIAFLPT 60

Query: 59  ------PLEII----------------DIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQ 96
                 P+  +                DIKSCQAKG+KVMLSI GGAG+YYL+ +EDARQ
Sbjct: 61  FGNGQTPMINLAGHCDPYSNGCTGLSSDIKSCQAKGIKVMLSIGGGAGSYYLASAEDARQ 120

Query: 97  VADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGT 131
           VA YLWNNFLGG SSSRPLG AVLDGIDF IEGGT
Sbjct: 121 VATYLWNNFLGGNSSSRPLGPAVLDGIDFDIEGGT 155

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224064085|ref|XP_002301383.1| predicted protein [Populus trichocarpa] gi|222843109|gb|EEE80656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255541742|ref|XP_002511935.1| hevamine-A precursor, putative [Ricinus communis] gi|223549115|gb|EEF50604.1| hevamine-A precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225454383|ref|XP_002279147.1| PREDICTED: acidic endochitinase [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745368|emb|CBI40448.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454387|ref|XP_002279205.1| PREDICTED: acidic endochitinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|125557999|gb|EAZ03535.1| hypothetical protein OsI_25670 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|27817953|dbj|BAC55717.1| putative class III acidic chitinase [Oryza sativa Japonica Group] gi|50510270|dbj|BAD31627.1| putative class III acidic chitinase [Oryza sativa Japonica Group] gi|125599876|gb|EAZ39452.1| hypothetical protein OsJ_23883 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|119393870|gb|ABL74451.1| class III chitinase [Casuarina glauca] Back     alignment and taxonomy information
>gi|224127788|ref|XP_002320164.1| predicted protein [Populus trichocarpa] gi|222860937|gb|EEE98479.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
UNIPROTKB|P51614 301 CHIT3 "Acidic endochitinase" [ 0.507 0.225 0.739 1.9e-33
UNIPROTKB|Q84S31 297 Q84S31 "Chitinase III" [Vitis 0.507 0.228 0.724 4.9e-33
TAIR|locus:2178702 302 CHIA "chitinase A" [Arabidopsi 0.5 0.221 0.686 1.1e-31
CGD|CAL0006391 462 CHT1 [Candida albicans (taxid: 0.552 0.160 0.48 1.1e-16
UNIPROTKB|Q5AAH2 462 CHT1 "Putative uncharacterized 0.552 0.160 0.48 1.1e-16
CGD|CAL0002204 583 CHT2 [Candida albicans (taxid: 0.5 0.114 0.492 3.1e-15
UNIPROTKB|P40953 583 CHT2 "Chitinase 2" [Candida al 0.5 0.114 0.492 3.1e-15
POMBASE|SPAPB1E7.04c 1236 SPAPB1E7.04c "chitinase (predi 0.701 0.076 0.406 4.9e-12
ASPGD|ASPL0000012800 961 chiA [Emericella nidulans (tax 0.522 0.072 0.405 3e-11
SGD|S000004276 562 CTS1 "Endochitinase" [Saccharo 0.641 0.153 0.388 2.7e-09
UNIPROTKB|P51614 CHIT3 "Acidic endochitinase" [Vitis vinifera (taxid:29760)] Back     alignment and assigned GO terms
 Score = 260 (96.6 bits), Expect = 1.9e-33, Sum P(2) = 1.9e-33
 Identities = 51/69 (73%), Positives = 60/69 (86%)

Query:    65 IKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGID 124
             I++CQ +G+KVMLSI GGAG+Y LS S DA+ VA+YLWNNFLGGQSSSRPLG+AVLDGID
Sbjct:    89 IRNCQNRGIKVMLSIGGGAGSYSLSSSNDAQNVANYLWNNFLGGQSSSRPLGDAVLDGID 148

Query:   125 FGIE-GGTI 132
             F IE G T+
Sbjct:   149 FDIELGSTL 157
GO:0006032 "chitin catabolic process" evidence=NAS
GO:0016798 "hydrolase activity, acting on glycosyl bonds" evidence=NAS
UNIPROTKB|Q84S31 Q84S31 "Chitinase III" [Vitis vinifera (taxid:29760)] Back     alignment and assigned GO terms
TAIR|locus:2178702 CHIA "chitinase A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0006391 CHT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AAH2 CHT1 "Putative uncharacterized protein CHT1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
CGD|CAL0002204 CHT2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P40953 CHT2 "Chitinase 2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPAPB1E7.04c SPAPB1E7.04c "chitinase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000012800 chiA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000004276 CTS1 "Endochitinase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1.14LOW CONFIDENCE prediction!
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026949001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (298 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
cd02877 280 cd02877, GH18_hevamine_XipI_class_III, This conser 7e-42
pfam00704 325 pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam 1e-08
>gnl|CDD|119356 cd02877, GH18_hevamine_XipI_class_III, This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information 
 Score =  139 bits (352), Expect = 7e-42
 Identities = 58/134 (43%), Positives = 70/134 (52%), Gaps = 28/134 (20%)

Query: 25  SGITIYWVQNGIQSTFMETCTTSNYDFVNLAF-------------------------CPP 59
             I +YW QN  + +  E C T NYD VN++F                         CP 
Sbjct: 1   GNIAVYWGQNSDEGSLREYCDTGNYDIVNISFLNVFGSGGTPGLNFAGHCGGSTYPNCPQ 60

Query: 60  LEIIDIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSS--RPLGN 117
           L   DIK CQ+KG KV+LSI G  G+Y LS   DA+  ADYLWN F GG  S   RP G+
Sbjct: 61  LGA-DIKHCQSKGKKVLLSIGGAGGSYSLSSDADAKDFADYLWNAFGGGTDSGVPRPFGD 119

Query: 118 AVLDGIDFGIEGGT 131
           AV+DG DF IE G+
Sbjct: 120 AVVDGFDFDIEHGS 133

Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin. Length = 280
>gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
KOG4701 568 consensus Chitinase [Cell wall/membrane/envelope b 100.0
cd02877 280 GH18_hevamine_XipI_class_III This conserved domain 100.0
cd02871 312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 99.77
cd06546 256 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 99.59
cd06543 294 GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch 99.57
cd06542 255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 99.56
COG3469 332 Chitinase [Carbohydrate transport and metabolism] 99.52
cd06545 253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 99.41
cd00598210 GH18_chitinase-like The GH18 (glycosyl hydrolase, 99.39
PF00704 343 Glyco_hydro_18: Glycosyl hydrolases family 18; Int 99.17
cd02879 299 GH18_plant_chitinase_class_V The class V plant chi 98.84
cd02878 345 GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin 98.74
smart00636 334 Glyco_18 Glycosyl hydrolase family 18. 98.71
cd06544 253 GH18_narbonin Narbonin is a plant 2S protein from 98.7
cd02872 362 GH18_chitolectin_chitotriosidase This conserved do 98.64
COG3325 441 ChiA Chitinase [Carbohydrate transport and metabol 98.58
cd06548 322 GH18_chitinase The GH18 (glycosyl hydrolases, fami 98.58
cd02874 313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 98.53
cd02873 413 GH18_IDGF The IDGF's (imaginal disc growth factors 98.45
cd02875 358 GH18_chitobiase Chitobiase (also known as di-N-ace 97.95
KOG2806 432 consensus Chitinase [Carbohydrate transport and me 97.93
cd02876 318 GH18_SI-CLP Stabilin-1 interacting chitinase-like 97.82
cd06549 298 GH18_trifunctional GH18 domain of an uncharacteriz 97.05
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 94.09
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 94.09
cd06523177 GH25_PlyB-like PlyB is a bacteriophage endolysin t 90.65
PRK02261137 methylaspartate mutase subunit S; Provisional 89.29
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 88.82
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 87.35
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 86.85
cd06415196 GH25_Cpl1-like Cpl-1 lysin (also known as Cpl-9 ly 84.99
cd06547 339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 83.95
cd06417195 GH25_LysA-like LysA is a cell wall endolysin produ 80.96
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 80.91
>KOG4701 consensus Chitinase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-42  Score=298.40  Aligned_cols=116  Identities=41%  Similarity=0.667  Sum_probs=109.8

Q ss_pred             hhcCCCCCceEEEccCC--CCCCchhhhhcCCCccEEEeeeC---------------------------CCchhHhHHHH
Q 048651           18 LMTGDDASGITIYWVQN--GIQSTFMETCTTSNYDFVNLAFC---------------------------PPLEIIDIKSC   68 (134)
Q Consensus        18 ~~~~~~~~~i~~YWGq~--~~~~~L~~~C~~~~ydiV~laF~---------------------------~P~~~~dI~~C   68 (134)
                      .++..++++|++|||||  ++|++|+.||+++.||+|+++|+                           |.+|++||+.|
T Consensus        20 k~~~~~~t~IA~YWGQN~aG~q~~Ls~yC~~~~yd~~~lsFL~~F~~~~Tp~LNfAn~Csd~~~~~l~~CTqi~~di~~C   99 (568)
T KOG4701|consen   20 KLNLTNQTAIAGYWGQNLAGDQKRLSSYCQNTTYDAIILSFLIDFNVDGTPVLNFANLCSDSDTFSLKKCTQIETDIQVC   99 (568)
T ss_pred             ccccccccceEEEeccccccchhhhhhhhccCccceeeeehhhhcCCCCCceeehhcccCccccccccccchhhhHHHHH
Confidence            44678889999999999  88999999999999999999999                           23499999999


Q ss_pred             HHCCCeEEEeeecCCcccccCCHHHHHHHHHHHHHhhCCCCCCCcCCCCcccceeeeecCCCCCC
Q 048651           69 QAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDGIDFGIEGGTIA  133 (134)
Q Consensus        69 Q~~GkkVlLSlGG~~g~~~l~s~~~A~~fA~~Lw~~f~~g~s~~RPfg~~~lDG~D~DiE~g~~~  133 (134)
                      |++||||||||||+.|+|.+.++++|+.||++|||+||+|....||||++||||||||||.+++.
T Consensus       100 QS~GiKVlLSLGG~~GnYs~~~d~dA~~fA~~LWn~Fg~G~~S~RPfg~AVvDGfDF~IE~g~~~  164 (568)
T KOG4701|consen  100 QSNGIKVLLSLGGYNGNYSLNNDDDATNFAFQLWNIFGSGEDSYRPFGKAVVDGFDFEIEKGTNT  164 (568)
T ss_pred             HhcCeEEEEeccCcccceeeccchhHHHHHHHHHHHhcCCccccCcccchhccceeeeeecCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999874

>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii Back     alignment and domain information
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>COG3469 Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods Back     alignment and domain information
>PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes Back     alignment and domain information
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit Back     alignment and domain information
>smart00636 Glyco_18 Glycosyl hydrolase family 18 Back     alignment and domain information
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L Back     alignment and domain information
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases Back     alignment and domain information
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>KOG2806 consensus Chitinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome Back     alignment and domain information
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd06523 GH25_PlyB-like PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>cd06415 GH25_Cpl1-like Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>cd06417 GH25_LysA-like LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
1kr0_A 273 Hevamine Mutant D125aY183F IN COMPLEX WITH TETRA-Na 9e-30
1hvq_A 273 Crystal Structures Of Hevamine, A Plant Defence Pro 1e-29
1kr1_A 273 Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Na 5e-29
1kqy_A 273 Hevamine Mutant D125aE127AY183F IN COMPLEX WITH PEN 5e-29
2gsj_A 271 Cdna Cloning And 1.75a Crystal Structure Determinat 7e-29
3d5h_A 272 Crystal Structure Of Haementhin From Haemanthus Mul 7e-20
3o9n_A 272 Crystal Structure Of A New Form Of Xylanase-A-Amyla 3e-19
3mu7_A 273 Crystal Structure Of The Xylanase And Alpha-Amylase 1e-18
1om0_A 274 Crystal Structure Of Xylanase Inhibitor Protein (Xi 1e-14
2uy2_A 294 Sccts1_apo Crystal Structure Length = 294 2e-11
1cnv_A 299 Crystal Structure Of Concanavalin B At 1.65 A Resol 3e-09
2xvn_A 309 A. Fumigatus Chitinase A1 Phenyl-Methylguanylurea C 2e-06
2xuc_A 310 Natural Product-Guided Discovery Of A Fungal Chitin 2e-06
>pdb|1KR0|A Chain A, Hevamine Mutant D125aY183F IN COMPLEX WITH TETRA-Nag Length = 273 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (313), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 83/129 (64%), Gaps = 23/129 (17%)
Query: 26  GITIYWVQNGIQSTFMETCTTSNYDFVNLAF-----------------CPPLE----IID 64
           GI IYW QNG + T  +TC+T  Y +VN+AF                 C P      I+ 
Sbjct: 2   GIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVS 61
Query: 65  --IKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSSRPLGNAVLDG 122
             I+SCQ +G+KVMLS+ GG G+Y L+   DA+ VADYLWNNFLGG+SSSRPLG+AVLDG
Sbjct: 62  NGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDG 121
Query: 123 IDFGIEGGT 131
           IDF IE G+
Sbjct: 122 IDFAIEHGS 130
>pdb|1HVQ|A Chain A, Crystal Structures Of Hevamine, A Plant Defence Protein With Chitinase And Lysozyme Activity, And Its Complex With An Inhibitor Length = 273 Back     alignment and structure
>pdb|1KR1|A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag Length = 273 Back     alignment and structure
>pdb|1KQY|A Chain A, Hevamine Mutant D125aE127AY183F IN COMPLEX WITH PENTA-Nag Length = 273 Back     alignment and structure
>pdb|2GSJ|A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity Length = 271 Back     alignment and structure
>pdb|3D5H|A Chain A, Crystal Structure Of Haementhin From Haemanthus Multiflorus At 2.0a Resolution: Formation Of A Novel Loop On A Tim Barrel Fold And Its Functional Significance Length = 272 Back     alignment and structure
>pdb|3O9N|A Chain A, Crystal Structure Of A New Form Of Xylanase-A-Amylase Inhibitor Protein(Xaip-Iii) At 2.4 A Resolution Length = 272 Back     alignment and structure
>pdb|3MU7|A Chain A, Crystal Structure Of The Xylanase And Alpha-Amylase Inhibitor Protein (Xaip-Ii) From Scadoxus Multiflorus At 1.2 A Resolution Length = 273 Back     alignment and structure
>pdb|1OM0|A Chain A, Crystal Structure Of Xylanase Inhibitor Protein (Xip-I) From Wheat Length = 274 Back     alignment and structure
>pdb|2UY2|A Chain A, Sccts1_apo Crystal Structure Length = 294 Back     alignment and structure
>pdb|1CNV|A Chain A, Crystal Structure Of Concanavalin B At 1.65 A Resolution Length = 299 Back     alignment and structure
>pdb|2XVN|A Chain A, A. Fumigatus Chitinase A1 Phenyl-Methylguanylurea Complex Length = 309 Back     alignment and structure
>pdb|2XUC|A Chain A, Natural Product-Guided Discovery Of A Fungal Chitinase Inhibitor Length = 310 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
1ta3_A 274 XIP-1, xylanase inhibitor protein I; beta alpha ba 8e-36
3mu7_A 273 XAIP-II, xylanase and alpha-amylase inhibitor prot 1e-33
2gsj_A 271 Protein PPL-2; mimosoideae, chimerolectin, endochi 4e-33
2hvm_A 273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 6e-32
2uy2_A 294 Endochitinase; carbohydrate metabolism, polysaccha 2e-28
1cnv_A 299 Concanavalin B; plant chitinase, chitin binding pr 6e-28
2xtk_A 310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 4e-23
3ebv_A 302 Chinitase A; chitinase A, CHIA, glycosidase, struc 1e-22
3ian_A 321 Chitinase; structural genomics, hydrolase, glycosi 3e-20
3n12_A 333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 2e-18
2y8v_A 290 CHIC, class III chitinase, putative; afchic, hydro 4e-14
2dsk_A 311 Chitinase; catalytic domain, active domain, crysta 1e-07
2ebn_A 289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 6e-05
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Length = 274 Back     alignment and structure
 Score =  123 bits (309), Expect = 8e-36
 Identities = 42/128 (32%), Positives = 60/128 (46%), Gaps = 19/128 (14%)

Query: 23  DASGITIYWVQNGIQSTFMETCTTSNYDFVNLAF-----------------CPPLEIIDI 65
               +T++W +N  + +  E C +  Y  V ++F                        DI
Sbjct: 4   KTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADI 63

Query: 66  KSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSS--RPLGNAVLDGI 123
           K CQ+KGV V LSI G    Y L  +  A  + D+LWN++ GG   S  RP G+A LDG+
Sbjct: 64  KHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGV 123

Query: 124 DFGIEGGT 131
           D  +E GT
Sbjct: 124 DLFLEHGT 131
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Length = 273 Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Length = 271 Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Length = 273 Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Length = 294 Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Length = 299 Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Length = 310 Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
3mu7_A 273 XAIP-II, xylanase and alpha-amylase inhibitor prot 100.0
1ta3_A 274 XIP-1, xylanase inhibitor protein I; beta alpha ba 100.0
2xtk_A 310 CHIA1, class III chitinase CHIA1; hydrolase, GH18; 100.0
1cnv_A 299 Concanavalin B; plant chitinase, chitin binding pr 100.0
2gsj_A 271 Protein PPL-2; mimosoideae, chimerolectin, endochi 100.0
2hvm_A 273 Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He 100.0
2uy2_A 294 Endochitinase; carbohydrate metabolism, polysaccha 100.0
4axn_A 328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 99.85
3ebv_A 302 Chinitase A; chitinase A, CHIA, glycosidase, struc 99.84
1eok_A 290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 99.79
2dsk_A 311 Chitinase; catalytic domain, active domain, crysta 99.78
3n12_A 333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 99.71
2y8v_A 290 CHIC, class III chitinase, putative; afchic, hydro 99.67
3ian_A 321 Chitinase; structural genomics, hydrolase, glycosi 99.67
4ac1_X 283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 99.62
2ebn_A 289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 99.48
1edt_A 271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 99.47
3qok_A 420 Putative chitinase II; structural genomics, PSI-bi 99.45
1nar_A 290 Narbonin; plant SEED protein; 1.80A {Vicia narbone 99.38
3fnd_A 312 Chitinase; TIM-barrel, structural genomics, PSI-2, 99.24
3poh_A 451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 99.2
4ay1_A 365 Chitinase-3-like protein 2; chilectin, lectin, chi 99.06
3alf_A 353 Chitinase, class V; hydrolase; 1.20A {Nicotiana ta 99.05
3cz8_A 319 Putative sporulation-specific glycosylase YDHD; st 99.05
3fy1_A 395 Amcase, TSA1902, acidic mammalian chitinase; struc 99.04
3g6m_A 406 Chitinase, crchi1; inhibitor, caffeine, glycosidas 99.03
1w9p_A 433 Chitinase; peptide inhibitors, argifin, argadin, g 99.01
3aqu_A 356 AT4G19810; stress response, TIM barrel, hydrolase, 99.0
3sim_A 275 Protein, family 18 chitinase; family 18 plant chit 98.97
1vf8_A 377 YM1, secretory protein; chitinase, CHI-lectin, str 98.96
1wb0_A 445 Chitinase 1, chitotriosidase 1; cyclopentapeptide 98.96
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 98.94
1kfw_A 435 Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob 98.93
2pi6_A 361 Chitinase-3-like protein 1; complex, signaling pro 98.9
1jnd_A 420 Imaginal DISC growth factor-2; IDGF, chitinase, in 98.9
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 98.88
1itx_A 419 Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) 98.83
1ll7_A 392 Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { 98.82
1goi_A 499 Chitinase B; chitin degradation, hydrolase, glycos 98.82
3oa5_A 574 CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers 98.67
3bxw_B 393 Chitinase domain-containing protein 1; TIM barrel, 98.39
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 92.53
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 92.13
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 90.14
1xrs_B262 D-lysine 5,6-aminomutase beta subunit; TIM barrel, 88.34
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 87.75
1jfx_A 217 1,4-beta-N-acetylmuramidase M1; beta-alpha-barrel, 86.07
3bul_A 579 Methionine synthase; transferase, reactivation con 83.99
>3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Back     alignment and structure
Probab=100.00  E-value=6.7e-42  Score=281.22  Aligned_cols=109  Identities=48%  Similarity=0.729  Sum_probs=103.2

Q ss_pred             CCceEEEccCCCCCCchhhhhcCCCccEEEeeeCC-----------------CchhHhHHHHHHCCCeEEEeeecCCccc
Q 048651           24 ASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCP-----------------PLEIIDIKSCQAKGVKVMLSIEGGAGNY   86 (134)
Q Consensus        24 ~~~i~~YWGq~~~~~~L~~~C~~~~ydiV~laF~~-----------------P~~~~dI~~CQ~~GkkVlLSlGG~~g~~   86 (134)
                      +++|++|||||++|++|+++|++++||||+|||++                 ++|.+|||+||++||||||||||++|+|
T Consensus         2 ~~~iavYWGqn~~~~~L~~~C~~~~y~~v~laFl~~~g~g~~p~~nl~~~c~~~l~~dI~~cQ~~G~kVlLSiGG~~g~~   81 (273)
T 3mu7_A            2 SLDIAVYWGQSFDERSLEATCDSGNYAYVIIGFLNTFGGGQTPALDISGHSPKGLEPQIKHCQSKNVKVLLSIGGPAGPY   81 (273)
T ss_dssp             CCCEEEEECSCTTSCCHHHHHHTSCCSEEEEEEEEEBSTTCCCEECSTTCCTTTHHHHHHHHHHTTCEEEEEEEESSCSB
T ss_pred             CCCEEEECCCCCCCCCHHHHhcCCCCCEEEEEeEeccCCCCCccccccccchHHHHHHHHHHHHCCCEEEEEeccCCCce
Confidence            47899999999999999999999999999999991                 3599999999999999999999999999


Q ss_pred             ccCCHHHHHHHHHHHHHhhC---CCCCCCcCCCCcccceeeeecCCCCC
Q 048651           87 YLSFSEDARQVADYLWNNFL---GGQSSSRPLGNAVLDGIDFGIEGGTI  132 (134)
Q Consensus        87 ~l~s~~~A~~fA~~Lw~~f~---~g~s~~RPfg~~~lDG~D~DiE~g~~  132 (134)
                      +|+|+++|++||++||++|+   +|++.+||||+++|||||||||++.+
T Consensus        82 ~l~s~~~a~~fa~~l~~~f~p~~~g~~~~rp~g~~~lDGiD~D~E~~~~  130 (273)
T 3mu7_A           82 SLDSRNDANDLAVYLHKNFLLPPAGTSESRPFGNAVLDGIDFHIEHGGP  130 (273)
T ss_dssp             CCCSHHHHHHHHHHHHHHHTSCCCSSCCCCTTTTCCCSEEEEEECSSCS
T ss_pred             ecCCHHHHHHHHHHHHHHhccccCCCcccccccccccCceEeecccCCc
Confidence            99999999999999999998   67888999999999999999999864
>1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Back     alignment and structure
>2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Back     alignment and structure
>1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Back     alignment and structure
>2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Back     alignment and structure
>2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Back     alignment and structure
>2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Back     alignment and structure
>3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Back     alignment and structure
>1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Back     alignment and structure
>3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Back     alignment and structure
>1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Back     alignment and structure
>1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Back     alignment and structure
>1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Back     alignment and structure
>1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Back     alignment and structure
>1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Back     alignment and structure
>3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Back     alignment and structure
>3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1 Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>1jfx_A 1,4-beta-N-acetylmuramidase M1; beta-alpha-barrel, cellosyl, lysozyme, hydrolase; 1.65A {Streptomyces coelicolor} SCOP: c.1.8.8 Back     alignment and structure
>3bul_A Methionine synthase; transferase, reactivation conformation, cobalamin, intermodular interactions, amino-acid biosynthesis, cobalt; HET: B12; 2.30A {Escherichia coli} SCOP: a.46.1.1 c.23.6.1 d.173.1.1 PDB: 3iv9_A* 3iva_A* 1k7y_A* 1k98_A* 1bmt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d1ta3a_ 274 c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { 6e-29
d2hvma_ 273 c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para 1e-26
d1cnva_ 283 c.1.8.5 (A:) Seed storage protein {Jack bean (Cana 5e-25
d1eoka_ 282 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 1e-11
d1edta_ 265 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St 5e-06
d1nara_ 289 c.1.8.5 (A:) Seed storage protein {Vicia narbonens 4e-05
d2ebna_ 285 c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl 0.002
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Xylanase inhibitor protein I, XIP-I
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score =  104 bits (259), Expect = 6e-29
 Identities = 43/130 (33%), Positives = 61/130 (46%), Gaps = 19/130 (14%)

Query: 21  GDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAF-----------------CPPLEII 63
           G     +T++W +N  + +  E C +  Y  V ++F                        
Sbjct: 2   GGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGA 61

Query: 64  DIKSCQAKGVKVMLSIEGGAGNYYLSFSEDARQVADYLWNNFLGGQSSS--RPLGNAVLD 121
           DIK CQ+KGV V LSI G    Y L  +  A  + D+LWN++ GG   S  RP G+A LD
Sbjct: 62  DIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLD 121

Query: 122 GIDFGIEGGT 131
           G+D  +E GT
Sbjct: 122 GVDLFLEHGT 131
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 Back     information, alignment and structure
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d1ta3a_ 274 Xylanase inhibitor protein I, XIP-I {Wheat (Tritic 100.0
d1cnva_ 283 Seed storage protein {Jack bean (Canavalia ensifor 100.0
d2hvma_ 273 Hevamine A (chitinase/lysozyme) {Para rubber tree 100.0
d1eoka_ 282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.89
d2ebna_ 285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 99.74
d1edta_ 265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 99.66
d1nara_ 289 Seed storage protein {Vicia narbonensis, Narbonin 99.61
d1wb0a1 297 Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 99.2
d1kfwa1 374 Psychrophilic chitinase B {Arthrobacter sp., tad20 99.18
d1w9pa1 333 Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} 99.17
d2pi6a1 292 Signal processing protein (SPC-40, MGP-40) {Sheep 99.11
d1itxa1 347 Chitinase A1 {Bacillus circulans [TaxId: 1397]} 99.02
d1ll7a1 330 Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 99.01
d1vf8a1 302 Chitinase-like lectin ym1, saccharide binding doma 98.96
d1edqa2 358 Chitinase A, catalytic domain {Serratia marcescens 98.84
d1goia2 356 Chitinase B, catalytic domain {Serratia marcescens 98.81
d1jnda1 327 Imaginal disc growth factor-2 {Fruit fly (Drosophi 98.8
d2aama1 285 Hypothetical protein TM1410 {Thermotoga maritima [ 85.7
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 85.43
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 82.73
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 81.2
>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Xylanase inhibitor protein I, XIP-I
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=100.00  E-value=4.4e-38  Score=251.15  Aligned_cols=112  Identities=38%  Similarity=0.693  Sum_probs=104.9

Q ss_pred             CCCCCceEEEccCCCCCCchhhhhcCCCccEEEeeeCC-----------------CchhHhHHHHHHCCCeEEEeeecCC
Q 048651           21 GDDASGITIYWVQNGIQSTFMETCTTSNYDFVNLAFCP-----------------PLEIIDIKSCQAKGVKVMLSIEGGA   83 (134)
Q Consensus        21 ~~~~~~i~~YWGq~~~~~~L~~~C~~~~ydiV~laF~~-----------------P~~~~dI~~CQ~~GkkVlLSlGG~~   83 (134)
                      .+++++|++|||||.++++|+++|+++.||||+|||++                 |++++||++||++||||||||||++
T Consensus         2 ~~~t~~i~~YWGq~~~~~~L~~~c~~~~~~~I~laF~~~~~~~~~~~~~~~~~~~~~~~~~I~~~q~~g~KVllSiGG~~   81 (274)
T d1ta3a_           2 GGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYG   81 (274)
T ss_dssp             CCCCCCEEEEESSCGGGCCHHHHHHTTCCSEEEEEEEEEBSSSSCCEECCTTCCGGGHHHHHHHHHHTTCCEEEEEEESS
T ss_pred             CCCCCcEEEEcCCCCCCCChHHHcCCCCCCEEEEEEEEEcCCCCeeeccCCCCChhHHHHHHHHHHhCCCEEEEEEcCCC
Confidence            46678999999999999999999999999999999992                 4599999999999999999999999


Q ss_pred             cccccCCHHHHHHHHHHHHHhhCCCC--CCCcCCCCcccceeeeecCCCCC
Q 048651           84 GNYYLSFSEDARQVADYLWNNFLGGQ--SSSRPLGNAVLDGIDFGIEGGTI  132 (134)
Q Consensus        84 g~~~l~s~~~A~~fA~~Lw~~f~~g~--s~~RPfg~~~lDG~D~DiE~g~~  132 (134)
                      +++++++.+++++||++||++|+++.  +..|||++++|||||||+|++.+
T Consensus        82 ~~~~~~~~~~~~~~a~~l~~~~~~~~~~s~~~~~~~~~~DGiDiD~E~~~~  132 (274)
T d1ta3a_          82 TGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTP  132 (274)
T ss_dssp             SCBCCCSHHHHHHHHHHHHHHHSSCCCTTSCCTTTTCCCSEEEEEESSCCT
T ss_pred             CCccccchhHHHHHHHHHHHhhcccchhhHHHHhhccceeeEEeccccCCC
Confidence            99999999999999999999999874  67999999999999999999865
>d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Back     information, alignment and structure
>d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Back     information, alignment and structure
>d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure