Citrus Sinensis ID: 048779

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-

MLLNSRHGYLAHSILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTDGSSSREAETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLEYLRLYICEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEEGIHSSSSSSRRYNSSLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGLPTDLRSLEIIFNTKIWKSMIERGQGFHRFSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYWDLLIHIPFVLLDYKWVFGD

cccccccccccccccccccccccEEEEEccccccccccccccccccccEEEccccccccccccccccccccEEcccccccccccHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEcccccccccHHHHHHcccccccccEEEEEEcccccccccccHHHHHHHccccccccccccEEEEEcccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccEEEcccccccccccEEEEEEccccccccccccccccccEEEEccccccccccccccccccEEEEEcccccHHHHHcccccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEccc

cccccccccccccHHHHHHcccccEEEEEEccccccccccccccHHEEEEEcccccccccccHHHHHHHHHHEEHcccHHHHcccHHHHccccccEEEccccccHHcccccccccccccEEcEEEEcccccccHHHHHcHHHccccEEEccccccccHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHccccccccEEEEEcccccccccHcccccccccEEEEEcccccccccccccccccccEEEEccccccEEccHHHcccccccccccccEEEEcccHHHHHHccccccccccccccccEEEEcccHHHHHccccccccccEEEEcccccccccccccHHHHHcEcccccccccccccccccccccccccHHHHcccHHHcccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEccccccccccHHcccccccccccccccccEEEEcccccHHcccccccccccccEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccccEEEEcccccccccccccccccccEEEEcccccHccccHHccccHHHHcccccccccccEEEcccccccccccHHccccccccHHccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccEEEEEccHHHHHHHHHHHcHccccccccEEEEccccccccccccccccccccHHccccccccEEEEcccccHHcccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHccccccccccEEEccEEEEccEEEEcc

mllnsrhgylahsiLPKLFKLQSLRVfslrgyriselpdsvgdlrylrhlnlsgteirtlPESVNKLYNLHTLLLVGCRRLKKLCADMGnliklhhlnnsntdllkempvgigKLTCLQTLCNfvvgkdsgsglpELKLLMHLRGtlkisklenvkdvgnakeAQMDGKKNLRELLLRWTcctdgsssreaetemgvldmlkphknleqfyicgyggtkfptwlgdssfsnlvtlkfedcgmctalpsvgqlpslkhltVRGMSRVkrlgsefygndspipfpcletlrfedmqewedwiphgssqgverfpklRELHILRCSklrgtfpkclpALQMLVIYRCEefsvsvtslpalcnlqingCEELSVSLTslpalcnlqigrceelsvsvtslpalcnlqigplkpripkleelginnikneTCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLEYLRLYICEGLVKLPQSLLSLSSLREIFIGGCnslvsfpevalpsklkkIEISECdalkslpeawmcdtnssleILYIESCHSLRYiagvqlppslktlfidecgnirTLTVEEgihssssssrRYNSSLLehlgirycpsltcifsknelpatleslevgnlppslksLCVYGCSKLESIAErlddntslkIIRIDFCEKLKILPSGLHNLRQLLEIKIWwcgnlvtfpegglpcakltrleiydckrlealpkglHNLKSLQelriggelpsleeddglptdlRSLEIIFNTKIWKSMIErgqgfhrfsslrhlsiegcdddmvsfppeaedkrlgtalplpasltsmwigdfpnlerlsssivdlqnltelrlhdcpklkyfpekglpssllqlqiwgcplmkekcrkdggqYWDLLIHIPFVLLdykwvfgd

MLLNSRHGYLAhsilpklfklQSLRVFSLRGYRIselpdsvgdlryLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRgtlkisklenvkdvgnakeaqmdgkknlRELLLRWTCctdgsssreAETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALpsvgqlpslkhlTVRGMSRVKRlgsefygndspipfPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLEYLRLYICEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVeegihssssssRRYNSSLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIaerlddntslKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGLPTDLRSLEIIFNTKIWKSMIERGQGFHRFSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYWDLLIHIPFVLLDYKWVFGD

MLLNSRHGYLAHSILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTDGSSSREAETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLEYLRLYICEGLVKLPQsllslsslREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEEGIHssssssrrynssLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGLPTDLRSLEIIFNTKIWKSMIERGQGFHRFSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYWDLLIHIPFVLLDYKWVFGD

******HGYLAHSILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKD*************NLRELLLRWTCCTD***********GVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCS****************LCEFSCRLEYLRLYICEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEEG*************SLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGG**********LPTDLRSLEIIFNTKIWKSMIERGQGFHRFSSLRHLSIEGCDDDMV**********LGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYWDLLIHIPFVLLDYKWVF**

ML******YLA*SILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTD*******ETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLEYLRLYICEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEE************NSSLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGLPTDLRSLEIIFNTKIWKSMIERGQGFHRFSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYWDLLIHIPFVLLDYKWVFGD

MLLNSRHGYLAHSILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTD********TEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSL**********KLCEFSCRLEYLRLYICEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEE************NSSLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGLPTDLRSLEIIFNTKIWKSMIERGQGFHRFSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYWDLLIHIPFVLLDYKWVFGD

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		911	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.358	0.310	0.418	2e-64
Q9LRR5		1424	Putative disease resistan	no	no	0.364	0.233	0.435	2e-64
Q7XBQ9		970	Disease resistance protei	N/A	no	0.448	0.421	0.336	6e-43
Q7XA39		988	Putative disease resistan	N/A	no	0.462	0.426	0.326	9e-43
Q7XA42		979	Putative disease resistan	N/A	no	0.448	0.417	0.313	3e-41
Q7XA40		992	Putative disease resistan	N/A	no	0.492	0.452	0.320	6e-40
P0CB16		1201	Putative disease resistan	no	no	0.604	0.458	0.238	2e-08
P0DI18		1049	Probable disease resistan	no	no	0.376	0.326	0.257	4e-08
P0DI17		1049	Probable disease resistan	no	no	0.376	0.326	0.257	4e-08
Q9V780		849	Protein lap1 OS=Drosophil	yes	no	0.264	0.283	0.274	8e-08

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  248 bits (632), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 146/349 (41%), Positives = 209/349 (59%), Gaps = 22/349 (6%)

Query: 10  LAHSILPKLFKLQSLRVFSLRGYRISELP-DSVGDLRYLRHLNLSGTEIRTLPESVNKLY 68
           ++  +LP L +L   RV SL  Y+I+ LP D   ++ + R L+LS TE+  LP+S+  +Y
Sbjct: 569 VSEKLLPTLTRL---RVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMY 625

Query: 69  NLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGK 128
           NL TLLL  C  LK+L  D+ NLI L +L+   T L ++MP   G+L  LQTL  F V  
Sbjct: 626 NLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKL-RQMPRRFGRLKSLQTLTTFFVSA 684

Query: 129 DSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTDGSSS 188
             GS + EL  L  L G LKI +L+ V DV +A EA ++ KK+LRE+   W     GSSS
Sbjct: 685 SDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRT---GSSS 741

Query: 189 REAET-------EMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCG 241
            E  T       E  V + L+PH+++E+  I  Y G +FP WL D SFS +V ++  +C 
Sbjct: 742 SENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQ 801

Query: 242 MCTALPSVGQLPSLKHLTVRGMSRVKRLGSEFYGN------DSPIPFPCLETLRFEDMQE 295
            CT+LPS+GQLP LK L + GM  ++ +G +FY +          PF  LETLRF+++ +
Sbjct: 802 YCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPD 861

Query: 296 WEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRC 344
           W++W+    ++G + FP L++L ILRC +L GT P  LP+L  L IY+C
Sbjct: 862 WQEWLDVRVTRG-DLFPSLKKLFILRCPELTGTLPTFLPSLISLHIYKC 909

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|P0CB16\|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

>sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1	Back alignment and function description

>sp\|Q9V780\|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		911
400131587		1388	FB_MR5 [Malus x robusta]	0.879	0.577	0.408	1e-156
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.919	0.588	0.401	1e-154
356554923		1399	PREDICTED: putative disease resistance R	0.874	0.569	0.376	1e-134
224059584		1418	cc-nbs-lrr resistance protein [Populus t	0.908	0.583	0.389	1e-133
225449649		1418	PREDICTED: putative disease resistance p	0.900	0.578	0.392	1e-131
359495024		1390	PREDICTED: putative disease resistance p	0.870	0.570	0.381	1e-127
359495026		2204	PREDICTED: uncharacterized protein LOC10	0.852	0.352	0.383	1e-125
359487225		1373	PREDICTED: putative disease resistance R	0.868	0.576	0.365	1e-125
45826061		739	resistance protein [Quercus suber]	0.803	0.990	0.387	1e-124
359487424		1453	PREDICTED: putative disease resistance R	0.909	0.570	0.378	1e-124

>gi\|400131587\|emb\|CCH50986.1\| FB_MR5 [Malus x robusta]	Back alignment and taxonomy information

 Score =  558 bits (1438), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 374/916 (40%), Positives = 523/916 (57%), Gaps = 115/916 (12%)

Query: 10   LAHSILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYN 69
            +A  +LPKL   Q LRV S   Y+I+ELPDS+GDLRYLR+L+LS T+I +LP+S + LYN
Sbjct: 571  VAFDLLPKL---QYLRVLSFNCYKITELPDSIGDLRYLRYLDLSYTDITSLPKSTSTLYN 627

Query: 70   LHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVG-- 127
            L TL+L GC +LK L  DM NL+ L HLNNSN  LL++MP  +G+L  LQ+L  FVV   
Sbjct: 628  LQTLILEGCSKLKALPIDMSNLVNLRHLNNSNVSLLEDMPPQLGRLVNLQSLTKFVVSGG 687

Query: 128  -KDSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTDGS 186
                 SG+ EL+ LMHLRGTL IS+LENV DV +A+ A ++ K+ L  L+L W+      
Sbjct: 688  GGGDRSGIRELEFLMHLRGTLCISRLENVTDVEDAQRANLNCKERLDSLVLEWS-----H 742

Query: 187  SSREAETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTAL 246
            SS   ETE  VLDML+PH  L++  I  Y G +F +W+G   FSN+V ++ E+C  C +L
Sbjct: 743  SSDTRETESAVLDMLQPHTKLKELTIKSYAGKEFSSWVGVPLFSNMVLVRLEECNNCLSL 802

Query: 247  PSVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQ 306
            P +G+LP LK L +RGM+ V+ +G+EFYG +  +PFP LETL F DMQ W+ W+P  +  
Sbjct: 803  PPLGKLPHLKELYIRGMNAVESVGAEFYG-ECSLPFPLLETLEFVDMQHWKVWLPFQTDH 861

Query: 307  GVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCE 366
                FP L+ L + +CSKL G  P+ L +L  L I +CEE  VS+ +   L  L I+GC+
Sbjct: 862  RGSVFPCLKTLLVRKCSKLEGKLPENLDSLASLEIVKCEELLVSIANYKQLRQLNIDGCK 921

Query: 367  ELSVSLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPL-KPRIPKLEELGINNIKNE 425
                 +    A    ++      S+ ++++  L +LQ G L +  +  + +L IN  +  
Sbjct: 922  ----GVVHTAAKVEFELLE----SLYLSNISELTSLQTGELCRNGLNMVRDLKINGCEEL 973

Query: 426  TCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEE---EEDQRQKLCEFSCRLEYLRLYI 482
            T   K+   LLQ + SL RL I       SL+ EE   E D+  +L    C+LE+L+L  
Sbjct: 974  TSSLKNEAILLQQLISLGRLEIED----NSLLVEELGKEADELLQLQILGCKLEFLKLKK 1029

Query: 483  CEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPEVALPSKLKKIEISECDALKSLPEAWMC 542
            C+ L+KLP+ L  LSSL+E+ I  C+SLVSFP+V LP  LK IEI+E             
Sbjct: 1030 CKNLLKLPEGLNQLSSLQELRIHECSSLVSFPDVGLPPSLKDIEITE------------- 1076

Query: 543  DTNSSLEILYIESCHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEEGIHSSSSSSRRYN 602
                         CHSL Y A  Q+P +L+ + I +C ++R+L   E + S SSSS    
Sbjct: 1077 -------------CHSLIYFAKSQIPQNLRRIQIRDCRSLRSLVDNEAVGSCSSSSH--- 1120

Query: 603  SSLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVYGCSKLESIAERLDD 662
             + LE+L I  C SLT +   ++L   L  L+            +Y C +LE +A     
Sbjct: 1121 -NCLEYLNIERCQSLTLLSLSDQLVRALRELD------------IYDCEQLEFLA----- 1162

Query: 663  NTSLKIIRIDFCEKLKILPSGL--HNLRQLLE-IKIWWCGNLVTFPE--GGLPCAKLTRL 717
                              P GL  +N    LE  +I  C NL + P   GG+  + L  +
Sbjct: 1163 ------------------PDGLFCNNTNYFLENFRIRRCQNLKSLPRLSGGIRGSNLREI 1204

Query: 718  EIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGL----PTDLRSLEIIFNTKIWK 773
             I DC RLEALP+ +HN  SL++L I       +  +GL    P +L SL +I+  K  K
Sbjct: 1205 RITDCDRLEALPEDMHNFNSLEKLII-------DYREGLTCSFPANLTSL-MIWKVKSCK 1256

Query: 774  SMIERGQGFHRFSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNL 833
            S+ E   G HR +SLR+L I G D DMVSFPP+    R+ T   LP SLT + IG FPNL
Sbjct: 1257 SLWELEWGLHRLTSLRYLWIGGEDPDMVSFPPDM--VRMETL--LPKSLTELSIGGFPNL 1312

Query: 834  ERLSSSIVD-LQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMKEKCRKDGGQYW 892
            ++LSS     L +L  L L DCPKL   P++GLP SL +L I+GCP++KE+C+   G+YW
Sbjct: 1313 KKLSSKGFQFLTSLESLELWDCPKLASIPKEGLPLSLTELCIYGCPVLKERCQPGKGRYW 1372

Query: 893  DLLIHIPFVLLDYKWV 908
              + HIP++ +D+K +
Sbjct: 1373 HKISHIPYIDIDWKMI 1388

Source: Malus x robusta

Species: Malus x robusta

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|224059584\|ref\|XP_002299919.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222847177\|gb\|EEE84724.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225449649\|ref\|XP_002262753.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495024\|ref\|XP_002267933.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495026\|ref\|XP_003634900.1\| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487225\|ref\|XP_002268551.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|45826061\|gb\|AAS77675.1\| resistance protein [Quercus suber]	Back alignment and taxonomy information

>gi\|359487424\|ref\|XP_002271822.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		911
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.371	0.237	0.432	3e-84
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.487	0.421	0.365	5.2e-64
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.874	0.442	0.259	5.2e-14
TAIR\|locus:2094498		1981	AT3G25510 [Arabidopsis thalian	0.363	0.167	0.244	5.9e-12
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.461	0.324	0.247	1.4e-10
TAIR\|locus:2205804		1556	AT1G27180 [Arabidopsis thalian	0.445	0.260	0.249	4.3e-09
TAIR\|locus:2205824		1384	AT1G27170 [Arabidopsis thalian	0.450	0.296	0.280	2.4e-10
TAIR\|locus:2117617		549	PIRL4 "plant intracellular ras	0.113	0.187	0.339	7.1e-10
TAIR\|locus:2129236		1301	SNC1 "SUPPRESSOR OF NPR1-1, CO	0.455	0.318	0.245	7.8e-10
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.347	0.260	0.259	9e-10

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 641 (230.7 bits), Expect = 3.0e-84, Sum P(2) = 3.0e-84
 Identities = 151/349 (43%), Positives = 206/349 (59%)

Query:    10 LAHSIL-PKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLY 68
             L   +L P L  L  LR+ SL  Y+I+ LP S+  L+ LR+L+LS T+I+ LPE V  L 
Sbjct:   560 LTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLC 619

Query:    69 NLHTLLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGK 128
             NL TLLL  CR L  L   +  LI L  L+   T L+ EMP GI KL  LQ L NFV+G+
Sbjct:   620 NLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLV-EMPPGIKKLRSLQKLSNFVIGR 678

Query:   129 DSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTC----CTD 184
              SG+GL ELK L HLRGTL+IS+L+NV     AK+A +  K  L  L+L+WT        
Sbjct:   679 LSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVP 738

Query:   185 GSSSREAETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCT 244
             GS +  A  +  VL ML+PH +L+ F I  Y G  FP WLGDSSF  + ++    C +C 
Sbjct:   739 GSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCI 798

Query:   245 ALPSVGQLPSLKHLTVRGMSRVKRLGSEFY---GNDSPIPFPCLETLRFEDMQEWEDWIP 301
             +LP VGQLPSLK+L++   + ++++G +F+    N   +PF  L+ L+F  M  W++WI 
Sbjct:   799 SLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWIC 858

Query:   302 HGSSQGVERFPKLRELHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVS 350
                  G+  FP L++L I RC  LR  FP+ LP+   + I  C   +VS
Sbjct:   859 PELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVS 905

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2117617 PIRL4 "plant intracellular ras group-related LRR 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		911
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-09
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-08
PLN03210		1153	PLN03210, PLN03210, Resistant to P	7e-06
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.002
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	0.002
PRK15370		754	PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl	0.002

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score = 60.7 bits (147), Expect = 3e-09
 Identities = 67/236 (28%), Positives = 102/236 (43%), Gaps = 22/236 (9%)

Query: 651 SKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLP 710
           SKLE + + +   T L+ I +   + LK +P  L     L  +K+  C +LV  P     
Sbjct: 621 SKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQY 679

Query: 711 CAKLTRLEIYDCKRLEALPKGLHNLKSLQELRIGGELPSLEEDDGLPTDLRSLEIIFNTK 770
             KL  L++  C+ LE LP G+ NLKSL  L + G            + L+S   I    
Sbjct: 680 LNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSG-----------CSRLKSFPDISTNI 727

Query: 771 IWKSMIERGQGFHRFSSLRHLSIEGCDD-DMVSFPPEAEDKRLGTALPL----PASLTSM 825
            W  +         F S  +L +E  D+  +     E   +R+    PL      SLT +
Sbjct: 728 SW--LDLDETAIEEFPS--NLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRL 783

Query: 826 WIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKGLPSSLLQLQIWGCPLMK 881
           ++ D P+L  L SSI +L  L  L + +C  L+  P      SL  L + GC  ++
Sbjct: 784 FLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLR 839

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		911
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.93
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.93
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.9
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.9
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.89
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.89
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.89
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.83
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.57
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.57
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.56
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.55
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.51
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.45
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.43
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.35
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.32
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.26
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.2
KOG4341		483	consensus F-box protein containing LRR [General fu	99.14
KOG4341		483	consensus F-box protein containing LRR [General fu	99.1
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.02
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.02
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.92
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.78
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.73
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.72
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.7
PLN03150		623	hypothetical protein; Provisional	98.7
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.68
PRK15386		426	type III secretion protein GogB; Provisional	98.57
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.49
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.44
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.42
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.39
PLN03150		623	hypothetical protein; Provisional	98.37
PRK15386		426	type III secretion protein GogB; Provisional	98.36
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.29
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.26
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.21
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.21
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.17
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.13
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.03
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.03
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.9
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.74
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.66
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.64
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.6
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.59
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.57
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.52
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.45
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.39
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.37
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.03
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.03
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.01
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.91
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.81
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.09
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.94
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.91
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.01
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.72
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.48
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.34
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.68
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	92.54
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.19
KOG0473		326	consensus Leucine-rich repeat protein [Function un	92.18
KOG3864		221	consensus Uncharacterized conserved protein [Funct	91.65
KOG3864		221	consensus Uncharacterized conserved protein [Funct	90.75
smart00370		26	LRR Leucine-rich repeats, outliers.	90.6
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	90.6
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.47
smart00370		26	LRR Leucine-rich repeats, outliers.	83.47

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.9e-37  Score=383.20  Aligned_cols=511  Identities=19%  Similarity=0.193  Sum_probs=283.6

Q ss_pred             eeeccCCcccccccccccCCCCCCEEEccCCCCc-cccccc-cCCCCCCeEEccCCCCC-cCChhhhcCCCccEEecCCc
Q 048779            2 LLNSRHGYLAHSILPKLFKLQSLRVFSLRGYRIS-ELPDSV-GDLRYLRHLNLSGTEIR-TLPESVNKLYNLHTLLLVGC   78 (911)
Q Consensus         2 ~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~-~lp~~~-~~l~~L~~L~L~~~~l~-~lp~~~~~L~~L~~L~l~~~   78 (911)
                      .|||++|.+++.++++|..+++|++|+|++|.++ .+|..+ ..+++||+|++++|+++ .+|.  ..+++|++|++++|
T Consensus        73 ~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n  150 (968)
T PLN00113         73 SIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNN  150 (968)
T ss_pred             EEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCC
Confidence            4667777777766666777777777777777765 565544 36777777777777665 3342  45667777777776


Q ss_pred             cccccchhhhhccCcccEEEcCCCcccccCcCCCCCccccccccceeccCCCCCChhhhhhhhccccceeecccCCCCCh
Q 048779           79 RRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKDV  158 (911)
Q Consensus        79 ~~~~~lp~~i~~L~~L~~L~L~~~~~~~~~p~~~~~L~~L~~L~~~~~~~~~~~~l~~l~~L~~L~~~l~~~~l~~~~~~  158 (911)
                      .....+|..++++++|++|++++|.+.+.+|..++++++|+.|+                                    
T Consensus       151 ~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~------------------------------------  194 (968)
T PLN00113        151 MLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLT------------------------------------  194 (968)
T ss_pred             cccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeee------------------------------------
Confidence            55556666677777777777777764455665565555555553                                    


Q ss_pred             hhhhhhccCCCCCccEEEEEEeecCCCCCCccchhhcccCCCCCCCCCccEEEEeeeCCC-CCCCCcCCCCCCcccEEEE
Q 048779          159 GNAKEAQMDGKKNLRELLLRWTCCTDGSSSREAETEMGVLDMLKPHKNLEQFYICGYGGT-KFPTWLGDSSFSNLVTLKF  237 (911)
Q Consensus       159 ~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~p~~l~~~~~~~L~~L~L  237 (911)
                                        +++|..           ....+..+..+++|+.|++.+|... .+|..+..  +++|+.|++
T Consensus       195 ------------------L~~n~l-----------~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~--l~~L~~L~L  243 (968)
T PLN00113        195 ------------------LASNQL-----------VGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG--LTSLNHLDL  243 (968)
T ss_pred             ------------------ccCCCC-----------cCcCChHHcCcCCccEEECcCCccCCcCChhHhc--CCCCCEEEC
Confidence                              211111           0001122233344444444444433 23444433  555666666


Q ss_pred             eCCCCCCCCC-CCCCcCcccceeccccccccccCccccCCCCCCCCCCcceEEeccCcccccccccCCCCccccCCccce
Q 048779          238 EDCGMCTALP-SVGQLPSLKHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRE  316 (911)
Q Consensus       238 ~~~~~~~~l~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~  316 (911)
                      ++|...+.+| .++.+++|++|++++|.....++..                                   ...+++|++
T Consensus       244 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~-----------------------------------l~~l~~L~~  288 (968)
T PLN00113        244 VYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS-----------------------------------IFSLQKLIS  288 (968)
T ss_pred             cCceeccccChhHhCCCCCCEEECcCCeeeccCchh-----------------------------------HhhccCcCE
Confidence            5555544444 4555555555555555321111111                                   234555666


Q ss_pred             eecccCCCcccCCCCCCCccceEEEeccCCcccccCCCCccceEEEcCCcchhhhcccccccccccccccCCcccccccc
Q 048779          317 LHILRCSKLRGTFPKCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVSLTSLPALCNLQIGRCEELSVSVTSL  396 (911)
Q Consensus       317 L~l~~c~~l~~~~~~~l~~L~~L~l~~~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~  396 (911)
                      |++++| .+.+.+|..                  +..+++|+.|++++|.....                     ....+
T Consensus       289 L~Ls~n-~l~~~~p~~------------------~~~l~~L~~L~l~~n~~~~~---------------------~~~~~  328 (968)
T PLN00113        289 LDLSDN-SLSGEIPEL------------------VIQLQNLEILHLFSNNFTGK---------------------IPVAL  328 (968)
T ss_pred             EECcCC-eeccCCChh------------------HcCCCCCcEEECCCCccCCc---------------------CChhH
Confidence            666555 344344431                  22233334444433332110                     00000


Q ss_pred             hhhcccccCCCCCCCCCcceEEeccCCCcchhcccccchhhccCCCCeEeEccCCCcccchhhhhHHHHhhhcccccCcc
Q 048779          397 PALCNLQIGPLKPRIPKLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLE  476 (911)
Q Consensus       397 ~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~~~l~~~~~~L~  476 (911)
                                  ..+++|+.|++.++.....    .+..++.+++|+.|++++|.....++.     .+..+    ++|+
T Consensus       329 ------------~~l~~L~~L~L~~n~l~~~----~p~~l~~~~~L~~L~Ls~n~l~~~~p~-----~~~~~----~~L~  383 (968)
T PLN00113        329 ------------TSLPRLQVLQLWSNKFSGE----IPKNLGKHNNLTVLDLSTNNLTGEIPE-----GLCSS----GNLF  383 (968)
T ss_pred             ------------hcCCCCCEEECcCCCCcCc----CChHHhCCCCCcEEECCCCeeEeeCCh-----hHhCc----CCCC
Confidence                        0133333444433332211    123456667777777777633222211     11111    5677


Q ss_pred             eEEEEeccccccccccccCCCCccEEEecCCCCccccCC-CCCCCCCcEEEeccCCCCCccchhhhcCCCCCccEEEEec
Q 048779          477 YLRLYICEGLVKLPQSLLSLSSLREIFIGGCNSLVSFPE-VALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIES  555 (911)
Q Consensus       477 ~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~c~~l~~~~~-~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~  555 (911)
                      .|++++|.....+|..+..+++|+.|++++|.....+|. ...+++|+.|++++|.....++...  ..+++|+.|++++
T Consensus       384 ~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~--~~l~~L~~L~L~~  461 (968)
T PLN00113        384 KLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK--WDMPSLQMLSLAR  461 (968)
T ss_pred             EEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhh--ccCCCCcEEECcC
Confidence            777777766666666666777777777777533323332 2335666666666666333333322  3456666666666


Q ss_pred             CCCCccccCCCCCCCCceeecccCCCcccccccccccccCCccccccccccceEeeecCCCccccccCCCCchhhhhhhc
Q 048779          556 CHSLRYIAGVQLPPSLKTLFIDECGNIRTLTVEEGIHSSSSSSRRYNSSLLEHLGIRYCPSLTCIFSKNELPATLESLEV  635 (911)
Q Consensus       556 c~~l~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~~~~~~l~~  635 (911)
                      |.....+|.....+                                   +|+.|++++|. +....     |..+.    
T Consensus       462 n~~~~~~p~~~~~~-----------------------------------~L~~L~ls~n~-l~~~~-----~~~~~----  496 (968)
T PLN00113        462 NKFFGGLPDSFGSK-----------------------------------RLENLDLSRNQ-FSGAV-----PRKLG----  496 (968)
T ss_pred             ceeeeecCcccccc-----------------------------------cceEEECcCCc-cCCcc-----Chhhh----
Confidence            54333333221122                                   45555555432 11111     11122    


Q ss_pred             cCCCCCCcEEEEcCCCCccchhhhhccCCcccEEEecccccccccccccccCCCcceEEeccCccccccCCCCCCCCCcc
Q 048779          636 GNLPPSLKSLCVYGCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLT  715 (911)
Q Consensus       636 ~~~~~~L~~L~l~~c~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~  715 (911)
                       .+ ++|+.|++++|.....+|..+..+++|++|++++|.....+|..+..+++|+.|++++|.....+|..+..+++|+
T Consensus       497 -~l-~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~  574 (968)
T PLN00113        497 -SL-SELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV  574 (968)
T ss_pred             -hh-hccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccC
Confidence             22 6788888888877778888888888888888888888888888888888888888888877777888777788888


Q ss_pred             EEeeccccCcccccc
Q 048779          716 RLEIYDCKRLEALPK  730 (911)
Q Consensus       716 ~L~l~~c~~l~~~~~  730 (911)
                      .+++++|+....+|.
T Consensus       575 ~l~ls~N~l~~~~p~  589 (968)
T PLN00113        575 QVNISHNHLHGSLPS  589 (968)
T ss_pred             EEeccCCcceeeCCC
Confidence            888888776666665

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		911
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-16
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-06
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	8e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	8e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	9e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	8e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	9e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	2e-04
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	8e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	8e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score = 89.6 bits (223), Expect = 2e-19
 Identities = 28/109 (25%), Positives = 47/109 (43%)

Query: 13  SILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHT 72
               +   L +L+   L    I  LP S+ +L+ L+ L +  + +  L  +++ L  L  
Sbjct: 174 DASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEE 233

Query: 73  LLLVGCRRLKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTL 121
           L L GC  L+      G    L  L   +   L  +P+ I +LT L+ L
Sbjct: 234 LDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKL 282

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		911
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.98
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.96
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.96
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.95
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.93
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.93
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.93
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.91
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.89
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.89
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.89
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.87
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.86
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.86
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.85
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.85
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.85
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.84
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.84
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.82
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.81
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.81
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.8
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.79
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.79
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.79
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.78
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.78
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.78
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.77
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.77
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.77
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.76
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.76
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.74
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.74
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.74
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.73
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.73
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.73
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.73
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.7
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.69
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.68
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.67
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.67
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.67
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.66
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.66
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.66
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.65
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.65
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.63
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.62
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.61
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.61
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.61
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.61
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.59
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.58
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.58
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.52
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.51
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.5
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.5
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.49
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.48
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.47
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.47
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.46
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.46
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.46
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.45
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.44
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.44
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.44
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.44
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.44
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.43
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.42
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.41
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.41
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.4
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.4
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.39
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.39
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.38
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.37
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.34
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.34
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.33
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.31
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.3
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.29
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.26
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.26
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.25
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.24
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.22
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.21
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.2
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.19
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.18
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.16
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.14
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.11
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.1
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.08
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.04
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.99
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.98
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.83
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.83
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.78
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.7
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.69
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.66
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.4
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.4
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.3
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.24
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.08
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.05
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.04
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.02
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.02
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.01
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.95
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.85
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.81
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.72
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.16
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.89
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	95.84
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.08

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=2.7e-49  Score=474.60  Aligned_cols=674  Identities=18%  Similarity=0.113  Sum_probs=350.2

Q ss_pred             CCCEEEccCCCCc-c---ccccccCCCCCCeEEccCCCCCcCChhhhcCCCccEEecCCccccccchh--hhhccCcccE
Q 048779           23 SLRVFSLRGYRIS-E---LPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKLCA--DMGNLIKLHH   96 (911)
Q Consensus        23 ~L~~L~L~~n~l~-~---lp~~~~~l~~L~~L~L~~~~l~~lp~~~~~L~~L~~L~l~~~~~~~~lp~--~i~~L~~L~~   96 (911)
                      +++.|+|+++.+. .   +|+++.++++|+.++++.+.+..+|+.|+.+++|++|++++|...+.+|.  .++++++|++
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~  130 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKF  130 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCE
T ss_pred             cEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCE
Confidence            4555555555554 2   45555555555555555555555555555555566666655544444554  5555556666


Q ss_pred             EEcCCCcccccCcCCC-CCccccccccceeccCCCCCChhhhhhhhccccceeecccCCCCChhhhhhhccCCCCCccEE
Q 048779           97 LNNSNTDLLKEMPVGI-GKLTCLQTLCNFVVGKDSGSGLPELKLLMHLRGTLKISKLENVKDVGNAKEAQMDGKKNLREL  175 (911)
Q Consensus        97 L~L~~~~~~~~~p~~~-~~L~~L~~L~~~~~~~~~~~~l~~l~~L~~L~~~l~~~~l~~~~~~~~~~~~~l~~~~~L~~L  175 (911)
                      |++++|.+...+|..+ .++++|++|+.......                           .........+..+++|+.|
T Consensus       131 L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~---------------------------~~~~~~~~~~~~l~~L~~L  183 (768)
T 3rgz_A          131 LNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSIS---------------------------GANVVGWVLSDGCGELKHL  183 (768)
T ss_dssp             EECCSSEEECCSSCCSCCCCTTCSEEECCSSCCE---------------------------EETHHHHHHTTCCTTCCEE
T ss_pred             EECcCCccCCcCCHHHhccCCCCCEEECCCCccC---------------------------CcCChhhhhhccCCCCCEE
Confidence            6665555444444433 45555555432111000                           0000000002333444444


Q ss_pred             EEEEeecCCCCCCccchhhcccCCCCCCCCCccEEEEeeeCCCCCCCCcCCCCCCcccEEEEeCCCCCCCCCCCCCcCcc
Q 048779          176 LLRWTCCTDGSSSREAETEMGVLDMLKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSL  255 (911)
Q Consensus       176 ~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~p~~l~~~~~~~L~~L~L~~~~~~~~l~~l~~l~~L  255 (911)
                      ++++|                                   .+......   ..+++|+.|++++|...+.+|.++.+++|
T Consensus       184 ~Ls~n-----------------------------------~l~~~~~~---~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L  225 (768)
T 3rgz_A          184 AISGN-----------------------------------KISGDVDV---SRCVNLEFLDVSSNNFSTGIPFLGDCSAL  225 (768)
T ss_dssp             ECCSS-----------------------------------EEESCCBC---TTCTTCCEEECCSSCCCSCCCBCTTCCSC
T ss_pred             ECCCC-----------------------------------cccccCCc---ccCCcCCEEECcCCcCCCCCcccccCCCC
Confidence            44332                                   22211111   13566666666666665555556666666


Q ss_pred             cceeccccccccccCccccCCCCCCCCCCcceEEeccCcccccccccCCCCccccCCccceeecccCCCcccCCCCCCCc
Q 048779          256 KHLTVRGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHILRCSKLRGTFPKCLPA  335 (911)
Q Consensus       256 ~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~l~~  335 (911)
                      ++|++++|.....++..+ ..     +++|++|+++++.- ....+      ...+++|++|++++| .+++.+|..+  
T Consensus       226 ~~L~Ls~n~l~~~~~~~l-~~-----l~~L~~L~Ls~n~l-~~~~~------~~~l~~L~~L~L~~n-~l~~~ip~~~--  289 (768)
T 3rgz_A          226 QHLDISGNKLSGDFSRAI-ST-----CTELKLLNISSNQF-VGPIP------PLPLKSLQYLSLAEN-KFTGEIPDFL--  289 (768)
T ss_dssp             CEEECCSSCCCSCHHHHT-TT-----CSSCCEEECCSSCC-EESCC------CCCCTTCCEEECCSS-EEEESCCCCS--
T ss_pred             CEEECcCCcCCCcccHHH-hc-----CCCCCEEECCCCcc-cCccC------ccccCCCCEEECcCC-ccCCccCHHH--
Confidence            666666664222222111 11     55555555555431 11111      124666677777666 4554555421  


Q ss_pred             cceEEEeccCCcccccCCCCccceEEEcCCcchhh---hcccccccccccccccCCcccccccchhhcccccCCCCCCCC
Q 048779          336 LQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSV---SLTSLPALCNLQIGRCEELSVSVTSLPALCNLQIGPLKPRIP  412 (911)
Q Consensus       336 L~~L~l~~~~~l~~~~~~l~~L~~L~l~~~~~~~~---~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  412 (911)
                                     ...+++|++|++++|.....   .+..                                    ++
T Consensus       290 ---------------~~~~~~L~~L~Ls~n~l~~~~p~~~~~------------------------------------l~  318 (768)
T 3rgz_A          290 ---------------SGACDTLTGLDLSGNHFYGAVPPFFGS------------------------------------CS  318 (768)
T ss_dssp             ---------------CTTCTTCSEEECCSSEEEECCCGGGGG------------------------------------CT
T ss_pred             ---------------HhhcCcCCEEECcCCcCCCccchHHhc------------------------------------CC
Confidence                           11235556666665553321   1223                                    33


Q ss_pred             CcceEEeccCCCcchhcccccchhhccCCCCeEeEccCCCcccchhhhhHHHHhhhcccccCcceEEEEecccccccccc
Q 048779          413 KLEELGINNIKNETCIWKSHTELLQDICSLKRLTITSCSKLQSLVAEEEEDQRQKLCEFSCRLEYLRLYICEGLVKLPQS  492 (911)
Q Consensus       413 ~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~  492 (911)
                      +|++|++.++.....+   +...+..+++|++|++++|.....++.. +    ..   .+++|++|++++|.....+|..
T Consensus       319 ~L~~L~L~~n~l~~~i---p~~~l~~l~~L~~L~Ls~n~l~~~~p~~-l----~~---l~~~L~~L~Ls~N~l~~~~~~~  387 (768)
T 3rgz_A          319 LLESLALSSNNFSGEL---PMDTLLKMRGLKVLDLSFNEFSGELPES-L----TN---LSASLLTLDLSSNNFSGPILPN  387 (768)
T ss_dssp             TCCEEECCSSEEEEEC---CHHHHTTCTTCCEEECCSSEEEECCCTT-H----HH---HTTTCSEEECCSSEEEEECCTT
T ss_pred             CccEEECCCCcccCcC---CHHHHhcCCCCCEEeCcCCccCccccHH-H----Hh---hhcCCcEEEccCCCcCCCcChh
Confidence            4444444443322221   2223455566666666655322122211 1    11   1125666666665554445544


Q ss_pred             ccC--CCCccEEEecCCCCccccCC-CCCCCCCcEEEeccCCCCCccchhhhcCCCCCccEEEEecCCCCccccCC-CCC
Q 048779          493 LLS--LSSLREIFIGGCNSLVSFPE-VALPSKLKKIEISECDALKSLPEAWMCDTNSSLEILYIESCHSLRYIAGV-QLP  568 (911)
Q Consensus       493 l~~--l~~L~~L~l~~c~~l~~~~~-~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~-~~~  568 (911)
                      +..  +++|++|++++|.....+|. ...+++|++|++++|.....++..+  ..+++|+.|++++|.....++.. ...
T Consensus       388 ~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l--~~l~~L~~L~L~~n~l~~~~p~~~~~l  465 (768)
T 3rgz_A          388 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL--GSLSKLRDLKLWLNMLEGEIPQELMYV  465 (768)
T ss_dssp             TTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGG--GGCTTCCEEECCSSCCCSCCCGGGGGC
T ss_pred             hhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHH--hcCCCCCEEECCCCcccCcCCHHHcCC
Confidence            444  55566666666422222332 2235556666666655322333333  34555555555554322222211 222


Q ss_pred             CCCceeecccCCCcccccccccccccCCccccccccccceEeeecCCCccccccCCCCchhhhhhhccCCCCCCcEEEEc
Q 048779          569 PSLKTLFIDECGNIRTLTVEEGIHSSSSSSRRYNSSLLEHLGIRYCPSLTCIFSKNELPATLESLEVGNLPPSLKSLCVY  648 (911)
Q Consensus       569 ~~L~~L~l~~c~~l~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~~~~~~l~~~~~~~~L~~L~l~  648 (911)
                      ++|+.|++++|.--..                                         .|..+.     .+ ++|+.|+++
T Consensus       466 ~~L~~L~L~~N~l~~~-----------------------------------------~p~~l~-----~l-~~L~~L~L~  498 (768)
T 3rgz_A          466 KTLETLILDFNDLTGE-----------------------------------------IPSGLS-----NC-TNLNWISLS  498 (768)
T ss_dssp             TTCCEEECCSSCCCSC-----------------------------------------CCGGGG-----GC-TTCCEEECC
T ss_pred             CCceEEEecCCcccCc-----------------------------------------CCHHHh-----cC-CCCCEEEcc
Confidence            3344444444321111                                         111121     12 566777777


Q ss_pred             CCCCccchhhhhccCCcccEEEecccccccccccccccCCCcceEEeccCccccccCCCCCCCCCccEEeeccccCc---
Q 048779          649 GCSKLESIAERLDDNTSLKIIRIDFCEKLKILPSGLHNLRQLLEIKIWWCGNLVTFPEGGLPCAKLTRLEIYDCKRL---  725 (911)
Q Consensus       649 ~c~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l---  725 (911)
                      +|.....+|..++.+++|++|++++|.....+|..+.++++|+.|++++|.....+|..++....+..+.+......   
T Consensus       499 ~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~  578 (768)
T 3rgz_A          499 NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYI  578 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEE
T ss_pred             CCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccc
Confidence            76666666666777777777777777766667767777777777777777655566665554444433332221111   


Q ss_pred             -------------------ccccccccCCCccCcEEeCC-c-cCccccCCCCCCCCCceEEecccchhhhhhhcCcccCC
Q 048779          726 -------------------EALPKGLHNLKSLQELRIGG-E-LPSLEEDDGLPTDLRSLEIIFNTKIWKSMIERGQGFHR  784 (911)
Q Consensus       726 -------------------~~~~~~l~~l~~L~~L~l~~-~-~~~l~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~  784 (911)
                                         ...+..+..++.++.+++.. . -..++...+.+++|+.|++++|.....++    ..+.+
T Consensus       579 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip----~~l~~  654 (768)
T 3rgz_A          579 KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP----KEIGS  654 (768)
T ss_dssp             ECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCC----GGGGG
T ss_pred             ccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCC----HHHhc
Confidence                               01122233344444444444 1 12334445667889999999998776655    56899


Q ss_pred             CCCccEEEeccCCCCCCCCCchhhhccccCcCCCCCCcceeeecCCCCccccccccCCCCCcceEecccCCCccccCCCC
Q 048779          785 FSSLRHLSIEGCDDDMVSFPPEAEDKRLGTALPLPASLTSMWIGDFPNLERLSSSIVDLQNLTELRLHDCPKLKYFPEKG  864 (911)
Q Consensus       785 l~~L~~L~l~~c~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~l~~l~~L~~L~l~~c~~l~~l~~~~  864 (911)
                      +++|+.|++++| .....+|+..         ..+++|++|+++++.--..+|..+..+++|++|++++++--..+|..+
T Consensus       655 l~~L~~L~Ls~N-~l~g~ip~~l---------~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~  724 (768)
T 3rgz_A          655 MPYLFILNLGHN-DISGSIPDEV---------GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMG  724 (768)
T ss_dssp             CTTCCEEECCSS-CCCSCCCGGG---------GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSS
T ss_pred             cccCCEEeCcCC-ccCCCCChHH---------hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCch
Confidence            999999999995 3555777765         478999999999954444888899999999999999966667889877


Q ss_pred             CcccccceeecCCchhH----HHhhccCCcccccccCCceEE
Q 048779          865 LPSSLLQLQIWGCPLMK----EKCRKDGGQYWDLLIHIPFVL  902 (911)
Q Consensus       865 ~~~sL~~L~i~~c~~l~----~~~~~~~~~~~~~i~~i~~~~  902 (911)
                      .+.++....+.|||.++    ..|....+++|++|+|+|+++
T Consensus       725 ~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          725 QFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             SGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             hhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            78888888888887543    258889999999999999864

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		911
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	8e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	9e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.002
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.002

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 43.1 bits (100), Expect = 1e-04
 Identities = 60/376 (15%), Positives = 109/376 (28%), Gaps = 41/376 (10%)

Query: 21  LQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRR 80
           L  +         I  + D V  L  L  +N S  ++  +   +  L  L  +L+   + 
Sbjct: 43  LDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQI 100

Query: 81  LKKLCADMGNLIKLHHLNNSNTDLLKEMPVGIGKLTCLQTLCNFVVGKDSGSGLPELKLL 140
                      +    L N+    +  +           +                 +L 
Sbjct: 101 ADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLS 160

Query: 141 MHLRGTLKISKLENVKDVGNAKEAQMDGKKNLRELLLRWTCCTDGSSSREAETEMGVLDM 200
              + T     L N+  +     +            L        ++++     +  +  
Sbjct: 161 FGNQVTDLK-PLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQ-----ISDITP 214

Query: 201 LKPHKNLEQFYICGYGGTKFPTWLGDSSFSNLVTLKFEDCGMCTALPSVGQLPSLKHLTV 260
           L    NL++  + G       T    +S +NL  L   +    + L  +  L  L  L  
Sbjct: 215 LGILTNLDELSLNGNQLKDIGTL---ASLTNLTDLDLANN-QISNLAPLSGLTKLTEL-- 268

Query: 261 RGMSRVKRLGSEFYGNDSPIPFPCLETLRFEDMQEWEDWIPHGSSQGVERFPKLRELHIL 320
                  +LG+    N SP+      T    +  + ED  P            L  L  L
Sbjct: 269 -------KLGANQISNISPLAGLTALTNLELNENQLEDISPI------SNLKNLTYLT-L 314

Query: 321 RCSKLRGTFP-KCLPALQMLVIYRCEEFSVSVTSLPALCNLQINGCEELSVS---LTSLP 376
             + +    P   L  LQ L           V+ + +L NL       LS     ++ L 
Sbjct: 315 YFNNISDISPVSSLTKLQRLFFANN-----KVSDVSSLANLT--NINWLSAGHNQISDLT 367

Query: 377 ALCNLQIGRCEELSVS 392
            L NL   R  +L ++
Sbjct: 368 PLANLT--RITQLGLN 381

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		911
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.82
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.78
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.76
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.72
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.68
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.67
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.67
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.64
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.63
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.63
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.59
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.56
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.52
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.49
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.48
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.45
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.39
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.39
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.38
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.35
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.34
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.32
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.31
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.31
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.29
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.21
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.21
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.18
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.0
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.96
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.95
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.86
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.8
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.44
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.3
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.08
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.69
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.07
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.42
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.33
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.88

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.82  E-value=1.3e-18  Score=188.73  Aligned_cols=98  Identities=15%  Similarity=0.278  Sum_probs=75.9

Q ss_pred             ccCCcccccccccccCCCCCCEEEccCCCCccccccccCCCCCCeEEccCCCCCcCChhhhcCCCccEEecCCccccccc
Q 048779            5 SRHGYLAHSILPKLFKLQSLRVFSLRGYRISELPDSVGDLRYLRHLNLSGTEIRTLPESVNKLYNLHTLLLVGCRRLKKL   84 (911)
Q Consensus         5 Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~L~~~~l~~lp~~~~~L~~L~~L~l~~~~~~~~l   84 (911)
                      ++.+.+++.+.  ...+.+|++|+++++.|+.+. .++.+++||+|++++|+|+++| .++++++|++|++++|. +..+
T Consensus        29 l~~~~~~~~~~--~~~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~-i~~i  103 (384)
T d2omza2          29 LGKTNVTDTVS--QTDLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQ-IADI  103 (384)
T ss_dssp             TTCSSTTSEEC--HHHHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSC-CCCC
T ss_pred             hCCCCCCCccC--HHHhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCCc-cccCCcccccccccccc-cccc
Confidence            44555555433  256778999999999998885 4788999999999999999886 48999999999999964 5555


Q ss_pred             hhhhhccCcccEEEcCCCcccccCc
Q 048779           85 CADMGNLIKLHHLNNSNTDLLKEMP  109 (911)
Q Consensus        85 p~~i~~L~~L~~L~L~~~~~~~~~p  109 (911)
                      + .++++++|+.|+++++. ...++
T Consensus       104 ~-~l~~l~~L~~L~~~~~~-~~~~~  126 (384)
T d2omza2         104 T-PLANLTNLTGLTLFNNQ-ITDID  126 (384)
T ss_dssp             G-GGTTCTTCCEEECCSSC-CCCCG
T ss_pred             c-ccccccccccccccccc-ccccc
Confidence            4 38899999999998887 44444

PyMOL of d2omza2

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure