Citrus Sinensis ID: 048809


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------88
MGGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
ccccEEEEEEcccccccccccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHccccccccccccHHHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEccccccccccccccccccccccEEccccccccccHHcccccccccccEEEEcccccccccccccccccEEEEEEccccccccccccHHHHHHHHHccccccccccccccccccccEEEEccccccEEEEEcccccccccccEEEEEEcccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEccccccHHHccccccccccccccccccccccEEEEcccccccEEcccccccccccccEEEEEcccccccccccccccccccccccEEEEccccccccHHHHHHcccccHHHccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEEcccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEcccccccccccccHHHHHHHHHcc
ccccEEEEEEccHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHEEEcHccccccccccccHHHHEEEccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEccccccccccccccccccEEEEEcccccccccHHHHccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccHHHHHHHHccccccccHHHHcccccccEEEEEccccccccccHHHHHHHHHEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccEcEcccccccHHccccccccccccccEEEEccccccEEcccccccccccccccccccEEEEcccHcHHHccccccccccccccEEEEEccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEcccccHccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccHHHHHccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccHcccEEEEcccHHHHHHHHHccccccccccccccccccccEEEEcccccHcccccccccccccccccEEEEcccccccccccccccccccEEEEEEEcccccccccHccHHHHHHHHHHcc
MGGCKVLLTArshdvlsskmdcqKNIFVDVLNAKEAWSLFEKMtgdciengelkSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELsyyhlededlggeELRKTFLLIGYSYIRNVKDLLYHGmglglfqnintvDEARDRAHTLVDKLKNsclllggwrsewfSMHDVVRDVAISIASRDQHVFAVenevvpltswpdkdvlkdctaislnnsninelpqgfecpqlkyfrihndhslkipdnfftgmteLRVLDFTRMHLLALPSslgllqnlqtlsldycelgdmaiIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEelyigespiewgkvegvdgerrnaslhelnnlskltSLEILIQdektlprdLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANiclngghimqlkgikdlclggsldmksvlygsdgegfpqlkrlevvknsnllcVVDTVDRATALTTAFPVLESLLLRHLSNLEkicrgplaaesfckvKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAergdessnsntQVIELTQlttlelcslpqltsfctgdlhfefpsleklkilecpqvkfkstiHESTKKRFHTIKVLCIegydydgeELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEiygcdnlinlvpsstsfqnltTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITeivvdddeegdnyAANYEIVFSELKELRLSSLESLTsfcsvnncafkfpslerlvvedcpnmsifsggelstpnlrKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
mggckvlltarshdvlsskmdcQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEvvpltswpdkdVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLhelnnlskltslEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAergdessnsNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFkstihestkkrfhtiKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSifsggelstpnlRKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
MGGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHlededlggeelRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHllalpsslgllqnlqtlslDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVleslllrhlsnleKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFselkelrlsslesltsFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
****KVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAE**********QVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLY***
MGGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALR*LK*******AY*SLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAA*************IELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVD************EIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLYQ**
MGGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
*GGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCLLLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQNLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESLLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVKFKSTIHESTKKRFHTIKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSLVRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYLYQQQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query878 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.691 0.660 0.282 3e-37
Q9T048985 Disease resistance protei no no 0.692 0.617 0.266 9e-37
Q42484909 Disease resistance protei no no 0.643 0.621 0.252 2e-29
Q9LVT4843 Probable disease resistan no no 0.376 0.392 0.296 7e-26
O64973889 Disease resistance protei no no 0.386 0.381 0.270 2e-20
Q8RXS5888 Probable disease resistan no no 0.382 0.378 0.274 9e-20
Q9FLB4874 Putative disease resistan no no 0.571 0.574 0.251 1e-18
Q9C8T9898 Putative disease resistan no no 0.376 0.368 0.267 1e-18
P60838894 Probable disease resistan no no 0.359 0.353 0.277 7e-18
Q9SI85893 Probable disease resistan no no 0.592 0.582 0.246 1e-17
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  157 bits (398), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 192/680 (28%), Positives = 301/680 (44%), Gaps = 73/680 (10%)

Query: 5   KVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKEC 64
           KV+LT+R  +V   +M   +NI V  L  KEAW LF    G+   +  +K +A ++  EC
Sbjct: 247 KVVLTSRRLEV-CQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHEC 305

Query: 65  AGLPIAILPVAKALKNKSSLYVWKDALRQLKNKS----LLGAAYSSLELSYYHLEDEDLG 120
            GLP+AI+ + + L+ K  + VWK  L  LK  +         + +L+LSY  L+D    
Sbjct: 306 CGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQD---- 361

Query: 121 GEELRKTFL---LIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCL 177
              ++  FL   L    Y   V +L+ + +  GL    +  ++  +   TLV++LK+SCL
Sbjct: 362 --NMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCL 419

Query: 178 LLGGWRSEWFSMHDVVRDVAI-SIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNN 236
           L  G   +   MHDVVRD AI  ++S+ +   ++      L  +P    +     +SL  
Sbjct: 420 LEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMA 479

Query: 237 SNINELP----QGFECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSL 292
           + +  LP    +G E   L      N H  ++P+ F      LR+LD + + +  LP S 
Sbjct: 480 NKLERLPNNVIEGVET--LVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSF 537

Query: 293 GLLQNLQTLSLDYC-ELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIA--- 348
             L +L++L L  C +L ++  +  L KL  L L  S ++EL   +  L+ LR +     
Sbjct: 538 SNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNT 597

Query: 349 ------PI-----LSRLEELYIGESPIEWGKVEGVDGERR--NASLHELNNLSKLTSLEI 395
                 P      LS LE L +  S   W    G+ GE R   A+L E+  L  L  L I
Sbjct: 598 YQLQSIPAGTILQLSSLEVLDMAGSAYSW----GIKGEEREGQATLDEVTCLPHLQFLAI 653

Query: 396 LIQDEKTLPRDL-SFFKMLQRYRILIGSQWTWDYISS-----EISEIFRLMVASGANICL 449
            + D  +   +  S  K L +++ L     +     +      IS++      S A+I  
Sbjct: 654 KLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVN----VSNASI-- 707

Query: 450 NGGHIMQLKGIKDLCLGGSLD-MKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRAT 508
             G ++Q     DL     L+ M   L       F  +K L +    +    +       
Sbjct: 708 --GWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSI----HYFPSLSLASGCE 761

Query: 509 ALTTAFPVLESLLLRHLSNLEKICR-GPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRG- 566
           +    FP LE L L ++ NLE I            K+K ++V  C +LK +F   I  G 
Sbjct: 762 SQLDLFPNLEELSLDNV-NLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGT 820

Query: 567 LQQLQSIEVTGCQNLEVI--FAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGD 624
           L  LQ I+V  C  LE +  F++   D  + S      L +LT ++L  LPQL S C   
Sbjct: 821 LPNLQEIKVVSCLRLEELFNFSSVPVDFCAES-----LLPKLTVIKLKYLPQLRSLCNDR 875

Query: 625 LHFEFPSLEKLKILECPQVK 644
           +  E  SLE L++  C  +K
Sbjct: 876 VVLE--SLEHLEVESCESLK 893




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query878
255563252 1603 Disease resistance protein RPS5, putativ 0.899 0.492 0.403 1e-141
255574526 1232 Disease resistance protein RFL1, putativ 0.966 0.689 0.381 1e-140
296087872 1152 unnamed protein product [Vitis vinifera] 0.904 0.689 0.373 1e-130
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.911 0.608 0.375 1e-130
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.872 0.311 0.380 1e-126
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.892 0.585 0.373 1e-125
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.879 0.674 0.387 1e-125
359488027 1520 PREDICTED: disease resistance protein At 0.912 0.526 0.359 1e-123
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.902 0.592 0.373 1e-121
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.849 0.440 0.367 1e-120
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  508 bits (1309), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 356/882 (40%), Positives = 505/882 (57%), Gaps = 92/882 (10%)

Query: 3    GCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVK 62
            GCK+LLT+RS D+LS  M  QK   ++VL  +EA SLFE M GD ++ GE +S A+E+ K
Sbjct: 282  GCKILLTSRSRDLLSCDMGVQKVFRLEVLQEEEALSLFEMMVGD-VKGGEFQSAASEVTK 340

Query: 63   ECAGLPIAILPVAKALKNKSSLYVWKDALRQLK---NKSLLGAAYSSLELSYYHLEDEDL 119
            +CAGLP+ I+ +A+ALKNK  LYVWKDA++QL    N+ +    YS+LELSY HL     
Sbjct: 341  KCAGLPVLIVTIARALKNKD-LYVWKDAVKQLSRCDNEEIQEKVYSALELSYNHL----- 394

Query: 120  GGEELRKTFLLIGYSYIRNVK--DLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCL 177
             G E++  FLL G     ++   DLL +  GLGLF+ I+T+ +AR+R H L+  LK +CL
Sbjct: 395  IGAEVKSLFLLCGLLGKSDIAILDLLMYSTGLGLFKGIDTLGDARNRVHKLISDLKAACL 454

Query: 178  LLGGWRSEWFSMHDVVRDVAISIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNNS 237
            LL         +HDVVRDVAISIASR QH+F V N  + L  WP+KDV K CT ISL  +
Sbjct: 455  LLDSDIKGRVKIHDVVRDVAISIASRMQHLFTVRNGAL-LKEWPNKDVCKSCTRISLPYN 513

Query: 238  NINELPQGFECPQLKYFRIHN-DHSLKIPDNFFTGMTELRVLDFTRMHLLALPSSLGLLQ 296
            +I+ LP+  ECP+L+ F +   D SLK+PD  F     LRVL+FT MH  +LP SLG L+
Sbjct: 514  DIHGLPEVLECPELELFLLFTQDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLK 573

Query: 297  NLQTLSLDYCELGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLL---------- 346
            NL TL LD+C L D+AIIG+L  L IL+ + SD+ EL  EI QLT+L+ L          
Sbjct: 574  NLFTLCLDWCALRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKV 633

Query: 347  ----IAPILSRLEELYIGESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEKT 402
                I   L++LEELY+  S   W  V+G++ + RNASL EL  L  LT+LEI + D K 
Sbjct: 634  IPAKIISELTQLEELYMNNSFDLW-DVQGINNQ-RNASLAELECLPYLTTLEICVLDAKI 691

Query: 403  LPRDLSFFKMLQRYRILIGSQW--TWDYISSEISEIFRLMVASGANICLNGGHIMQLKGI 460
            LP+DL FF+ L+R+RI IG  W  T DY +S   ++ +L  +S   I L  G  + L+  
Sbjct: 692  LPKDL-FFRKLERFRIFIGDVWSGTGDYGTSRTLKL-KLNTSS---IHLEHGLSILLEVT 746

Query: 461  KDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLESL 520
            +DL L     +KSVLY  D +GF QLK L+V  +  +  ++D   R+     AFP+LESL
Sbjct: 747  EDLYLAEVKGIKSVLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPC--NAFPILESL 804

Query: 521  LLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQN 580
             L +L +LEKIC G L   SF K++ + V  CD+LKN+F   + R L QLQ ++V  C N
Sbjct: 805  YLDNLMSLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCAN 864

Query: 581  LEVIFAAERGDESSNSNTQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILEC 640
            LE I A   G E ++++ + ++LTQL +L L  LP   SFC+           K K+   
Sbjct: 865  LEEIVAC--GSEDTDNDYEAVKLTQLCSLTLKRLPMFKSFCS-----------KKKV--- 908

Query: 641  PQVKFKSTIHESTKKRFHT---IKVLCIEGYDYDGEELFETVENGVNAMIKGINFHPDLK 697
                  S I    +K+  T   +K +  +G   D   LF       N M       P+L+
Sbjct: 909  ------SPISLRVQKQLTTDTGLKEIAPKGELGDPLPLF-------NEMF----CFPNLE 951

Query: 698  QILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKSL 757
                       NLE+  I  C+ + +   S+ S  NL ++ V+ C+ +  + TSS  K+L
Sbjct: 952  -----------NLELSSI-ACEKICDDQLSAIS-SNLMSLIVERCWNLKYLFTSSLVKNL 998

Query: 758  VRLKQMKIFHCKMITEIVVDDDEEGDNYAANYEIVFSELKELRLSSLESLTSFCSVNNCA 817
            + LK++++F C  +  I+V   EE      N + +F EL  L+L +L  +T FC  +   
Sbjct: 999  LLLKRLEVFDCMSVEGIIV--AEELVEEERNRKKLFPELDFLKLKNLPHITRFC--DGYP 1054

Query: 818  FKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEK 859
             +F SL +L++E+CP +++F     S   +   + K  + EK
Sbjct: 1055 VEFSSLRKLLIENCPALNMFVSKSPSADMIESREAKGMNSEK 1096




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query878
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.411 0.392 0.260 5.4e-29
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.379 0.338 0.270 5.9e-29
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.449 0.434 0.259 1.2e-21
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.376 0.392 0.277 1.7e-21
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.313 0.307 0.275 5.1e-19
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.384 0.381 0.228 2.7e-17
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.381 0.377 0.245 1.4e-16
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.383 0.396 0.25 1.6e-16
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.386 0.381 0.245 5e-16
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.272 0.267 0.25 2.5e-15
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 303 (111.7 bits), Expect = 5.4e-29, Sum P(2) = 5.4e-29
 Identities = 99/380 (26%), Positives = 168/380 (44%)

Query:     5 KVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKEC 64
             KV+LT+R  +V    M   +NI V  L  KEAW LF    G+   +  +K +A ++  EC
Sbjct:   247 KVVLTSRRLEVCQQMMT-NENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHEC 305

Query:    65 AGLPIAILPVAKALKNKSSLYVWKDALRQLKNKS----LLGAAYSSLELSYYHXXXXXXX 120
              GLP+AI+ + + L+ K  + VWK  L  LK  +         + +L+LSY         
Sbjct:   306 CGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSY------DFL 359

Query:   121 XXXXRKTFL---LIGYSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLVDKLKNSCL 177
                 +  FL   L    Y   V +L+ + +  GL    +  ++  +   TLV++LK+SCL
Sbjct:   360 QDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCL 419

Query:   178 LLGGWRSEWFSMHDVVRDVAI-SIASRDQHVFAVENEVVPLTSWPDKDVLKDCTAISLNN 236
             L  G   +   MHDVVRD AI  ++S+ +   ++      L  +P    +     +SL  
Sbjct:   420 LEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMA 479

Query:   237 SNINELPQG-FECPQLKYFRIH-NDHSLKIPDNFFTGMTELRVLDFTRMHXXXXXXXXXX 294
             + +  LP    E  +     +  N H  ++P+ F      LR+LD + +           
Sbjct:   480 NKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSN 539

Query:   295 XXXXXXXXXDYCE-LGDMAIIGDLKKLVILALRGSDMKELVGEIGQLTQLRLLIAPILSR 353
                        C+ L ++  +  L KL  L L  S ++EL   +  L+ LR +      +
Sbjct:   540 LHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQ 599

Query:   354 LEELYIGESPIEWGKVEGVD 373
             L+ +  G + ++   +E +D
Sbjct:   600 LQSIPAG-TILQLSSLEVLD 618


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query878
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-15
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 77.0 bits (190), Expect = 3e-15
 Identities = 40/121 (33%), Positives = 58/121 (47%), Gaps = 6/121 (4%)

Query: 3   GCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTG--DCIENGELKSVATEI 60
           G +V++T RS  V        K   V+ L  +E+W LF       +     EL+ VA EI
Sbjct: 128 GSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEI 187

Query: 61  VKECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNK----SLLGAAYSSLELSYYHLED 116
           V++C GLP+A+  +   L  KS++  W+  L QL N+      L    S L LSY +L  
Sbjct: 188 VEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPM 247

Query: 117 E 117
            
Sbjct: 248 H 248


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 878
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.81
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.79
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG4341483 consensus F-box protein containing LRR [General fu 99.43
KOG0617264 consensus Ras suppressor protein (contains leucine 99.42
KOG4341483 consensus F-box protein containing LRR [General fu 99.42
KOG4237498 consensus Extracellular matrix protein slit, conta 99.4
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.4
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.38
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.35
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.3
KOG4237498 consensus Extracellular matrix protein slit, conta 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.55
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.53
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.52
PRK15386 426 type III secretion protein GogB; Provisional 98.49
PRK15386 426 type III secretion protein GogB; Provisional 98.35
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.3
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.27
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.12
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.12
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.0
PLN03150623 hypothetical protein; Provisional 97.93
PLN03150623 hypothetical protein; Provisional 97.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.67
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.39
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.32
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.43
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.97
PRK04841903 transcriptional regulator MalT; Provisional 95.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.81
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.22
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.53
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.48
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.54
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.41
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.21
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 92.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.28
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.19
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.91
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.54
smart0037026 LRR Leucine-rich repeats, outliers. 87.54
smart0037026 LRR Leucine-rich repeats, outliers. 86.4
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.4
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.15
COG3903414 Predicted ATPase [General function prediction only 82.67
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.2e-58  Score=537.89  Aligned_cols=530  Identities=27%  Similarity=0.430  Sum_probs=380.0

Q ss_pred             CCcEEEEEeCChHHhhccCCCCccEEcCCCChHHHHHHHHHHhCCC--CCChhhHHHHHHHHHHcCCCcchHHHHHHHHh
Q 048809            2 GGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDC--IENGELKSVATEIVKECAGLPIAILPVAKALK   79 (878)
Q Consensus         2 ~gs~iivTtR~~~v~~~~~~~~~~~~l~~L~~~~~~~Lf~~~~~~~--~~~~~~~~~~~~i~~~c~g~Pla~~~~g~~l~   79 (878)
                      +||||++|||++.||..+|++..+++++.|+++|||+||+++||..  ...+.++++|++||++|+|+|||++++|+.|+
T Consensus       288 ~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma  367 (889)
T KOG4658|consen  288 NGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLA  367 (889)
T ss_pred             CCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhc
Confidence            6899999999999999879999999999999999999999999643  33345899999999999999999999999999


Q ss_pred             cCCChHHHHHHHHHHHccC------cchhhhhhhhhcccccCCCCCChHHHHHHHhhhcccC-CccH--HHHHHHHhhcc
Q 048809           80 NKSSLYVWKDALRQLKNKS------LLGAAYSSLELSYYHLEDEDLGGEELRKTFLLIGYSY-IRNV--KDLLYHGMGLG  150 (878)
Q Consensus        80 ~~~~~~~w~~~l~~l~~~~------~~~~~~~~l~~sy~~L~~~~~~~~~~k~cf~~~~~fp-~~~~--~~li~~w~~~g  150 (878)
                      .|.+.++|+++.+.+.+..      ..+.|+++|++|||.||+      ++|.||+|||+|| ||.|  ++||.+|||||
T Consensus       368 ~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~------~lK~CFLycalFPED~~I~~e~Li~yWiaEG  441 (889)
T KOG4658|consen  368 CKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE------ELKSCFLYCALFPEDYEIKKEKLIEYWIAEG  441 (889)
T ss_pred             CCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH------HHHHHHHhhccCCcccccchHHHHHHHHhcc
Confidence            9999999999999887651      234889999999999999      9999999999999 9999  99999999999


Q ss_pred             CccCCCcHHHHHHHHHHHHHHHHhcccccccc---CCcceehhHHHHHHHHHHHc-----ccceEEEEccCCccCCCCCC
Q 048809          151 LFQNINTVDEARDRAHTLVDKLKNSCLLLGGW---RSEWFSMHDVVRDVAISIAS-----RDQHVFAVENEVVPLTSWPD  222 (878)
Q Consensus       151 ~i~~~~~~~~~~~~~~~~l~~L~~~~l~~~~~---~~~~~~mhdli~~~~~~~~~-----~e~~~~~~~~~~~~~~~~~~  222 (878)
                      |+++....+.+.+.+++|+.+|+++|+++...   ...+|+|||+||++|.++++     .++.+.  .++ ......+.
T Consensus       442 fi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv--~~~-~~~~~~~~  518 (889)
T KOG4658|consen  442 FIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIV--SDG-VGLSEIPQ  518 (889)
T ss_pred             CcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEE--ECC-cCcccccc
Confidence            99886666677778889999999999998874   45789999999999999998     566333  321 12233444


Q ss_pred             ccccCCCcEEEeeCCCCCCCCCCCCCCCccEEEeecCC--CCCCCchhhcCCCCCcEEEeeCC-CCCCCCccccCCCCCc
Q 048809          223 KDVLKDCTAISLNNSNINELPQGFECPQLKYFRIHNDH--SLKIPDNFFTGMTELRVLDFTRM-HLLALPSSLGLLQNLQ  299 (878)
Q Consensus       223 ~~~~~~lr~l~l~~~~~~~l~~~~~~~~Lr~L~l~~~~--~~~l~~~~~~~l~~Lr~L~Ls~~-~i~~lp~~i~~L~~L~  299 (878)
                      ...+..+|++++.++.+..++....+++|++|.+.+|.  +..++.++|..+++||||||++| .+.++|.+|++|.|||
T Consensus       519 ~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~Lr  598 (889)
T KOG4658|consen  519 VKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLR  598 (889)
T ss_pred             ccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhh
Confidence            55577899999999999999999999999999999995  88999999999999999999987 5689999999999999


Q ss_pred             EEEccCCCCCCc-ccccCcccCcEEEeeCC-CcccchHhhcccccCcccccccccCCcEEEccCCCCCcccccccccccc
Q 048809          300 TLSLDYCELGDM-AIIGDLKKLVILALRGS-DMKELVGEIGQLTQLRLLIAPILSRLEELYIGESPIEWGKVEGVDGERR  377 (878)
Q Consensus       300 ~L~L~~~~l~~l-~~i~~L~~L~~L~l~~~-~l~~lp~~i~~L~~L~~Lip~~l~~L~~L~l~~~~~~~~~~~~~~~~~~  377 (878)
                      ||+++++.++.+ .++++|++|.+||+..+ .+..+|..+..|.+||+|           .+.....          ..+
T Consensus       599 yL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L-----------~l~~s~~----------~~~  657 (889)
T KOG4658|consen  599 YLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVL-----------RLPRSAL----------SND  657 (889)
T ss_pred             cccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEE-----------Eeecccc----------ccc
Confidence            999999999876 89999999999999988 455555556667776666           3322211          111


Q ss_pred             ccCcccccCCCCCCEEEeecCCCCCCCcchhcccCCceEEEEecccccccccchhhhhhhhhhhccCCccccchhHHhhc
Q 048809          378 NASLHELNNLSKLTSLEILIQDEKTLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRLMVASGANICLNGGHIMQL  457 (878)
Q Consensus       378 ~~~~~~L~~l~~L~~L~l~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~~l~l~~~~~~~~~~~~~l  457 (878)
                      .....++.++.+|+.+.+..... .+-..+..+.+|.                                           
T Consensus       658 ~~~l~el~~Le~L~~ls~~~~s~-~~~e~l~~~~~L~-------------------------------------------  693 (889)
T KOG4658|consen  658 KLLLKELENLEHLENLSITISSV-LLLEDLLGMTRLR-------------------------------------------  693 (889)
T ss_pred             hhhHHhhhcccchhhheeecchh-HhHhhhhhhHHHH-------------------------------------------
Confidence            23456666666777666543322 1111110111111                                           


Q ss_pred             cccceEEecCcCCcccccccCcCCCCCCCcEEEEccCCCceEEeecccccccccC-cccccceeeccccccccceecCCC
Q 048809          458 KGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTT-AFPVLESLLLRHLSNLEKICRGPL  536 (878)
Q Consensus       458 ~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~-~~~~L~~L~L~~~~~L~~~~~~~~  536 (878)
                      ...+.+.+.++.. ......+  ..+.+|+.|.+.+|.............  ... .|+++..+.+.+|..+....+   
T Consensus       694 ~~~~~l~~~~~~~-~~~~~~~--~~l~~L~~L~i~~~~~~e~~~~~~~~~--~~~~~f~~l~~~~~~~~~~~r~l~~---  765 (889)
T KOG4658|consen  694 SLLQSLSIEGCSK-RTLISSL--GSLGNLEELSILDCGISEIVIEWEESL--IVLLCFPNLSKVSILNCHMLRDLTW---  765 (889)
T ss_pred             HHhHhhhhccccc-ceeeccc--ccccCcceEEEEcCCCchhhccccccc--chhhhHHHHHHHHhhccccccccch---
Confidence            1111222211111 1111222  457888888888887543211100000  112 266777777777765554321   


Q ss_pred             CccccCCccEEEeecCCCcccccchhhhhhccCccEEEEecCCcchhhhcccccccccCCCCcccccccccee-ecccCC
Q 048809          537 AAESFCKVKDIRVEWCDKLKNVFPLVIGRGLQQLQSIEVTGCQNLEVIFAAERGDESSNSNTQVIELTQLTTL-ELCSLP  615 (878)
Q Consensus       537 ~~~~l~~L~~L~l~~c~~L~~l~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~L~~c~  615 (878)
                       ....|+|+.|.+..|+.+..+.+.  .+.+..++++.+                          .+.++..+ .+.+.+
T Consensus       766 -~~f~~~L~~l~l~~~~~~e~~i~~--~k~~~~l~~~i~--------------------------~f~~~~~l~~~~~l~  816 (889)
T KOG4658|consen  766 -LLFAPHLTSLSLVSCRLLEDIIPK--LKALLELKELIL--------------------------PFNKLEGLRMLCSLG  816 (889)
T ss_pred             -hhccCcccEEEEecccccccCCCH--HHHhhhcccEEe--------------------------cccccccceeeecCC
Confidence             234577777777777777666542  233333333111                          13344444 344444


Q ss_pred             CcceecCCCcccccCCcceEEEecCCCcc
Q 048809          616 QLTSFCTGDLHFEFPSLEKLKILECPQVK  644 (878)
Q Consensus       616 ~l~~~~~~~~~~~~~~L~~L~l~~C~~l~  644 (878)
                      .+..+...  ...++.|+.+.+..||++.
T Consensus       817 ~l~~i~~~--~l~~~~l~~~~ve~~p~l~  843 (889)
T KOG4658|consen  817 GLPQLYWL--PLSFLKLEELIVEECPKLG  843 (889)
T ss_pred             CCceeEec--ccCccchhheehhcCcccc
Confidence            44443321  2235558888888888776



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query878
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 7e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 7e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 99.7 bits (248), Expect = 7e-22
 Identities = 31/217 (14%), Positives = 66/217 (30%), Gaps = 25/217 (11%)

Query: 3   GCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVK 62
             + L+T R  ++ ++     + I V  L   E +   E          + + V  + ++
Sbjct: 265 RLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIE 324

Query: 63  ECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSS----------LELSYY 112
             +G P  ++   K+ + K+          +L+++ L+G    +          L+    
Sbjct: 325 LSSGNPATLMMFFKSCEPKTFEK-MAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVE 383

Query: 113 HLEDEDLGGEELRKTFLLIG---YSYIRNVKDLLYHGMGLGLFQNINTVDEARDRAHTLV 169
            L D      E R                VK          +    N  ++  D     +
Sbjct: 384 VLSD------EDRSALAFAVVMPPGVDIPVKLWSCVIP---VDICSNEEEQLDDEVADRL 434

Query: 170 DKLKNSCLLLGGWRS--EWFSMHDVVRDVAISIASRD 204
            +L     LL G R     F +  ++      +    
Sbjct: 435 KRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQ 471


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query878
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.85
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.77
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.77
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.73
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.71
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.71
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.68
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.68
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.64
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.64
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.64
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.64
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.59
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.53
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.53
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.52
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.49
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.49
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.48
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.47
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.47
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.46
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.45
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.45
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.45
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.44
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.43
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.41
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.39
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.38
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.36
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.35
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.28
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.25
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.2
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.19
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.96
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.95
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.63
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.54
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.36
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.81
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.7
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.56
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.51
2fna_A357 Conserved hypothetical protein; structural genomic 96.48
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.71
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.15
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 90.0
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 88.4
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.03
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 85.06
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-36  Score=366.16  Aligned_cols=470  Identities=15%  Similarity=0.066  Sum_probs=252.8

Q ss_pred             CCCcEEEeeCCCCCC----CCCCC-CCCCccEEEeecCCCCCCCchhhcCCCCCcEEEeeCCCCC-CCCc--cccCCCCC
Q 048809          227 KDCTAISLNNSNINE----LPQGF-ECPQLKYFRIHNDHSLKIPDNFFTGMTELRVLDFTRMHLL-ALPS--SLGLLQNL  298 (878)
Q Consensus       227 ~~lr~l~l~~~~~~~----l~~~~-~~~~Lr~L~l~~~~~~~l~~~~~~~l~~Lr~L~Ls~~~i~-~lp~--~i~~L~~L  298 (878)
                      ..++.|+++++.+..    +++.+ .+++|+.++++.+.+..+|.. |+++++|++|+|++|.+. .+|.  .++++++|
T Consensus        50 ~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~-~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L  128 (768)
T 3rgz_A           50 DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG-FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGL  128 (768)
T ss_dssp             TEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCC-CCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTC
T ss_pred             CcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchh-hccCCCCCEEECCCCcCCCcCCChHHHhCCCCC
Confidence            467888888877654    44444 678888888887766556665 588999999999999885 4677  88999999


Q ss_pred             cEEEccCCCCCCc--cc-ccCcccCcEEEeeCCCcccchH-h---hcccccCccc----------ccc-cccCCcEEEcc
Q 048809          299 QTLSLDYCELGDM--AI-IGDLKKLVILALRGSDMKELVG-E---IGQLTQLRLL----------IAP-ILSRLEELYIG  360 (878)
Q Consensus       299 ~~L~L~~~~l~~l--~~-i~~L~~L~~L~l~~~~l~~lp~-~---i~~L~~L~~L----------ip~-~l~~L~~L~l~  360 (878)
                      ++|+|++|.+...  .. ++++++|++|++++|.++..+. .   ++++++|++|          +|. .+++|+.|++.
T Consensus       129 ~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls  208 (768)
T 3rgz_A          129 KFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVS  208 (768)
T ss_dssp             CEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECC
T ss_pred             CEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECc
Confidence            9999999986532  33 3788999999999998876543 3   6788888888          121 77889999998


Q ss_pred             CCCCCccccccccccccccCcccccCCCCCCEEEeecCCCC-CCCcchhcccCCceEEEEecccccccccchhhhhhhhh
Q 048809          361 ESPIEWGKVEGVDGERRNASLHELNNLSKLTSLEILIQDEK-TLPRDLSFFKMLQRYRILIGSQWTWDYISSEISEIFRL  439 (878)
Q Consensus       361 ~~~~~~~~~~~~~~~~~~~~~~~L~~l~~L~~L~l~~~~~~-~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~  439 (878)
                      +|.+.            .. +..++++++|++|++++|... .+|..+..+++|+.|+++.+........          
T Consensus       209 ~n~l~------------~~-~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~----------  265 (768)
T 3rgz_A          209 SNNFS------------TG-IPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP----------  265 (768)
T ss_dssp             SSCCC------------SC-CCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCC----------
T ss_pred             CCcCC------------CC-CcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCc----------
Confidence            88765            11 223788889999999988865 4567777888888888864432111000          


Q ss_pred             hhccCCccccchhHHhhccccceEEecCcCCcccccccCcCCCCCCCcEEEEccCCCceEEeecccccccccCcccccce
Q 048809          440 MVASGANICLNGGHIMQLKGIKDLCLGGSLDMKSVLYGSDGEGFPQLKRLEVVKNSNLLCVVDTVDRATALTTAFPVLES  519 (878)
Q Consensus       440 ~l~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~L~~  519 (878)
                                     ..+++|++|++.++.....+...+ ...+++|++|++.++.-...++.       ....+++|+.
T Consensus       266 ---------------~~l~~L~~L~L~~n~l~~~ip~~~-~~~~~~L~~L~Ls~n~l~~~~p~-------~~~~l~~L~~  322 (768)
T 3rgz_A          266 ---------------LPLKSLQYLSLAENKFTGEIPDFL-SGACDTLTGLDLSGNHFYGAVPP-------FFGSCSLLES  322 (768)
T ss_dssp             ---------------CCCTTCCEEECCSSEEEESCCCCS-CTTCTTCSEEECCSSEEEECCCG-------GGGGCTTCCE
T ss_pred             ---------------cccCCCCEEECcCCccCCccCHHH-HhhcCcCCEEECcCCcCCCccch-------HHhcCCCccE
Confidence                           024556666666554322222222 12235666666655431111110       3344556666


Q ss_pred             eeccccccccceecCCCCccccCCccEEEeecCCCcc-cccchhhhhhcc-CccEEEEecCCcchhhhcccccccccCCC
Q 048809          520 LLLRHLSNLEKICRGPLAAESFCKVKDIRVEWCDKLK-NVFPLVIGRGLQ-QLQSIEVTGCQNLEVIFAAERGDESSNSN  597 (878)
Q Consensus       520 L~L~~~~~L~~~~~~~~~~~~l~~L~~L~l~~c~~L~-~l~~~~~~~~l~-~L~~L~l~~c~~l~~~~~~~~~~~~~~~~  597 (878)
                      |+++++.-...++..  .+..+++|+.|++.+| ++. .+|.  .+..++ +|++|++++|.....++.....       
T Consensus       323 L~L~~n~l~~~ip~~--~l~~l~~L~~L~Ls~n-~l~~~~p~--~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~-------  390 (768)
T 3rgz_A          323 LALSSNNFSGELPMD--TLLKMRGLKVLDLSFN-EFSGELPE--SLTNLSASLLTLDLSSNNFSGPILPNLCQ-------  390 (768)
T ss_dssp             EECCSSEEEEECCHH--HHTTCTTCCEEECCSS-EEEECCCT--THHHHTTTCSEEECCSSEEEEECCTTTTC-------
T ss_pred             EECCCCcccCcCCHH--HHhcCCCCCEEeCcCC-ccCccccH--HHHhhhcCCcEEEccCCCcCCCcChhhhh-------
Confidence            666554321122110  1334555666666554 232 2222  223343 5555655554332222211110       


Q ss_pred             CccccccccceeecccCCCcceecCCCcccccCCcceEEEecCCCcc-ccccccccccccccceeEEEEeccccccccee
Q 048809          598 TQVIELTQLTTLELCSLPQLTSFCTGDLHFEFPSLEKLKILECPQVK-FKSTIHESTKKRFHTIKVLCIEGYDYDGEELF  676 (878)
Q Consensus       598 ~~~~~~~~L~~L~L~~c~~l~~~~~~~~~~~~~~L~~L~l~~C~~l~-lp~~~~~~~~~~l~~L~~L~l~~c~~~~~~~~  676 (878)
                         ..+++|+.|++++|.....++.  ....+++|++|++++|..-. +|..+ ..    +++|+.|++++|.. ...+.
T Consensus       391 ---~~~~~L~~L~L~~n~l~~~~p~--~l~~l~~L~~L~Ls~N~l~~~~p~~l-~~----l~~L~~L~L~~n~l-~~~~p  459 (768)
T 3rgz_A          391 ---NPKNTLQELYLQNNGFTGKIPP--TLSNCSELVSLHLSFNYLSGTIPSSL-GS----LSKLRDLKLWLNML-EGEIP  459 (768)
T ss_dssp             ---STTCCCCEEECCSSEEEEECCG--GGGGCTTCCEEECCSSEEESCCCGGG-GG----CTTCCEEECCSSCC-CSCCC
T ss_pred             ---cccCCccEEECCCCccccccCH--HHhcCCCCCEEECcCCcccCcccHHH-hc----CCCCCEEECCCCcc-cCcCC
Confidence               0134455555555432222222  23344555555555532111 33222 22    45555555555543 22222


Q ss_pred             eeccccccceeeccCCCCchhhhccccccccCCccEEEEccCCCcccccCcccccCCCcEEEecccCCceEeechhhhhh
Q 048809          677 ETVENGVNAMIKGINFHPDLKQILKQESSHANNLEVLEIYGCDNLINLVPSSTSFQNLTTVAVDFCYGMINILTSSTAKS  756 (878)
Q Consensus       677 ~~~~~~~~l~~l~l~~~~~l~~i~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~  756 (878)
                      .......+++.++++++.- ....+..+..+++|++|++++|.....+|..++.+++|+.|++++| .+....+ ..+..
T Consensus       460 ~~~~~l~~L~~L~L~~N~l-~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N-~l~~~~p-~~l~~  536 (768)
T 3rgz_A          460 QELMYVKTLETLILDFNDL-TGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN-SFSGNIP-AELGD  536 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCC-CSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS-CCEEECC-GGGGG
T ss_pred             HHHcCCCCceEEEecCCcc-cCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCC-cccCcCC-HHHcC
Confidence            2222233444444444322 2222333444555555555555444444444455555555555553 3332222 22344


Q ss_pred             hccceEEEEcccc
Q 048809          757 LVRLKQMKIFHCK  769 (878)
Q Consensus       757 l~~L~~L~i~~C~  769 (878)
                      +++|+.|++++|+
T Consensus       537 l~~L~~L~Ls~N~  549 (768)
T 3rgz_A          537 CRSLIWLDLNTNL  549 (768)
T ss_dssp             CTTCCEEECCSSE
T ss_pred             CCCCCEEECCCCc
Confidence            5555555555443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 878
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 9e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 70.2 bits (171), Expect = 9e-14
 Identities = 19/113 (16%), Positives = 43/113 (38%), Gaps = 2/113 (1%)

Query: 2   GGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIV 61
              + L+T R  ++ ++     + I V  L   E +   E          + + V  + +
Sbjct: 156 LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTI 215

Query: 62  KECAGLPIAILPVAKALKNKSSLYVWKDALRQLKNKSLLGAAYSSLELSYYHL 114
           +  +G P  ++   K+ + K +         +L+++ L+G        SY  L
Sbjct: 216 ELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLESRGLVG-VECITPYSYKSL 266


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query878
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.22
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.06
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.88
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.42
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.11
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.83  E-value=1.5e-21  Score=199.68  Aligned_cols=122  Identities=16%  Similarity=0.174  Sum_probs=105.9

Q ss_pred             CCcEEEEEeCChHHhhccCCCCccEEcCCCChHHHHHHHHHHhCCCCCChhhHHHHHHHHHHcCCCcchHHHHHHHHhcC
Q 048809            2 GGCKVLLTARSHDVLSSKMDCQKNIFVDVLNAKEAWSLFEKMTGDCIENGELKSVATEIVKECAGLPIAILPVAKALKNK   81 (878)
Q Consensus         2 ~gs~iivTtR~~~v~~~~~~~~~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~~~~~~i~~~c~g~Pla~~~~g~~l~~~   81 (878)
                      .|||||||||++.||..+....+.|+|++|+.+|||+||+++|+.....+..++++++||++|+|+||||+++|+.|+.+
T Consensus       156 ~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k  235 (277)
T d2a5yb3         156 LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK  235 (277)
T ss_dssp             TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS
T ss_pred             cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC
Confidence            58999999999999996333347899999999999999999996545556678999999999999999999999999987


Q ss_pred             CChHHHHHHHHHHHccCcchhhhhhhhhcccccCCCCCChHHHHHHHhhh
Q 048809           82 SSLYVWKDALRQLKNKSLLGAAYSSLELSYYHLEDEDLGGEELRKTFLLI  131 (878)
Q Consensus        82 ~~~~~w~~~l~~l~~~~~~~~~~~~l~~sy~~L~~~~~~~~~~k~cf~~~  131 (878)
                       +.++|.+..+.++.... .++.+++.+||++||+      ++|+||.++
T Consensus       236 -~~~~~~~~~~~L~~~~~-~~v~~il~~sY~~L~~------~lk~c~~~l  277 (277)
T d2a5yb3         236 -TFEKMAQLNNKLESRGL-VGVECITPYSYKSLAM------ALQRCVEVL  277 (277)
T ss_dssp             -SHHHHHHHHHHHHHHCS-STTCCCSSSSSSSHHH------HHHHHHHTS
T ss_pred             -CHHHHHHHHHHHhcCcH-HHHHHHHHHHHhcccH------HHHHHHHhC
Confidence             78899999888876543 4899999999999999      999999874



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure