Citrus Sinensis ID: 048807


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------
MEMILTKQPKFLLKRHHLPLLRHFCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
ccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccc
ccccccccccEEEcccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccc
memiltkqpkfllkrhhlpllrhfctehnsplpqvsessIIITQALDVLlqtpdnewtsspqiknllfsstslspqlffqitrrfpsssraLSFFNFLqsnlpteantsSLSYAYQAVFELAIRERMSPESLFDLYKackdqniplsinSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEmldresqfpvneltGDIVFYALMRREhvknsvtdeELVGLVSKFaehgvfpnaVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEmkendiepsvvTFGTIINRLCKLYRADEALEVFEKMIAGketaeisvepdvIIFNTLIDGLCKVGKQEEALGLIEQMRLRLqkgcmpnavtyncLINGFCKSGNIEKGLELFHLMKqegvtpnvvTLNTLvdgmcrhgrinSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFddmsragcsaDSVVYFTLISGLCQAGRMNDASLVVSKLkeagfrpdivcYNHLISGFCKKKMLDKAYEVLQEMEdigmtpnsvTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELssssnvspntVIYNILIDSLCKNNQVELALSLMEEMKvkevrpntntYNAMFKGLRQKNMLDKAFKLMDRMIehachpdyiSMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
MEMILTKQPKFLLKRHHLPLLRHFCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEmldresqfpvnELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTemkendiepsvvTFGTIINRLCKLYRADEALEVFEKMIAGketaeisvepdVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKElssssnvspNTVIYNILIDSLCKNNQVELALSLMEemkvkevrpntntynamFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
MEMILTKQpkfllkrhhlpllrhfCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGvtpnvvtlntlvDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
********PKFLLKRHHLPLLRHFCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSS**NVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYA******
*************KRHHLP**************************LDVLLQTPDNEWTSSPQI*NLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
MEMILTKQPKFLLKRHHLPLLRHFCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
*EMILTKQPKFLLKRHHLPLLRHFCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMILTKQPKFLLKRHHLPLLRHFCTEHNSPLPQVSESSIIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query757 2.2.26 [Sep-21-2011]
Q9LKU8766 Pentatricopeptide repeat- yes no 0.980 0.968 0.476 0.0
Q9M316766 Pentatricopeptide repeat- yes no 0.965 0.954 0.480 0.0
P0C894761 Putative pentatricopeptid no no 0.615 0.612 0.322 2e-72
Q3EDF8598 Pentatricopeptide repeat- no no 0.599 0.759 0.298 6e-72
Q6NQ83619 Pentatricopeptide repeat- no no 0.631 0.772 0.311 8e-71
Q9CAN0630 Pentatricopeptide repeat- no no 0.715 0.860 0.300 3e-70
Q9SXD8634 Pentatricopeptide repeat- no no 0.638 0.761 0.291 4e-70
Q0WKV3637 Pentatricopeptide repeat- no no 0.554 0.659 0.319 1e-69
Q9FMF6730 Pentatricopeptide repeat- no no 0.692 0.717 0.288 5e-69
Q9T0D6566 Pentatricopeptide repeat- no no 0.546 0.731 0.357 6e-69
>sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 Back     alignment and function desciption
 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/755 (47%), Positives = 505/755 (66%), Gaps = 13/755 (1%)

Query: 4   ILTKQPKFLLKRHHLPLLRHFCTEHNSPLPQVSESS--IIITQALDVLLQTPDNEWTSSP 61
           I  +Q  ++L  H    LR F  + + P P++   S   ++ + +  L  TP ++W SS 
Sbjct: 7   ISRRQNSYILLNHS-RFLRRFSYDVD-PRPEIKSESQEFVVVKFVKTLQNTPQHDWASSE 64

Query: 62  QIKNLLFSSTSLSPQLFFQITRRFPSSSRALSFFNFLQSNLPT-EANTSSLSYAYQAVFE 120
            +  L+ SS+S SP +F QITRR  S S A+SFF +L +   + +    SLS A Q+V E
Sbjct: 65  SLSALVVSSSSASPLVFSQITRRLGSYSLAISFFEYLDAKSQSLKRREESLSLALQSVIE 124

Query: 121 LAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRN 180
            A  E    + L  LY+  K++NIPL+I +  LLIR+FG++ M + S+LVY  LD+N++N
Sbjct: 125 FAGSEPDPRDKLLRLYEIAKEKNIPLTIVATKLLIRWFGRMGMVNQSVLVYERLDSNMKN 184

Query: 181 THVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHVKNSVTD 240
           + VRNV++DVLLR     DAF VLDEML +ES FP N +T DIV + + +    +  +T+
Sbjct: 185 SQVRNVVVDVLLRNGLVDDAFKVLDEMLQKESVFPPNRITADIVLHEVWK----ERLLTE 240

Query: 241 EELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNAL 300
           E+++ L+S+F+ HGV PN+VWLT+ I+  C+  + + AWD+L  LMK   PLEA   NAL
Sbjct: 241 EKIIALISRFSSHGVSPNSVWLTRFISSLCKNARANTAWDILSDLMKNKTPLEAPPFNAL 300

Query: 301 LNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKE 360
           L+ LGR  D  RMN L  +M E  I P VVT G +IN LCK  R DEALEVFE+M  GK 
Sbjct: 301 LSCLGRNMDISRMNDLVLKMDEVKIRPDVVTLGILINTLCKSRRVDEALEVFEQM-RGKR 359

Query: 361 TAEISV-EPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFC 419
           T + +V + D I FNTLIDGLCKVG+ +EA  L+  +R++L++ C+PNAVTYNCLI+G+C
Sbjct: 360 TDDGNVIKADSIHFNTLIDGLCKVGRLKEAEELL--VRMKLEERCVPNAVTYNCLIDGYC 417

Query: 420 KSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAV 479
           ++G +E   E+   MK++ + PNVVT+NT+V GMCRH  +N AV FF ++ ++G+  N V
Sbjct: 418 RAGKLETAKEVVSRMKEDEIKPNVVTVNTIVGGMCRHHGLNMAVVFFMDMEKEGVKGNVV 477

Query: 480 TYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKL 539
           TY  LI A C+V+N ++A+ W++ M  AGCS D+ +Y+ LISGLCQ  R +DA  VV KL
Sbjct: 478 TYMTLIHACCSVSNVEKAMYWYEKMLEAGCSPDAKIYYALISGLCQVRRDHDAIRVVEKL 537

Query: 540 KEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNF 599
           KE GF  D++ YN LI  FC K   +K YE+L +ME  G  P+S+TYNTLISF  K  +F
Sbjct: 538 KEGGFSLDLLAYNMLIGLFCDKNNAEKVYEMLTDMEKEGKKPDSITYNTLISFFGKHKDF 597

Query: 600 SAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNI 659
            +  R++++M ++GL PTV TYGA+I A+C  G +DEA+K+FK++   S V+PNTVIYNI
Sbjct: 598 ESVERMMEQMREDGLDPTVTTYGAVIDAYCSVGELDEALKLFKDMGLHSKVNPNTVIYNI 657

Query: 660 LIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHA 719
           LI++  K      ALSL EEMK+K VRPN  TYNA+FK L +K   +   KLMD M+E +
Sbjct: 658 LINAFSKLGNFGQALSLKEEMKMKMVRPNVETYNALFKCLNEKTQGETLLKLMDEMVEQS 717

Query: 720 CHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSA 754
           C P+ I+MEIL E LS + +  KL+KF+QGY+V++
Sbjct: 718 CEPNQITMEILMERLSGSDELVKLRKFMQGYSVAS 752





Arabidopsis thaliana (taxid: 3702)
>sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 Back     alignment and function description
>sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 Back     alignment and function description
>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 Back     alignment and function description
>sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 Back     alignment and function description
>sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function description
>sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query757
225454300765 PREDICTED: pentatricopeptide repeat-cont 0.988 0.977 0.613 0.0
224130398775 predicted protein [Populus trichocarpa] 0.951 0.929 0.551 0.0
356560325746 PREDICTED: pentatricopeptide repeat-cont 0.972 0.986 0.511 0.0
449443903660 PREDICTED: pentatricopeptide repeat-cont 0.788 0.904 0.569 0.0
22327132766 pentatricopeptide repeat-containing prot 0.980 0.968 0.476 0.0
15233137766 pentatricopeptide repeat-containing prot 0.965 0.954 0.480 0.0
297821008766 pentatricopeptide repeat-containing prot 0.969 0.958 0.481 0.0
21537126766 unknown [Arabidopsis thaliana] 0.980 0.968 0.472 0.0
15241779727 pentatricopeptide repeat-containing prot 0.944 0.983 0.470 0.0
413944227595 hypothetical protein ZEAMMB73_037126 [Ze 0.677 0.862 0.439 1e-127
>gi|225454300|ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/765 (61%), Positives = 579/765 (75%), Gaps = 17/765 (2%)

Query: 4   ILTKQPKFL-LKRHHLP-----LLRHFCTEHNSPLPQV---SESSIIITQALDVLLQTPD 54
           + +KQ K L   R   P     LLRH   E +   P     ++SS ++   ++ LLQT D
Sbjct: 7   VSSKQSKLLRFLRPQTPPNLSSLLRHLSAEPDHHPPAPPPQNDSSSVVNLVVE-LLQTTD 65

Query: 55  NEWTSSPQIKNLLFSSTSLSPQL--FFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLS 112
           N+W    ++  LLF +TS  P      QITR   S+++AL FFN++Q+N P + ++  LS
Sbjct: 66  NDWNED-KLHQLLFPTTSPPPPPHNLLQITRLLGSTAKALKFFNWVQANSPCQ-DSPLLS 123

Query: 113 YAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLLIRFFGKVSMYDYSLLVYN 172
           +  +AVFE A RE  S   L DL+K  K   IPLS+N+ATLLIR FG+  M D S LVYN
Sbjct: 124 FTLEAVFEHASREPNSHNKLLDLFKTSKSHKIPLSVNAATLLIRCFGRAQMVDESFLVYN 183

Query: 173 ELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRRE 232
           EL  + R TH+RN+LIDVL R     DA ++LDEML  +++FP N  TG IVF AL +R+
Sbjct: 184 ELCPSRRLTHIRNILIDVLFRKGRVDDALHLLDEMLQPKAEFPPNSNTGHIVFSALSKRD 243

Query: 233 HVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPL 292
            V  +V +EE+VGLVSKFAEH VFPN++WLTQLI+R CR G+TD AWDVLH LMK    +
Sbjct: 244 KVGRAVDEEEIVGLVSKFAEHEVFPNSIWLTQLISRLCRSGRTDRAWDVLHGLMKLGGVM 303

Query: 293 EAASCNALLNALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVF 352
           EAASCNALL ALGR  +FKRMN L  EMKE DI+P+VVTFG +IN LCK  R DEALEVF
Sbjct: 304 EAASCNALLTALGRAREFKRMNTLLAEMKEMDIQPNVVTFGILINHLCKFRRVDEALEVF 363

Query: 353 EKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYN 412
           EKM  G E+    VEPDVI +NTLIDGLCKVG+QEE LGL+E  R+R Q  CMPN VTYN
Sbjct: 364 EKMNGG-ESNGFLVEPDVITYNTLIDGLCKVGRQEEGLGLVE--RMRSQPRCMPNTVTYN 420

Query: 413 CLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRK 472
           CLI+G+CK+  IE   ELF  M ++GV PNVVTLNTLVDGMC+HGRIN AVEFF E+  K
Sbjct: 421 CLIDGYCKASMIEAARELFDQMNKDGVPPNVVTLNTLVDGMCKHGRINGAVEFFNEMQGK 480

Query: 473 GLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDA 532
           GL  NAVTYT LI AFCNVNN ++A++ FD+M  AGCS D++VY+TLISGL QAG+++ A
Sbjct: 481 GLKGNAVTYTALIRAFCNVNNIEKAMELFDEMLEAGCSPDAIVYYTLISGLSQAGKLDRA 540

Query: 533 SLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISF 592
           S V+SK+KEAGF PDIV +N LI+GFC+K  LD+AYE+L+EME+ G+ P+ VTYNTLIS 
Sbjct: 541 SFVLSKMKEAGFSPDIVSFNVLINGFCRKNKLDEAYEMLKEMENAGIKPDGVTYNTLISH 600

Query: 593 LSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSP 652
            SK+G+FS A R++KKMVKEGLVPTVVTYGALIHA+C+NG++DEAMKIF+++SS+S V P
Sbjct: 601 FSKTGDFSTAHRLMKKMVKEGLVPTVVTYGALIHAYCLNGNLDEAMKIFRDMSSTSKVPP 660

Query: 653 NTVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLM 712
           NTVIYNILI+SLC+ NQV+LALSLM++MKVK V+PNTNT+NAMFKGL++KN L KAF+LM
Sbjct: 661 NTVIYNILINSLCRKNQVDLALSLMDDMKVKGVKPNTNTFNAMFKGLQEKNWLSKAFELM 720

Query: 713 DRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA 757
           DRM EHAC+PDYI+MEILTEWLS  G+T KLK FVQGY VSA+ A
Sbjct: 721 DRMTEHACNPDYITMEILTEWLSAVGETAKLKSFVQGYEVSASAA 765




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224130398|ref|XP_002320827.1| predicted protein [Populus trichocarpa] gi|222861600|gb|EEE99142.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356560325|ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449443903|ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] gi|449475521|ref|XP_004154479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22327132|ref|NP_680234.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174514|sp|Q9LKU8.1|PP401_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g28460 gi|9502149|gb|AAF88002.1| contains similarity to Pfam family PF01535 (Domain of unknown function), score=340.5, E=1.9e-98, N=2 [Arabidopsis thaliana] gi|15529206|gb|AAK97697.1| AT5g28460/F21B23_120 [Arabidopsis thaliana] gi|27363272|gb|AAO11555.1| At5g28460/F21B23_120 [Arabidopsis thaliana] gi|332006418|gb|AED93801.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15233137|ref|NP_191711.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75183498|sp|Q9M316.1|PP292_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g61520, mitochondrial; Flags: Precursor gi|6850843|emb|CAB71082.1| putative protein [Arabidopsis thaliana] gi|332646696|gb|AEE80217.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297821008|ref|XP_002878387.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324225|gb|EFH54646.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|21537126|gb|AAM61467.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15241779|ref|NP_198189.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|9502152|gb|AAF88005.1| similar to a large family of Arabidopsis thaliana salt inducible protein-like proteins; contains similarity to Pfam family PF01535 (Domain of unknown function), score=340.5, E=1.9e-98, N=2 [Arabidopsis thaliana] gi|332006410|gb|AED93793.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413944227|gb|AFW76876.1| hypothetical protein ZEAMMB73_037126 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query757
TAIR|locus:2146554766 AT5G28460 [Arabidopsis thalian 0.948 0.937 0.478 4.1e-175
TAIR|locus:2082832766 AT3G61520 "AT3G61520" [Arabido 0.948 0.937 0.476 1.1e-174
TAIR|locus:2146549727 AT5G28370 [Arabidopsis thalian 0.899 0.936 0.476 6.8e-166
TAIR|locus:2077061619 AT3G22470 "AT3G22470" [Arabido 0.631 0.772 0.303 2.9e-64
TAIR|locus:2155730 915 AT5G65560 "AT5G65560" [Arabido 0.692 0.572 0.298 3e-64
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.532 0.632 0.336 7.6e-64
TAIR|locus:2139732566 AT4G11690 [Arabidopsis thalian 0.577 0.772 0.331 4.2e-63
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.673 0.682 0.289 4.2e-63
TAIR|locus:2024296598 AT1G09900 "AT1G09900" [Arabido 0.618 0.782 0.301 8.8e-63
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.801 0.805 0.258 8.8e-63
TAIR|locus:2146554 AT5G28460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1701 (603.8 bits), Expect = 4.1e-175, P = 4.1e-175
 Identities = 349/730 (47%), Positives = 485/730 (66%)

Query:    31 PLPQV-SESS-IIITQALDVLLQTPDNEWTSSPQIKNLLFSSTSLSPQLFFQITRRFPSS 88
             P P++ SES   ++ + +  L  TP ++W SS  +  L+ SS+S SP +F QITRR  S 
Sbjct:    32 PRPEIKSESQEFVVVKFVKTLQNTPQHDWASSESLSALVVSSSSASPLVFSQITRRLGSY 91

Query:    89 SRALSFFNFLQSNLPT-EANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLS 147
             S A+SFF +L +   + +    SLS A Q+V E A  E    + L  LY+  K++NIPL+
Sbjct:    92 SLAISFFEYLDAKSQSLKRREESLSLALQSVIEFAGSEPDPRDKLLRLYEIAKEKNIPLT 151

Query:   148 INSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEM 207
             I +  LLIR+FG++ M + S+LVY  LD+N++N+ VRNV++DVLLR     DAF VLDEM
Sbjct:   152 IVATKLLIRWFGRMGMVNQSVLVYERLDSNMKNSQVRNVVVDVLLRNGLVDDAFKVLDEM 211

Query:   208 LDRESQFPVNELTGDIVFYALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLIT 267
             L +ES FP N +T DIV + + +    +  +T+E+++ L+S+F+ HGV PN+VWLT+ I+
Sbjct:   212 LQKESVFPPNRITADIVLHEVWK----ERLLTEEKIIALISRFSSHGVSPNSVWLTRFIS 267

Query:   268 RFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMNQLFTEMKENDIEP 327
               C+  + + AWD+L  LMK   PLEA   NALL+ LGR  D  RMN L  +M E  I P
Sbjct:   268 SLCKNARANTAWDILSDLMKNKTPLEAPPFNALLSCLGRNMDISRMNDLVLKMDEVKIRP 327

Query:   328 SVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISV-EPDVIIFNTLIDGLCKVGKQ 386
              VVT G +IN LCK  R DEALEVFE+M  GK T + +V + D I FNTLIDGLCKVG+ 
Sbjct:   328 DVVTLGILINTLCKSRRVDEALEVFEQM-RGKRTDDGNVIKADSIHFNTLIDGLCKVGRL 386

Query:   387 EEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGXXXXXXXX 446
             +EA  L+  +R++L++ C+PNAVTYNCLI+G+C++G +E   E+   MK++         
Sbjct:   387 KEAEELL--VRMKLEERCVPNAVTYNCLIDGYCRAGKLETAKEVVSRMKEDEIKPNVVTV 444

Query:   447 XXXXDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSR 506
                  GMCRH  +N AV FF ++ ++G+  N VTY  LI A C+V+N ++A+ W++ M  
Sbjct:   445 NTIVGGMCRHHGLNMAVVFFMDMEKEGVKGNVVTYMTLIHACCSVSNVEKAMYWYEKMLE 504

Query:   507 AGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDK 566
             AGCS D+ +Y+ LISGLCQ  R +DA  VV KLKE GF  D++ YN LI  FC K   +K
Sbjct:   505 AGCSPDAKIYYALISGLCQVRRDHDAIRVVEKLKEGGFSLDLLAYNMLIGLFCDKNNAEK 564

Query:   567 AYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIH 626
              YE+L +ME  G  P+S+TYNTLISF  K  +F +  R++++M ++GL PTV TYGA+I 
Sbjct:   565 VYEMLTDMEKEGKKPDSITYNTLISFFGKHKDFESVERMMEQMREDGLDPTVTTYGAVID 624

Query:   627 AFCVNGHVDEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMKVKEVR 686
             A+C  G +DEA+K+FK++   S V+PNTVIYNILI++  K      ALSL EEMK+K VR
Sbjct:   625 AYCSVGELDEALKLFKDMGLHSKVNPNTVIYNILINAFSKLGNFGQALSLKEEMKMKMVR 684

Query:   687 PNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKF 746
             PN  TYNA+FK L +K   +   KLMD M+E +C P+ I+MEIL E LS + +  KL+KF
Sbjct:   685 PNVETYNALFKCLNEKTQGETLLKLMDEMVEQSCEPNQITMEILMERLSGSDELVKLRKF 744

Query:   747 VQGYAVSAAP 756
             +QGY+V A+P
Sbjct:   745 MQGYSV-ASP 753




GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2082832 AT3G61520 "AT3G61520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146549 AT5G28370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024296 AT1G09900 "AT1G09900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LKU8PP401_ARATHNo assigned EC number0.47680.98010.9686yesno
Q9M316PP292_ARATHNo assigned EC number0.48040.96560.9543yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query757
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-35
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-34
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-32
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-23
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-22
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-22
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-20
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-15
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-13
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-11
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-09
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-09
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-09
pfam0153531 pfam01535, PPR, PPR repeat 2e-08
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 6e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 8e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 3e-06
pfam0153531 pfam01535, PPR, PPR repeat 7e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-05
pfam0153531 pfam01535, PPR, PPR repeat 8e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-05
pfam0153531 pfam01535, PPR, PPR repeat 9e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 9e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
pfam0153531 pfam01535, PPR, PPR repeat 0.004
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.004
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.004
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  143 bits (363), Expect = 3e-35
 Identities = 103/435 (23%), Positives = 186/435 (42%), Gaps = 21/435 (4%)

Query: 302 NALGREGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKET 361
           N L R+G  K    L  +M++  +      +     + CK  RA +    F K+I     
Sbjct: 378 NRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIR---- 433

Query: 362 AEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKS 421
                 P +  FN L+         + AL +   +RL  + G   +   Y  LI+   KS
Sbjct: 434 -----NPTLSTFNMLMSVCASSQDIDGALRV---LRLVQEAGLKADCKLYTTLISTCAKS 485

Query: 422 GNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTY 481
           G ++   E+FH M   GV  NV T   L+DG  R G++  A   +  +  K +  + V +
Sbjct: 486 GKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVF 545

Query: 482 TILITAFCNVNNFQEAIKWFDDMSRAGCSA-----DSVVYFTLISGLCQAGRMNDASLVV 536
             LI+A         A   FD ++           D +    L+     AG+++ A  V 
Sbjct: 546 NALISACGQSGAVDRA---FDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVY 602

Query: 537 SKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKS 596
             + E   +     Y   ++   +K   D A  +  +M+  G+ P+ V ++ L+     +
Sbjct: 603 QMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHA 662

Query: 597 GNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNTVI 656
           G+   A  +L+   K+G+    V+Y +L+ A     +  +A+++++++ S   + P    
Sbjct: 663 GDLDKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIK-LRPTVST 721

Query: 657 YNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMI 716
            N LI +LC+ NQ+  AL ++ EMK   + PNT TY+ +     +K+  D    L+ +  
Sbjct: 722 MNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAK 781

Query: 717 EHACHPDYISMEILT 731
           E    P+ +    +T
Sbjct: 782 EDGIKPNLVMCRCIT 796


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 757
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.94
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
KOG2076895 consensus RNA polymerase III transcription factor 99.83
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.81
KOG2076895 consensus RNA polymerase III transcription factor 99.81
KOG2003 840 consensus TPR repeat-containing protein [General f 99.8
KOG1915677 consensus Cell cycle control protein (crooked neck 99.77
KOG2003840 consensus TPR repeat-containing protein [General f 99.77
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.75
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.74
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.71
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
KOG1126638 consensus DNA-binding cell division cycle control 99.66
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.63
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.62
KOG0547606 consensus Translocase of outer mitochondrial membr 99.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.6
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.58
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.58
KOG1126638 consensus DNA-binding cell division cycle control 99.58
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.57
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.57
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.54
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.53
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.5
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.48
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.47
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.44
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.43
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.42
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.41
PRK12370553 invasion protein regulator; Provisional 99.4
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.39
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.38
PRK12370553 invasion protein regulator; Provisional 99.37
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.35
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.33
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.31
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.31
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.31
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
KOG1129478 consensus TPR repeat-containing protein [General f 99.29
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.29
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.28
KOG1129478 consensus TPR repeat-containing protein [General f 99.28
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.28
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.25
KOG2376652 consensus Signal recognition particle, subunit Srp 99.24
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.21
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.2
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.2
PRK11189296 lipoprotein NlpI; Provisional 99.18
PRK11189296 lipoprotein NlpI; Provisional 99.17
PF1304150 PPR_2: PPR repeat family 99.17
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.16
PF1304150 PPR_2: PPR repeat family 99.15
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.14
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.11
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.09
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.08
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.07
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.06
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.03
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.96
PRK04841 903 transcriptional regulator MalT; Provisional 98.95
PRK04841 903 transcriptional regulator MalT; Provisional 98.95
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.94
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.9
KOG1125579 consensus TPR repeat-containing protein [General f 98.84
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.82
KOG1125579 consensus TPR repeat-containing protein [General f 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.77
PLN02789320 farnesyltranstransferase 98.76
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.76
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.75
PLN02789320 farnesyltranstransferase 98.72
KOG1128777 consensus Uncharacterized conserved protein, conta 98.66
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.63
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.62
PF1285434 PPR_1: PPR repeat 98.57
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.53
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.52
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.5
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.49
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.48
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.48
PF1285434 PPR_1: PPR repeat 98.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.47
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
PRK15359144 type III secretion system chaperone protein SscB; 98.45
PRK10370198 formate-dependent nitrite reductase complex subuni 98.44
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.41
PRK15359144 type III secretion system chaperone protein SscB; 98.39
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.38
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.34
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.34
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.22
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.19
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.16
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.11
KOG20411189 consensus WD40 repeat protein [General function pr 98.01
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.97
KOG20411189 consensus WD40 repeat protein [General function pr 97.96
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.95
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.94
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.92
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.88
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.87
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.84
COG4700251 Uncharacterized protein conserved in bacteria cont 97.8
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.78
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.73
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.72
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.7
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.68
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.68
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.67
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.6
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.59
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.59
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.57
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.54
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.54
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.53
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.52
KOG0553304 consensus TPR repeat-containing protein [General f 97.52
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.52
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.51
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.51
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.5
COG3898531 Uncharacterized membrane-bound protein [Function u 97.48
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.47
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.47
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.46
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.46
KOG0553304 consensus TPR repeat-containing protein [General f 97.46
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.45
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.45
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.44
COG4700251 Uncharacterized protein conserved in bacteria cont 97.42
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.41
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.41
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.38
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.38
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.38
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.36
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.31
PF12688120 TPR_5: Tetratrico peptide repeat 97.21
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.18
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.14
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.13
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.13
PF12688120 TPR_5: Tetratrico peptide repeat 97.12
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.12
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.09
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.09
KOG1258577 consensus mRNA processing protein [RNA processing 97.04
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.0
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.98
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.97
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.96
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.95
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.94
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.87
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.78
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.77
PRK10803263 tol-pal system protein YbgF; Provisional 96.69
KOG1258577 consensus mRNA processing protein [RNA processing 96.68
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.62
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.61
PF1337173 TPR_9: Tetratricopeptide repeat 96.58
PRK15331165 chaperone protein SicA; Provisional 96.57
PRK10803263 tol-pal system protein YbgF; Provisional 96.53
COG3898531 Uncharacterized membrane-bound protein [Function u 96.53
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.45
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.38
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.36
PF1337173 TPR_9: Tetratricopeptide repeat 96.34
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.28
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.22
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.22
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.12
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.1
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.04
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.99
PRK15331165 chaperone protein SicA; Provisional 95.94
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.9
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.83
KOG1585308 consensus Protein required for fusion of vesicles 95.83
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.81
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.72
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.72
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.56
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.56
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.51
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.51
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.46
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.38
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.37
PRK11906458 transcriptional regulator; Provisional 95.36
PRK11906458 transcriptional regulator; Provisional 95.35
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.26
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.26
KOG4555175 consensus TPR repeat-containing protein [Function 95.13
smart00299140 CLH Clathrin heavy chain repeat homology. 95.09
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.08
smart00299140 CLH Clathrin heavy chain repeat homology. 94.97
KOG1585308 consensus Protein required for fusion of vesicles 94.89
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.87
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.8
PF1342844 TPR_14: Tetratricopeptide repeat 94.75
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.66
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.63
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.63
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.59
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.41
KOG4555175 consensus TPR repeat-containing protein [Function 94.37
KOG1550552 consensus Extracellular protein SEL-1 and related 94.21
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.08
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.01
KOG1550552 consensus Extracellular protein SEL-1 and related 94.0
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.99
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.98
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 93.95
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 93.31
PF13512142 TPR_18: Tetratricopeptide repeat 93.28
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.16
PF1342844 TPR_14: Tetratricopeptide repeat 93.13
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.93
KOG3941 406 consensus Intermediate in Toll signal transduction 92.73
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 92.61
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.39
KOG3941 406 consensus Intermediate in Toll signal transduction 92.37
COG3629280 DnrI DNA-binding transcriptional activator of the 92.27
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 92.22
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.7
PF1343134 TPR_17: Tetratricopeptide repeat 91.6
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.3
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.29
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.03
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.81
KOG4648536 consensus Uncharacterized conserved protein, conta 90.74
PRK09687280 putative lyase; Provisional 90.7
COG3629280 DnrI DNA-binding transcriptional activator of the 90.49
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.35
PF13512142 TPR_18: Tetratricopeptide repeat 90.27
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.22
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 90.13
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.07
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.89
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.57
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.51
PF1343134 TPR_17: Tetratricopeptide repeat 89.46
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 89.27
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.04
KOG2062 929 consensus 26S proteasome regulatory complex, subun 88.95
PRK09687280 putative lyase; Provisional 88.46
KOG1586288 consensus Protein required for fusion of vesicles 88.33
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.21
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.2
COG3947361 Response regulator containing CheY-like receiver a 88.16
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 88.08
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 87.56
COG1747 711 Uncharacterized N-terminal domain of the transcrip 86.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.74
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.37
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.19
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.04
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.65
KOG4234271 consensus TPR repeat-containing protein [General f 85.43
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.41
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 85.37
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.13
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 84.83
KOG4570 418 consensus Uncharacterized conserved protein [Funct 84.61
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.12
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.08
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 83.77
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 83.59
KOG4234271 consensus TPR repeat-containing protein [General f 83.06
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 82.44
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.38
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.12
PF06552186 TOM20_plant: Plant specific mitochondrial import r 81.92
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.64
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 81.52
KOG4570 418 consensus Uncharacterized conserved protein [Funct 81.18
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.12
COG4455273 ImpE Protein of avirulence locus involved in tempe 80.86
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.9e-79  Score=711.84  Aligned_cols=629  Identities=19%  Similarity=0.261  Sum_probs=584.8

Q ss_pred             hHHHHHHHhcCCChhHHHHHHHHhhhCCCCCCCCCchHHHHHHHHHHHHhcCCChHHHHHHHHHHhhCCCCCCHHHHHHH
Q 048807           75 PQLFFQITRRFPSSSRALSFFNFLQSNLPTEANTSSLSYAYQAVFELAIRERMSPESLFDLYKACKDQNIPLSINSATLL  154 (757)
Q Consensus        75 ~~~~~~~~~~~~~~~~a~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  154 (757)
                      .+.++..+.+.+....|+.+|+.+...... ++    ..++..++..+. ..+..+.+.+++..+.+.+..++..+++.|
T Consensus        54 ~n~~i~~l~~~g~~~~A~~l~~~m~~~g~~-~~----~~~~~~ll~~~~-~~~~~~~a~~~~~~~~~~~~~~~~~~~n~l  127 (857)
T PLN03077         54 SNSQLRALCSHGQLEQALKLLESMQELRVP-VD----EDAYVALFRLCE-WKRAVEEGSRVCSRALSSHPSLGVRLGNAM  127 (857)
T ss_pred             HHHHHHHHHhCCCHHHHHHHHHHHHhcCCC-CC----hhHHHHHHHHHh-hCCCHHHHHHHHHHHHHcCCCCCchHHHHH
Confidence            445556677788999999999988774322 33    234556666544 356678999999999999988999999999


Q ss_pred             HHHHHhcCChhHHHHHHHHhhccCCCcchHHHHHHHHHhcCChhhHHHHHHHHHhccCCCCCCcccHHHHHHHHHhhhhh
Q 048807          155 IRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVFYALMRREHV  234 (757)
Q Consensus       155 ~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~p~~~~~~~~~~~~~~~~~~  234 (757)
                      +.+|+++|+++.|+.+|++|.+  +|+++||.+|.+|++.|++++|+++|++|...  ++.||.+|+..++.++.+.   
T Consensus       128 i~~~~~~g~~~~A~~~f~~m~~--~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~--g~~Pd~~t~~~ll~~~~~~---  200 (857)
T PLN03077        128 LSMFVRFGELVHAWYVFGKMPE--RDLFSWNVLVGGYAKAGYFDEALCLYHRMLWA--GVRPDVYTFPCVLRTCGGI---  200 (857)
T ss_pred             HHHHHhCCChHHHHHHHhcCCC--CCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHc--CCCCChhHHHHHHHHhCCc---
Confidence            9999999999999999999974  78999999999999999999999999999874  6899999999999998755   


Q ss_pred             ccccChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChhHHH
Q 048807          235 KNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALGREGDFKRMN  314 (757)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~  314 (757)
                         .....+.+++..+.+.|+.||..++++||.+|+++|++++|.++|++|.+    +|.++||++|.+|++.|++++|.
T Consensus       201 ---~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~----~d~~s~n~li~~~~~~g~~~eAl  273 (857)
T PLN03077        201 ---PDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPR----RDCISWNAMISGYFENGECLEGL  273 (857)
T ss_pred             ---cchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCC----CCcchhHHHHHHHHhCCCHHHHH
Confidence               22356788999999999999999999999999999999999999999975    68999999999999999999999


Q ss_pred             HHHHHHHHCCCCCccchHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCcccccCCHhHHHHHHHHHHHcCCHHHHHHHHH
Q 048807          315 QLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIE  394 (757)
Q Consensus       315 ~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~  394 (757)
                      ++|++|.+.|+.||..||+.++.+|++.|+.+.|.+++..+.+.|      +.||..+|+.||.+|++.|++++|.++|+
T Consensus       274 ~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g------~~~d~~~~n~Li~~y~k~g~~~~A~~vf~  347 (857)
T PLN03077        274 ELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTG------FAVDVSVCNSLIQMYLSLGSWGEAEKVFS  347 (857)
T ss_pred             HHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhC------CccchHHHHHHHHHHHhcCCHHHHHHHHh
Confidence            999999999999999999999999999999999999999999998      89999999999999999999999999999


Q ss_pred             HHHHhhcCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHCCC
Q 048807          395 QMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGL  474 (757)
Q Consensus       395 ~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~  474 (757)
                      +|.       .||..+|+.+|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|++++|.++++.+.+.|+
T Consensus       348 ~m~-------~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~  420 (857)
T PLN03077        348 RME-------TKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGL  420 (857)
T ss_pred             hCC-------CCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCC
Confidence            994       6899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHH
Q 048807          475 CANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHL  554 (757)
Q Consensus       475 ~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~l  554 (757)
                      .++..+|+.||.+|+++|++++|.++|++|.+    +|..+|+++|.+|++.|+.++|..+|++|.. ++.||..||+.+
T Consensus       421 ~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~----~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~l  495 (857)
T PLN03077        421 ISYVVVANALIEMYSKCKCIDKALEVFHNIPE----KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAA  495 (857)
T ss_pred             CcchHHHHHHHHHHHHcCCHHHHHHHHHhCCC----CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHH
Confidence            99999999999999999999999999999975    5889999999999999999999999999986 589999999999


Q ss_pred             HHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCH
Q 048807          555 ISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHV  634 (757)
Q Consensus       555 i~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~  634 (757)
                      +.+|++.|.++.+.+++..+.+.|+.+|..++++|+++|++.|++++|.++|+++     .||..+|+++|.+|++.|+.
T Consensus       496 L~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~  570 (857)
T PLN03077        496 LSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKG  570 (857)
T ss_pred             HHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCH
Confidence            9999999999999999999999999999999999999999999999999999987     48999999999999999999


Q ss_pred             HHHHHHHHHhhhcCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHH-hCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHH
Q 048807          635 DEAMKIFKELSSSSNVSPNTVIYNILIDSLCKNNQVELALSLMEEMK-VKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMD  713 (757)
Q Consensus       635 ~~A~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~-~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~  713 (757)
                      ++|.++|++|.+ .|+.||..||+.++.+|++.|++++|.++|++|. +.|+.|+..+|++++++|++.|++++|.++++
T Consensus       571 ~~A~~lf~~M~~-~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~  649 (857)
T PLN03077        571 SMAVELFNRMVE-SGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFIN  649 (857)
T ss_pred             HHHHHHHHHHHH-cCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHH
Confidence            999999999998 7999999999999999999999999999999999 68999999999999999999999999999999


Q ss_pred             HHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHhhc
Q 048807          714 RMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGY  750 (757)
Q Consensus       714 ~~~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~  750 (757)
                      +|   ++.||..+|.+|+.+|...|+.+.++...+++
T Consensus       650 ~m---~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l  683 (857)
T PLN03077        650 KM---PITPDPAVWGALLNACRIHRHVELGELAAQHI  683 (857)
T ss_pred             HC---CCCCCHHHHHHHHHHHHHcCChHHHHHHHHHH
Confidence            99   48999999999999999999988877766553



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query757
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-21
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-19
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-05
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 97.2 bits (240), Expect = 7e-21
 Identities = 23/170 (13%), Positives = 60/170 (35%), Gaps = 1/170 (0%)

Query: 363 EISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCLINGFCKSG 422
           +  +                  +   A  L+     + QK  +     YN ++ G+ + G
Sbjct: 120 QAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQG 179

Query: 423 NIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVE-FFQEVTRKGLCANAVTY 481
             ++ + +  ++K  G+TP++++    +  M R  +    +E   ++++++GL   A+  
Sbjct: 180 AFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFT 239

Query: 482 TILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMND 531
            +L++        +   K     S        V    L+  +        
Sbjct: 240 AVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVS 289


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query757
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.88
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.87
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.81
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.79
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.68
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3u4t_A272 TPR repeat-containing protein; structural genomics 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.63
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.62
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.61
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
3u4t_A272 TPR repeat-containing protein; structural genomics 99.59
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.58
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.58
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.57
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.56
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.56
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.53
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.51
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.51
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.47
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.47
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.46
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.45
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.43
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.4
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.36
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.36
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.33
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.23
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.11
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.04
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.03
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.02
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.01
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.99
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.98
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.97
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.96
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.95
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.93
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.88
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.86
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.86
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.85
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.82
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.79
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.74
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.73
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.69
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.67
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.66
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.66
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.65
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.63
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.62
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.62
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.59
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.57
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.55
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.51
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.5
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.5
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.49
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.49
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.47
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.46
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.44
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.44
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.43
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.29
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.24
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.23
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.21
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.18
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.17
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.11
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.08
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.03
3k9i_A117 BH0479 protein; putative protein binding protein, 97.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.96
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.95
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.94
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.94
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.94
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.91
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.91
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.89
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.88
3k9i_A117 BH0479 protein; putative protein binding protein, 97.85
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.83
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.78
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.72
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.69
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.67
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.64
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.63
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.63
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.57
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.53
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.52
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.49
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.43
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.29
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.29
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.77
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.76
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.63
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.6
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.54
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.5
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.45
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.24
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.2
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.97
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.83
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.76
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.68
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.57
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.47
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.39
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.37
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.35
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.29
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.25
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.19
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.12
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.34
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.01
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.77
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.77
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.43
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.13
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.1
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.66
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.05
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.89
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.76
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 87.52
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 86.83
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 86.6
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.09
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 85.56
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.0
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.54
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.44
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 84.26
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.24
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.1e-41  Score=380.85  Aligned_cols=504  Identities=11%  Similarity=0.020  Sum_probs=291.1

Q ss_pred             CCHHHHHHHHHHHHhcCChhHHHHHHHHhhccCCCcchHHHHHHHHHhcCChhhHHHHHHHHHhccCCCCCCcccHHHHH
Q 048807          146 LSINSATLLIRFFGKVSMYDYSLLVYNELDNNLRNTHVRNVLIDVLLRCDHDRDAFNVLDEMLDRESQFPVNELTGDIVF  225 (757)
Q Consensus       146 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~p~~~~~~~~~  225 (757)
                      ++...++.+++.|.+.|++++|+.+|+++....|+..+++.++.+|.+.|++++|+.+|+++..                
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~----------------  145 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDL----------------  145 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCG----------------
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhc----------------
Confidence            3455566666666666666666666666554444555566666666666666666666655421                


Q ss_pred             HHHHhhhhhccccChHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHH
Q 048807          226 YALMRREHVKNSVTDEELVGLVSKFAEHGVFPNAVWLTQLITRFCRKGKTDEAWDVLHVLMKFDAPLEAASCNALLNALG  305 (757)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~  305 (757)
                                                   .+++..+++.++.+|.++|++++|+++|+++...    +..     ..++.
T Consensus       146 -----------------------------~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~----~~~-----~~~~~  187 (597)
T 2xpi_A          146 -----------------------------YNRSSACRYLAAFCLVKLYDWQGALNLLGETNPF----RKD-----EKNAN  187 (597)
T ss_dssp             -----------------------------GGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTT----C------------
T ss_pred             -----------------------------cccchhHHHHHHHHHHHHhhHHHHHHHHhccCCc----ccc-----ccccc
Confidence                                         1234556666666666666666666666642211    100     00000


Q ss_pred             HcCChhHHHHHHHHHHHCCCCCccchHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCcccccCCHhHHHHHHHHHHHcCC
Q 048807          306 REGDFKRMNQLFTEMKENDIEPSVVTFGTIINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGK  385 (757)
Q Consensus       306 ~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~  385 (757)
                      +.++           ...+.+++..+|+.++.+|.+.|++++|++.|+++++.+       +.+...+..++..+...+.
T Consensus       188 ~~~~-----------~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-------p~~~~~~~~l~~~~~~~~~  249 (597)
T 2xpi_A          188 KLLM-----------QDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD-------AKCYEAFDQLVSNHLLTAD  249 (597)
T ss_dssp             ---C-----------CCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-------TTCHHHHHHHHHTTCSCHH
T ss_pred             cccc-----------cccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-------chhhHHHHHHHHhhcccch
Confidence            0000           001222344555555555555555555555555555432       2233444444433332222


Q ss_pred             HHHHHH--H-HHHHHHhhcCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChHHH
Q 048807          386 QEEALG--L-IEQMRLRLQKGCMPNAVTYNCLINGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSA  462 (757)
Q Consensus       386 ~~~A~~--~-~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A  462 (757)
                      .+.+..  + +..+.   ..+......+|+.++..|.+.|++++|.++|+++.+.  +++..+++.++.+|.+.|++++|
T Consensus       250 ~~~~~~~~l~~~~~~---~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A  324 (597)
T 2xpi_A          250 EEWDLVLKLNYSTYS---KEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRSRFIDV  324 (597)
T ss_dssp             HHHHHHHHSCTHHHH---GGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHHH
T ss_pred             hHHHHHHhcCCcccc---cchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhcCHHHH
Confidence            111111  0 22221   1222223344455555555556666666666555543  34555666666666666666666


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHhhHHHHHHHHHhcCChhHHHHHHHHHHHC
Q 048807          463 VEFFQEVTRKGLCANAVTYTILITAFCNVNNFQEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEA  542 (757)
Q Consensus       463 ~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~  542 (757)
                      .++|+++.+.+.. +..+++.++.+|.+.|++++|..+++++.+.. +.+..+|+.++..|.+.|++++|..+|+++.+.
T Consensus       325 ~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  402 (597)
T 2xpi_A          325 LAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTM  402 (597)
T ss_dssp             HHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHh
Confidence            6666666554332 44555666666666666666666666665432 445556666666666666666666666666554


Q ss_pred             CCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHH
Q 048807          543 GFRPDIVCYNHLISGFCKKKMLDKAYEVLQEMEDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYG  622 (757)
Q Consensus       543 g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~  622 (757)
                      . +.+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+|+.++.+|.+.|++++|.++|+++.+.. +.+..+|+
T Consensus       403 ~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~  479 (597)
T 2xpi_A          403 D-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLN  479 (597)
T ss_dssp             C-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHH
T ss_pred             C-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHH
Confidence            2 2245666777777777777777777777766654 4466677777777777777777777777777643 33567777


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHhhhc---CCCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHH
Q 048807          623 ALIHAFCVNGHVDEAMKIFKELSSS---SNVSPN--TVIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFK  697 (757)
Q Consensus       623 ~li~~~~~~g~~~~A~~~~~~~~~~---~~~~p~--~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~l~~  697 (757)
                      .++..|.+.|++++|.++|+++.+.   .+..|+  ..+|..++.+|.+.|++++|.+.|+++.+.+ +.+..+|..++.
T Consensus       480 ~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~  558 (597)
T 2xpi_A          480 ELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIAL  558 (597)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHH
T ss_pred             HHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHH
Confidence            7777777777777777777777652   144566  6678888888888888888888888877653 346778888888


Q ss_pred             HHHHcCCHHHHHHHHHHHHHcCCCCC-HHHHHHHHHHH
Q 048807          698 GLRQKNMLDKAFKLMDRMIEHACHPD-YISMEILTEWL  734 (757)
Q Consensus       698 ~~~~~g~~~~A~~~~~~~~~~g~~p~-~~~~~~l~~~~  734 (757)
                      +|.+.|++++|.++++++++.  .|+ ...+..+...|
T Consensus       559 ~~~~~g~~~~A~~~~~~~l~~--~p~~~~~~~~l~~~~  594 (597)
T 2xpi_A          559 VYLHKKIPGLAITHLHESLAI--SPNEIMASDLLKRAL  594 (597)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHTT
T ss_pred             HHHHhCCHHHHHHHHHHHHhc--CCCChHHHHHHHHHH
Confidence            888888888888888888764  453 45555555443



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query757
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.61
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.29
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.28
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.21
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.15
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.11
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.09
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.08
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.08
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.04
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.65
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.58
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.56
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.51
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.5
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.33
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.16
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.11
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.07
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.07
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.0
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.98
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.97
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.93
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.9
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.84
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.78
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.78
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.66
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.48
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.43
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.31
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.3
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.28
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.63
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.53
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.31
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.21
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.2
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.92
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.83
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.31
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.3
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.55
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.73
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=4.7e-22  Score=207.61  Aligned_cols=383  Identities=13%  Similarity=0.060  Sum_probs=318.3

Q ss_pred             HHHHHHhcCChhHHHHHHHHHHhCCCCCcccccCCHhHHHHHHHHHHHcCCHHHHHHHHHHHHHhhcCCCCCCHHHHHHH
Q 048807          335 IINRLCKLYRADEALEVFEKMIAGKETAEISVEPDVIIFNTLIDGLCKVGKQEEALGLIEQMRLRLQKGCMPNAVTYNCL  414 (757)
Q Consensus       335 li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~l  414 (757)
                      +...+.+.|++++|++.++++++..       |.+..++..+...|.+.|++++|...++++..    ..+.+..+|..+
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~-------p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~----~~p~~~~a~~~l   73 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIK----QNPLLAEAYSNL   73 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC-------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH----HCTTCHHHHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC-------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH----hCCCCHHHHHHH
Confidence            4566778899999999999998864       55788899999999999999999999999842    235678899999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCH
Q 048807          415 INGFCKSGNIEKGLELFHLMKQEGVTPNVVTLNTLVDGMCRHGRINSAVEFFQEVTRKGLCANAVTYTILITAFCNVNNF  494 (757)
Q Consensus       415 i~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~  494 (757)
                      +..|.+.|++++|++.+....+.... +..............+....+............. ...............+..
T Consensus        74 ~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  151 (388)
T d1w3ba_          74 GNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-LYCVRSDLGNLLKALGRL  151 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-CTHHHHHHHHHHHTTSCH
T ss_pred             HHHhhhhccccccccccccccccccc-cccccccccccccccccccccccccccccccccc-cccccccccccccccchh
Confidence            99999999999999999999887433 5555666666666677777777666666555443 444555566777788889


Q ss_pred             HHHHHHHHHHHHcCCCCCHhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHH
Q 048807          495 QEAIKWFDDMSRAGCSADSVVYFTLISGLCQAGRMNDASLVVSKLKEAGFRPDIVCYNHLISGFCKKKMLDKAYEVLQEM  574 (757)
Q Consensus       495 ~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~  574 (757)
                      ..+...+.+..... +.+...+..+...+...|++++|...+++..+... .+...+..+...+...|++++|...+++.
T Consensus       152 ~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~  229 (388)
T d1w3ba_         152 EEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFDRAVAAYLRA  229 (388)
T ss_dssp             HHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHTTTCTTHHHHHHHHH
T ss_pred             hhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCc-ccHHHHHHHhhhhhccccHHHHHHHHHHh
Confidence            99998888887664 55677888889999999999999999999887642 36778999999999999999999999999


Q ss_pred             HhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHhhhcCCCCCCH
Q 048807          575 EDIGMTPNSVTYNTLISFLSKSGNFSAARRVLKKMVKEGLVPTVVTYGALIHAFCVNGHVDEAMKIFKELSSSSNVSPNT  654 (757)
Q Consensus       575 ~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~p~~  654 (757)
                      .+.+ +.+...+..+...+.+.|++++|...|+++++.. +.+..++..+...+...|++++|.+.++....  ..+.+.
T Consensus       230 ~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~  305 (388)
T d1w3ba_         230 LSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALR--LCPTHA  305 (388)
T ss_dssp             HHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHH--HCTTCH
T ss_pred             HHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhc--cCCccc
Confidence            8876 5677888889999999999999999999999864 33678899999999999999999999999887  345677


Q ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCC-HHHHHHHHHH
Q 048807          655 VIYNILIDSLCKNNQVELALSLMEEMKVKEVRPNTNTYNAMFKGLRQKNMLDKAFKLMDRMIEHACHPD-YISMEILTEW  733 (757)
Q Consensus       655 ~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~-~~~~~~l~~~  733 (757)
                      ..+..++..+.+.|++++|++.|++.++.. +-+..++..++.++.+.|++++|++.|+++++  +.|+ ...|..|+..
T Consensus       306 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~  382 (388)
T d1w3ba_         306 DSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNT  382 (388)
T ss_dssp             HHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHH
Confidence            889999999999999999999999998752 33567889999999999999999999999986  5675 5789999999


Q ss_pred             HHhcCC
Q 048807          734 LSEAGQ  739 (757)
Q Consensus       734 ~~~~g~  739 (757)
                      |.+.||
T Consensus       383 ~~~~~D  388 (388)
T d1w3ba_         383 LKEMQD  388 (388)
T ss_dssp             HHHTCC
T ss_pred             HHHcCC
Confidence            988775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure