Psyllid ID: psy10170
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 366 | ||||||
| 328724570 | 2494 | PREDICTED: papilin-like isoform 2 [Acyrt | 0.852 | 0.125 | 0.452 | 7e-81 | |
| 328724572 | 2553 | PREDICTED: papilin-like isoform 1 [Acyrt | 0.841 | 0.120 | 0.454 | 3e-80 | |
| 307206898 | 2983 | Papilin [Harpegnathos saltator] | 0.844 | 0.103 | 0.483 | 4e-78 | |
| 242022723 | 2838 | papilin, putative [Pediculus humanus cor | 0.849 | 0.109 | 0.477 | 5e-78 | |
| 383852694 | 2894 | PREDICTED: papilin-like [Megachile rotun | 0.844 | 0.106 | 0.480 | 8e-77 | |
| 270010741 | 2771 | hypothetical protein TcasGA2_TC010195 [T | 0.838 | 0.110 | 0.480 | 8e-76 | |
| 350422357 | 2962 | PREDICTED: LOW QUALITY PROTEIN: papilin- | 0.849 | 0.104 | 0.468 | 9e-76 | |
| 340713638 | 3067 | PREDICTED: papilin-like [Bombus terrestr | 0.844 | 0.100 | 0.468 | 3e-75 | |
| 6164595 | 3198 | lacunin [Manduca sexta] | 0.816 | 0.093 | 0.449 | 7e-75 | |
| 380025477 | 2813 | PREDICTED: papilin-like [Apis florea] | 0.844 | 0.109 | 0.471 | 1e-74 |
| >gi|328724570|ref|XP_003248188.1| PREDICTED: papilin-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 306 bits (785), Expect = 7e-81, Method: Compositional matrix adjust.
Identities = 156/345 (45%), Positives = 210/345 (60%), Gaps = 33/345 (9%)
Query: 35 APTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEG 94
P PNL+GCGC+YTP+GCCPDN T ARGP+N+GC CQYTEHKCCPD +TPA+GP Y+G
Sbjct: 1332 VPANGPNLQGCGCIYTPFGCCPDNTTTARGPNNSGCSCQYTEHKCCPDNFTPASGPQYQG 1391
Query: 95 CPCYTYQFGCCPDGVTRAVGPRQQD----------ATASTTPTPDKSKPSEPPKEDCAAT 144
C C+TYQFGCCPDG+T+A+GP Q + TP PD+SK C A+
Sbjct: 1392 CACHTYQFGCCPDGITKAIGPNSQGCGCEYTQYGCCSDKNTPAPDESKNCS-----CEAS 1446
Query: 145 QFGCCPDGTAATK-KTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPR 203
++GCC DG +K + E C + D C++P +RG C+ +
Sbjct: 1447 KYGCCLDGITESKGENFEGCQSKPIL--------------PGDRCKEPKDRGSCSDFTVK 1492
Query: 204 WAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKR 263
W F+ E C +F+YGGC GN N F+++ C + C+ P R +C LP G C Y+
Sbjct: 1493 WFFDTEYGGCSRFWYGGCNGNNNRFKTQEECKDICVEPS-GRDVCYLPKSVGPCEGYYPT 1551
Query: 264 YYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPP--RDPCEQPIERGDCNGNYPRW 321
+YYD+ R+ C F+Y GC GN N+F T EEC H C P DPCEQP+ G C GN+ RW
Sbjct: 1552 WYYDQDRKQCAQFVYGGCLGNNNKFQTREECEHLCVIPDTLDPCEQPLTPGPCKGNFSRW 1611
Query: 322 AFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRGVGT 366
++K +SC QF YGGCKG+ NNF ++ +C KC++P + + + T
Sbjct: 1612 YYDKSTRSCSQFNYGGCKGSQNNFLNKESCNHKCINPLKAQEIDT 1656
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328724572|ref|XP_001951980.2| PREDICTED: papilin-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307206898|gb|EFN84744.1| Papilin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242022723|ref|XP_002431788.1| papilin, putative [Pediculus humanus corporis] gi|212517113|gb|EEB19050.1| papilin, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383852694|ref|XP_003701860.1| PREDICTED: papilin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|270010741|gb|EFA07189.1| hypothetical protein TcasGA2_TC010195 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350422357|ref|XP_003493139.1| PREDICTED: LOW QUALITY PROTEIN: papilin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340713638|ref|XP_003395347.1| PREDICTED: papilin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|6164595|gb|AAF04457.1|AF078161_1 lacunin [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|380025477|ref|XP_003696500.1| PREDICTED: papilin-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 366 | ||||||
| FB|FBgn0003137 | 2898 | Ppn "Papilin" [Drosophila mela | 0.833 | 0.105 | 0.419 | 5.1e-70 | |
| WB|WBGene00003242 | 2167 | mig-6 [Caenorhabditis elegans | 0.693 | 0.117 | 0.379 | 1.4e-53 | |
| WB|WBGene00012186 | 3129 | mlt-11 [Caenorhabditis elegans | 0.486 | 0.056 | 0.389 | 1.3e-36 | |
| ZFIN|ZDB-GENE-060503-38 | 233 | tfpi2 "tissue factor pathway i | 0.459 | 0.721 | 0.391 | 3.1e-35 | |
| UNIPROTKB|Q7YRQ8 | 234 | TFPI2 "Tissue factor pathway i | 0.483 | 0.756 | 0.374 | 3.6e-34 | |
| UNIPROTKB|F1SFC1 | 232 | LOC100520144 "Uncharacterized | 0.475 | 0.75 | 0.375 | 5.8e-34 | |
| UNIPROTKB|E1BVF2 | 239 | TFPI2 "Uncharacterized protein | 0.486 | 0.744 | 0.370 | 9.5e-34 | |
| UNIPROTKB|E2RBF0 | 235 | TFPI2 "Uncharacterized protein | 0.483 | 0.753 | 0.357 | 2.3e-32 | |
| UNIPROTKB|B5ST96 | 303 | LOC100155068 "Uncharacterized | 0.303 | 0.366 | 0.387 | 1.1e-31 | |
| ZFIN|ZDB-GENE-030711-1 | 292 | tfpia "tissue factor pathway i | 0.295 | 0.369 | 0.409 | 3.4e-22 |
| FB|FBgn0003137 Ppn "Papilin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 705 (253.2 bits), Expect = 5.1e-70, Sum P(2) = 5.1e-70
Identities = 138/329 (41%), Positives = 176/329 (53%)
Query: 40 PNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYT 99
PN EGC C YTPYGCCPDN++ A G + GC C+ T++ CCPDK T A GP +EGCPC T
Sbjct: 1471 PNNEGCECHYTPYGCCPDNKSAATGYNQEGCACETTQYGCCPDKITAAKGPKHEGCPCET 1530
Query: 100 YQFGCCPDGVTRAVGPRQ------QXXXXXXXXXXXXXXXXXXXXXXCAATQFGCCPDGT 153
QFGCCPDG+T A GP Q C ++FGCCPDG
Sbjct: 1531 TQFGCCPDGLTFAKGPHHHGCHCTQTEFKCCDDEKTPAKGPNGDGCTCVESKFGCCPDGV 1590
Query: 154 AATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSC 213
TK T E G + +V P C P E G CN ++ F+ C
Sbjct: 1591 --TKATDEKFGGCE----NVQE----PPQKA---CGLPKETGTCNNYSVKYYFDTSYGGC 1637
Query: 214 EQFYYGGCKGNGNNFQSESACLEKCL-HPGRTRVICRLPGDGGMCSEYHKRYYYDERRQT 272
+F+YGGC GN N F+SE+ C + C + G+ +C LP G C+ + K++Y+D R
Sbjct: 1638 ARFWYGGCDGNDNRFESEAECKDTCQDYTGKH--VCLLPKSAGPCTGFTKKWYFDVDRNR 1695
Query: 273 CVPFIYTGCGGNLNRFTTSEECLHYCSPPRD-P-CEQPIERGDCNGNYPRWAFNKEAKSC 330
C F Y GC G NRF + E+C C+ + P CEQP+E G C GN+ RW ++ E C
Sbjct: 1696 CEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNETDIC 1755
Query: 331 EQFYYGGCKGNGNNFQSESACLEKCLHPG 359
F YGGCKGN NN+ +E AC C PG
Sbjct: 1756 RPFTYGGCKGNKNNYPTEHACNYNCRQPG 1784
|
|
| WB|WBGene00003242 mig-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00012186 mlt-11 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-38 tfpi2 "tissue factor pathway inhibitor 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7YRQ8 TFPI2 "Tissue factor pathway inhibitor 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SFC1 LOC100520144 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVF2 TFPI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBF0 TFPI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5ST96 LOC100155068 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030711-1 tfpia "tissue factor pathway inhibitor a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 366 | |||
| cd00109 | 54 | cd00109, KU, BPTI/Kunitz family of serine protease | 9e-17 | |
| cd00109 | 54 | cd00109, KU, BPTI/Kunitz family of serine protease | 9e-17 | |
| smart00131 | 53 | smart00131, KU, BPTI/Kunitz family of serine prote | 4e-16 | |
| smart00131 | 53 | smart00131, KU, BPTI/Kunitz family of serine prote | 4e-16 | |
| cd00109 | 54 | cd00109, KU, BPTI/Kunitz family of serine protease | 2e-15 | |
| pfam00014 | 53 | pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t | 2e-15 | |
| pfam00014 | 53 | pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t | 2e-15 | |
| smart00131 | 53 | smart00131, KU, BPTI/Kunitz family of serine prote | 7e-15 | |
| pfam00014 | 53 | pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t | 3e-14 |
| >gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
Score = 73.1 bits (180), Expect = 9e-17
Identities = 22/54 (40%), Positives = 28/54 (51%)
Query: 186 DPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL 239
D C P + G C PR+ ++ K CE F YGGC GN NNF ++ C C
Sbjct: 1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG 54
|
BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. Length = 54 |
| >gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
| >gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
| >gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain | Back alignment and domain information |
|---|
| >gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain | Back alignment and domain information |
|---|
| >gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| cd00109 | 54 | KU BPTI/Kunitz family of serine protease inhibitor | 99.5 | |
| smart00131 | 53 | KU BPTI/Kunitz family of serine protease inhibitor | 99.48 | |
| PF00014 | 53 | Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi | 99.45 | |
| cd00109 | 54 | KU BPTI/Kunitz family of serine protease inhibitor | 99.43 | |
| smart00131 | 53 | KU BPTI/Kunitz family of serine protease inhibitor | 99.4 | |
| PF00014 | 53 | Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi | 99.4 | |
| KOG4295|consensus | 295 | 99.33 | ||
| KOG4295|consensus | 295 | 99.3 | ||
| KOG4597|consensus | 560 | 98.6 | ||
| KOG4597|consensus | 560 | 98.56 | ||
| KOG3540|consensus | 615 | 90.57 | ||
| KOG3540|consensus | 615 | 86.83 |
| >cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
Probab=99.50 E-value=3.3e-14 Score=104.33 Aligned_cols=54 Identities=41% Similarity=0.975 Sum_probs=51.8
Q ss_pred CCCCCCCccCCCCCCCCeeEEecCCCcceeeEecccCCCCCCcCChHHHHHhCC
Q psy10170 303 DPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL 356 (366)
Q Consensus 303 ~~C~~p~~~G~C~~~~~RwyYd~~~~~C~~F~Y~GC~GN~NnF~T~~eC~~~C~ 356 (366)
++|.+|++.|.|...+.|||||+++++|++|.|+||.+|.|+|.|+++|+++|.
T Consensus 1 ~~C~~~~~~g~C~~~~~~~~yd~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~ 54 (54)
T cd00109 1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG 54 (54)
T ss_pred CcccCCCCCCCCCCCccEEEEeCCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence 479999999999999999999999999999999999999999999999999995
|
BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. |
| >smart00131 KU BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus | Back alignment and domain information |
|---|
| >cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
| >smart00131 KU BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus | Back alignment and domain information |
|---|
| >KOG4295|consensus | Back alignment and domain information |
|---|
| >KOG4295|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >KOG3540|consensus | Back alignment and domain information |
|---|
| >KOG3540|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 366 | ||||
| 1bik_A | 147 | X-Ray Structure Of Bikunin From The Human Inter-Alp | 4e-19 | ||
| 1bik_A | 147 | X-Ray Structure Of Bikunin From The Human Inter-Alp | 2e-16 | ||
| 2ody_E | 127 | Thrombin-bound Boophilin Displays A Functional And | 2e-18 | ||
| 2ody_E | 127 | Thrombin-bound Boophilin Displays A Functional And | 6e-06 | ||
| 2ddi_A | 70 | Nmr Structure Of The Second Kunitz Domain Of Human | 8e-09 | ||
| 2ddi_A | 70 | Nmr Structure Of The Second Kunitz Domain Of Human | 4e-08 | ||
| 1kth_A | 58 | The Anisotropic Refinement Of Kunitz Type Domain C5 | 1e-08 | ||
| 1kth_A | 58 | The Anisotropic Refinement Of Kunitz Type Domain C5 | 3e-05 | ||
| 2jot_A | 55 | Nuclear Magnetic Resonance Studies On Huwentoxin-Xi | 2e-08 | ||
| 2jot_A | 55 | Nuclear Magnetic Resonance Studies On Huwentoxin-Xi | 2e-08 | ||
| 1irh_A | 61 | The Solution Structure Of The Third Kunitz Domain O | 3e-07 | ||
| 1irh_A | 61 | The Solution Structure Of The Third Kunitz Domain O | 2e-04 | ||
| 1zr0_B | 63 | Crystal Structure Of Kunitz Domain 1 Of Tissue Fact | 3e-07 | ||
| 1zr0_B | 63 | Crystal Structure Of Kunitz Domain 1 Of Tissue Fact | 2e-06 | ||
| 1zr0_B | 63 | Crystal Structure Of Kunitz Domain 1 Of Tissue Fact | 4e-06 | ||
| 1dtk_A | 57 | The Nmr Solution Structure Of Dendrotoxin K From Th | 1e-06 | ||
| 3byb_A | 59 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 2e-06 | ||
| 3byb_A | 59 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 3e-06 | ||
| 3d65_I | 57 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 2e-06 | ||
| 3d65_I | 57 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 3e-06 | ||
| 1aap_A | 58 | X-Ray Crystal Structure Of The Protease Inhibitor D | 4e-06 | ||
| 1brc_I | 56 | Relocating A Negative Charge In The Binding Pocket | 4e-06 | ||
| 1yc0_I | 75 | Short Form Hgfa With First Kunitz Domain From Hai-1 | 5e-06 | ||
| 1yc0_I | 75 | Short Form Hgfa With First Kunitz Domain From Hai-1 | 5e-06 | ||
| 4dtg_K | 66 | Hemostatic Effect Of A Monoclonal Antibody Mab 2021 | 1e-05 | ||
| 4dtg_K | 66 | Hemostatic Effect Of A Monoclonal Antibody Mab 2021 | 1e-04 | ||
| 1tfx_C | 58 | Complex Of The Second Kunitz Domain Of Tissue Facto | 1e-05 | ||
| 1tfx_C | 58 | Complex Of The Second Kunitz Domain Of Tissue Facto | 1e-04 | ||
| 1bti_A | 58 | Crevice-Forming Mutants In The Rigid Core Of Bovine | 1e-05 | ||
| 1bti_A | 58 | Crevice-Forming Mutants In The Rigid Core Of Bovine | 2e-05 | ||
| 3l3t_E | 57 | Human Mesotrypsin Complexed With Amyloid Precursor | 2e-05 | ||
| 3l3t_E | 57 | Human Mesotrypsin Complexed With Amyloid Precursor | 2e-05 | ||
| 1zjd_B | 57 | Crystal Structure Of The Catalytic Domain Of Coagul | 2e-05 | ||
| 1zjd_B | 57 | Crystal Structure Of The Catalytic Domain Of Coagul | 2e-05 | ||
| 1dem_A | 60 | Proteinase Inhibitor Homologues As Potassium Channe | 2e-05 | ||
| 1ca0_D | 54 | Bovine Chymotrypsin Complexed To Appi Length = 54 | 2e-05 | ||
| 1ca0_D | 54 | Bovine Chymotrypsin Complexed To Appi Length = 54 | 2e-05 | ||
| 1bf0_A | 60 | Calcicludine (Cac) From Green Mamba Dendroaspis Ang | 2e-05 | ||
| 1bf0_A | 60 | Calcicludine (Cac) From Green Mamba Dendroaspis Ang | 5e-05 | ||
| 1adz_A | 71 | The Solution Structure Of The Second Kunitz Domain | 2e-05 | ||
| 1adz_A | 71 | The Solution Structure Of The Second Kunitz Domain | 2e-04 | ||
| 3l33_E | 52 | Human Mesotrypsin Complexed With Amyloid Precursor | 2e-05 | ||
| 3l33_E | 52 | Human Mesotrypsin Complexed With Amyloid Precursor | 2e-05 | ||
| 3bth_I | 58 | The Crystal Structures Of The Complexes Between Bov | 2e-05 | ||
| 3bth_I | 58 | The Crystal Structures Of The Complexes Between Bov | 3e-05 | ||
| 3btd_I | 58 | The Crystal Structures Of The Complexes Between The | 2e-05 | ||
| 3btd_I | 58 | The Crystal Structures Of The Complexes Between The | 3e-05 | ||
| 1fak_I | 55 | Human Tissue Factor Complexed With Coagulation Fact | 3e-05 | ||
| 1fak_I | 55 | Human Tissue Factor Complexed With Coagulation Fact | 3e-05 | ||
| 1qlq_A | 58 | Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant W | 3e-05 | ||
| 1qlq_A | 58 | Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant W | 3e-05 | ||
| 3btt_I | 58 | The Crystal Structures Of The Complexes Between Bov | 3e-05 | ||
| 3btt_I | 58 | The Crystal Structures Of The Complexes Between Bov | 3e-05 | ||
| 1y62_A | 60 | A 2.4 Crystal Structure Of Conkunitzin-S1, A Novel | 3e-05 | ||
| 1dtx_A | 59 | Crystal Structure Of Alpha-Dendrotoxin From The Gre | 3e-05 | ||
| 1co7_I | 99 | R117h Mutant Rat Anionic Trypsin Complexed With Bov | 3e-05 | ||
| 1co7_I | 99 | R117h Mutant Rat Anionic Trypsin Complexed With Bov | 4e-05 | ||
| 1t8l_B | 59 | Crystal Structure Of The P1 Met Bpti Mutant- Bovine | 3e-05 | ||
| 1t8l_B | 59 | Crystal Structure Of The P1 Met Bpti Mutant- Bovine | 4e-05 | ||
| 3btq_I | 58 | The Crystal Structures Of The Complexes Between Bov | 4e-05 | ||
| 3btq_I | 58 | The Crystal Structures Of The Complexes Between Bov | 4e-05 | ||
| 3btm_I | 58 | The Crystal Structures Of The Complexes Between Bov | 4e-05 | ||
| 3btm_I | 58 | The Crystal Structures Of The Complexes Between Bov | 4e-05 | ||
| 3btg_I | 58 | The Crystal Structures Of The Complexes Between Bov | 4e-05 | ||
| 3btg_I | 58 | The Crystal Structures Of The Complexes Between Bov | 5e-05 | ||
| 3bte_I | 58 | The Crystal Structures Of The Complexes Between Bov | 4e-05 | ||
| 3bte_I | 58 | The Crystal Structures Of The Complexes Between Bov | 5e-05 | ||
| 3p95_E | 58 | Human Mesotrypsin Complexed With Bovine Pancreatic | 4e-05 | ||
| 3p95_E | 58 | Human Mesotrypsin Complexed With Bovine Pancreatic | 5e-05 | ||
| 1p2k_I | 58 | Structural Consequences Of Accommodation Of Four No | 4e-05 | ||
| 1p2k_I | 58 | Structural Consequences Of Accommodation Of Four No | 5e-05 | ||
| 1p2j_I | 58 | Structural Consequences Of Accommodation Of Four No | 5e-05 | ||
| 1p2j_I | 58 | Structural Consequences Of Accommodation Of Four No | 5e-05 | ||
| 3btf_I | 58 | The Crystal Structures Of The Complexes Between Bov | 5e-05 | ||
| 3btf_I | 58 | The Crystal Structures Of The Complexes Between Bov | 6e-05 | ||
| 1uub_A | 56 | Solution Structure Of A Truncated Bovine Pancreatic | 6e-05 | ||
| 1uub_A | 56 | Solution Structure Of A Truncated Bovine Pancreatic | 6e-05 | ||
| 1ld5_A | 58 | Structure Of Bpti Mutant A16v Length = 58 | 6e-05 | ||
| 1ld5_A | 58 | Structure Of Bpti Mutant A16v Length = 58 | 6e-05 | ||
| 1ykt_B | 56 | TrypsinBPTI COMPLEX MUTANT Length = 56 | 6e-05 | ||
| 1ykt_B | 56 | TrypsinBPTI COMPLEX MUTANT Length = 56 | 6e-05 | ||
| 1ejm_B | 58 | Crystal Structure Of The Bpti Ala16leu Mutant In Co | 6e-05 | ||
| 1ejm_B | 58 | Crystal Structure Of The Bpti Ala16leu Mutant In Co | 7e-05 | ||
| 4tpi_I | 58 | The Refined 2.2-angstroms (0.22-nm) X-ray Crystal S | 6e-05 | ||
| 4tpi_I | 58 | The Refined 2.2-angstroms (0.22-nm) X-ray Crystal S | 7e-05 | ||
| 1tpa_I | 58 | The Geometry Of The Reactive Site And Of The Peptid | 7e-05 | ||
| 1tpa_I | 58 | The Geometry Of The Reactive Site And Of The Peptid | 7e-05 | ||
| 1pit_A | 58 | Determination Of A High-Quality Nuclear Magnetic Re | 7e-05 | ||
| 1pit_A | 58 | Determination Of A High-Quality Nuclear Magnetic Re | 7e-05 | ||
| 3p92_E | 58 | Human Mesotrypsin Complexed With Bovine Pancreatic | 7e-05 | ||
| 3p92_E | 58 | Human Mesotrypsin Complexed With Bovine Pancreatic | 8e-05 | ||
| 1uua_A | 56 | Solution Structure Of A Truncated Bovine Pancreatic | 7e-05 | ||
| 1uua_A | 56 | Solution Structure Of A Truncated Bovine Pancreatic | 7e-05 | ||
| 3btw_I | 58 | The Crystal Structures Of The Complexes Between Bov | 8e-05 | ||
| 3btw_I | 58 | The Crystal Structures Of The Complexes Between Bov | 1e-04 | ||
| 3tgi_I | 65 | Wild-Type Rat Anionic Trypsin Complexed With Bovine | 9e-05 | ||
| 3tgi_I | 65 | Wild-Type Rat Anionic Trypsin Complexed With Bovine | 1e-04 | ||
| 1jv8_A | 58 | Nmr Structure Of Bpti Mutant G37a Length = 58 | 2e-04 | ||
| 1jv8_A | 58 | Nmr Structure Of Bpti Mutant G37a Length = 58 | 2e-04 | ||
| 1jc6_A | 65 | Solution Structure Of Bungarus Faciatus Ix, A Kunit | 2e-04 | ||
| 1jc6_A | 65 | Solution Structure Of Bungarus Faciatus Ix, A Kunit | 3e-04 | ||
| 1bun_B | 61 | Structure Of Beta2-Bungarotoxin: Potassium Channel | 2e-04 | ||
| 1bun_B | 61 | Structure Of Beta2-Bungarotoxin: Potassium Channel | 2e-04 | ||
| 9pti_A | 58 | Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized | 2e-04 | ||
| 9pti_A | 58 | Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized | 2e-04 | ||
| 1bpt_A | 58 | Crevice-Forming Mutants Of Bpti: Crystal Structures | 2e-04 | ||
| 1bpt_A | 58 | Crevice-Forming Mutants Of Bpti: Crystal Structures | 3e-04 | ||
| 1nag_A | 58 | Crevice-forming Mutants In The Rigid Core Of Bovine | 3e-04 | ||
| 1nag_A | 58 | Crevice-forming Mutants In The Rigid Core Of Bovine | 3e-04 | ||
| 2fi4_I | 58 | Crystal Structure Of A Bpti Variant (Cys14->ser) In | 5e-04 | ||
| 2fi4_I | 58 | Crystal Structure Of A Bpti Variant (Cys14->ser) In | 6e-04 | ||
| 2fi5_I | 58 | Crystal Structure Of A Bpti Variant (Cys38->ser) In | 5e-04 | ||
| 2fi5_I | 58 | Crystal Structure Of A Bpti Variant (Cys38->ser) In | 6e-04 | ||
| 1fan_A | 58 | Crevice-Forming Mutants In The Rigid Core Of Bovine | 6e-04 | ||
| 1fan_A | 58 | Crevice-Forming Mutants In The Rigid Core Of Bovine | 7e-04 |
| >pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 | Back alignment and structure |
|
| >pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 | Back alignment and structure |
| >pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 | Back alignment and structure |
| >pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 | Back alignment and structure |
| >pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 | Back alignment and structure |
| >pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 | Back alignment and structure |
| >pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 | Back alignment and structure |
| >pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 | Back alignment and structure |
| >pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 | Back alignment and structure |
| >pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 | Back alignment and structure |
| >pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 | Back alignment and structure |
| >pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 | Back alignment and structure |
| >pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 | Back alignment and structure |
| >pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 | Back alignment and structure |
| >pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 | Back alignment and structure |
| >pdb|1DTK|A Chain A, The Nmr Solution Structure Of Dendrotoxin K From The Venom Of Dendroaspis Polylepis Polylepis Length = 57 | Back alignment and structure |
| >pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 | Back alignment and structure |
| >pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 | Back alignment and structure |
| >pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 | Back alignment and structure |
| >pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 | Back alignment and structure |
| >pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 | Back alignment and structure |
| >pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 | Back alignment and structure |
| >pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 | Back alignment and structure |
| >pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 | Back alignment and structure |
| >pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 | Back alignment and structure |
| >pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 | Back alignment and structure |
| >pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 | Back alignment and structure |
| >pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 | Back alignment and structure |
| >pdb|1BTI|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|1BTI|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 | Back alignment and structure |
| >pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 | Back alignment and structure |
| >pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 | Back alignment and structure |
| >pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 | Back alignment and structure |
| >pdb|1DEM|A Chain A, Proteinase Inhibitor Homologues As Potassium Channel Blockers Length = 60 | Back alignment and structure |
| >pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 | Back alignment and structure |
| >pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 | Back alignment and structure |
| >pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 | Back alignment and structure |
| >pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 | Back alignment and structure |
| >pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 | Back alignment and structure |
| >pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 | Back alignment and structure |
| >pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 | Back alignment and structure |
| >pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 | Back alignment and structure |
| >pdb|3BTH|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTH|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTD|I Chain I, The Crystal Structures Of The Complexes Between The Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTD|I Chain I, The Crystal Structures Of The Complexes Between The Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|1FAK|I Chain I, Human Tissue Factor Complexed With Coagulation Factor Viia Inhibited With A Bpti-Mutant Length = 55 | Back alignment and structure |
| >pdb|1FAK|I Chain I, Human Tissue Factor Complexed With Coagulation Factor Viia Inhibited With A Bpti-Mutant Length = 55 | Back alignment and structure |
| >pdb|1QLQ|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant With Altered Binding Loop Sequence Length = 58 | Back alignment and structure |
| >pdb|1QLQ|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant With Altered Binding Loop Sequence Length = 58 | Back alignment and structure |
| >pdb|3BTT|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTT|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|1Y62|A Chain A, A 2.4 Crystal Structure Of Conkunitzin-S1, A Novel Kunitz- Fold Cone Snail Neurotoxin. Length = 60 | Back alignment and structure |
| >pdb|1DTX|A Chain A, Crystal Structure Of Alpha-Dendrotoxin From The Green Mamba Venom And Its Comparison With The Structure Of Bovine Pancreatic Trypsin Inhibitor Length = 59 | Back alignment and structure |
| >pdb|1CO7|I Chain I, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 99 | Back alignment and structure |
| >pdb|1CO7|I Chain I, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 99 | Back alignment and structure |
| >pdb|1T8L|B Chain B, Crystal Structure Of The P1 Met Bpti Mutant- Bovine Chymotrypsin Complex Length = 59 | Back alignment and structure |
| >pdb|1T8L|B Chain B, Crystal Structure Of The P1 Met Bpti Mutant- Bovine Chymotrypsin Complex Length = 59 | Back alignment and structure |
| >pdb|3BTQ|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTQ|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTM|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTM|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTG|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTG|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTE|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta-Trypsin And Ten P1 Variants Of Bpti. Length = 58 | Back alignment and structure |
| >pdb|3BTE|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta-Trypsin And Ten P1 Variants Of Bpti. Length = 58 | Back alignment and structure |
| >pdb|3P95|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17D) Length = 58 | Back alignment and structure |
| >pdb|3P95|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17D) Length = 58 | Back alignment and structure |
| >pdb|1P2K|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 | Back alignment and structure |
| >pdb|1P2K|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 | Back alignment and structure |
| >pdb|1P2J|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 | Back alignment and structure |
| >pdb|1P2J|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 | Back alignment and structure |
| >pdb|3BTF|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti. Length = 58 | Back alignment and structure |
| >pdb|3BTF|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti. Length = 58 | Back alignment and structure |
| >pdb|1UUB|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor Mutant, 3-58 Bpti (K15r, R17a, R42s) Length = 56 | Back alignment and structure |
| >pdb|1UUB|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor Mutant, 3-58 Bpti (K15r, R17a, R42s) Length = 56 | Back alignment and structure |
| >pdb|1LD5|A Chain A, Structure Of Bpti Mutant A16v Length = 58 | Back alignment and structure |
| >pdb|1LD5|A Chain A, Structure Of Bpti Mutant A16v Length = 58 | Back alignment and structure |
| >pdb|1YKT|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 | Back alignment and structure |
| >pdb|1YKT|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 | Back alignment and structure |
| >pdb|1EJM|B Chain B, Crystal Structure Of The Bpti Ala16leu Mutant In Complex With Bovine Trypsin Length = 58 | Back alignment and structure |
| >pdb|1EJM|B Chain B, Crystal Structure Of The Bpti Ala16leu Mutant In Complex With Bovine Trypsin Length = 58 | Back alignment and structure |
| >pdb|4TPI|I Chain I, The Refined 2.2-angstroms (0.22-nm) X-ray Crystal Structure Of The Ternary Complex Formed By Bovine Trypsinogen, Valine-valine And The Arg15 Analogue Of Bovine Pancreatic Trypsin Inhibitor Length = 58 | Back alignment and structure |
| >pdb|4TPI|I Chain I, The Refined 2.2-angstroms (0.22-nm) X-ray Crystal Structure Of The Ternary Complex Formed By Bovine Trypsinogen, Valine-valine And The Arg15 Analogue Of Bovine Pancreatic Trypsin Inhibitor Length = 58 | Back alignment and structure |
| >pdb|1TPA|I Chain I, The Geometry Of The Reactive Site And Of The Peptide Groups In Trypsin, Trypsinogen And Its Complexes With Inhibitors Length = 58 | Back alignment and structure |
| >pdb|1TPA|I Chain I, The Geometry Of The Reactive Site And Of The Peptide Groups In Trypsin, Trypsinogen And Its Complexes With Inhibitors Length = 58 | Back alignment and structure |
| >pdb|1PIT|A Chain A, Determination Of A High-Quality Nuclear Magnetic Resonance Solution Structure Of The Bovine Pancreatic Trypsin Inhibitor And Comparison With Three Crystal Structures Length = 58 | Back alignment and structure |
| >pdb|1PIT|A Chain A, Determination Of A High-Quality Nuclear Magnetic Resonance Solution Structure Of The Bovine Pancreatic Trypsin Inhibitor And Comparison With Three Crystal Structures Length = 58 | Back alignment and structure |
| >pdb|3P92|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17G) Length = 58 | Back alignment and structure |
| >pdb|3P92|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17G) Length = 58 | Back alignment and structure |
| >pdb|1UUA|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor, 3-58 Bpti Length = 56 | Back alignment and structure |
| >pdb|1UUA|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor, 3-58 Bpti Length = 56 | Back alignment and structure |
| >pdb|3BTW|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTW|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3TGI|I Chain I, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 65 | Back alignment and structure |
| >pdb|3TGI|I Chain I, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 65 | Back alignment and structure |
| >pdb|1JV8|A Chain A, Nmr Structure Of Bpti Mutant G37a Length = 58 | Back alignment and structure |
| >pdb|1JV8|A Chain A, Nmr Structure Of Bpti Mutant G37a Length = 58 | Back alignment and structure |
| >pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 | Back alignment and structure |
| >pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 | Back alignment and structure |
| >pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 | Back alignment and structure |
| >pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 | Back alignment and structure |
| >pdb|9PTI|A Chain A, Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized) Length = 58 | Back alignment and structure |
| >pdb|9PTI|A Chain A, Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized) Length = 58 | Back alignment and structure |
| >pdb|1BPT|A Chain A, Crevice-Forming Mutants Of Bpti: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|1BPT|A Chain A, Crevice-Forming Mutants Of Bpti: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|1NAG|A Chain A, Crevice-forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|1NAG|A Chain A, Crevice-forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|2FI4|I Chain I, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|2FI4|I Chain I, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|2FI5|I Chain I, Crystal Structure Of A Bpti Variant (Cys38->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|2FI5|I Chain I, Crystal Structure Of A Bpti Variant (Cys38->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|1FAN|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|1FAN|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 366 | |||
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 7e-35 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 1e-33 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 2e-16 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 1e-14 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 3e-32 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 7e-31 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 1e-14 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 8e-21 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 7e-19 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 4e-17 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 1e-19 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 2e-18 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 6e-16 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 2e-19 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 6e-18 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 2e-17 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 2e-19 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 6e-19 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 1e-16 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 4e-19 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 3e-18 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 6e-17 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 6e-19 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 1e-18 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 2e-16 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 6e-19 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 3e-18 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 3e-16 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 7e-19 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 2e-18 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 2e-16 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 1e-18 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 1e-18 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 2e-16 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 1e-18 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 2e-18 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 2e-16 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} Length = 6 | 2e-18 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} Length = 6 | 5e-18 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} Length = 6 | 4e-16 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 3e-18 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 6e-18 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 3e-16 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 3e-18 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 7e-18 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 4e-16 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 4e-18 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 7e-18 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 2e-15 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 4e-18 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 1e-17 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 5e-17 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 4e-18 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 7e-18 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 1e-15 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 4e-18 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 9e-18 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 1e-16 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 6e-18 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 9e-18 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 6e-17 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 8e-18 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 1e-17 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 9e-16 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 1e-17 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 5e-17 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 6e-16 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 1e-17 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 4e-17 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 6e-17 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 2e-16 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 2e-16 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 6e-15 |
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
Score = 123 bits (311), Expect = 7e-35
Identities = 43/124 (34%), Positives = 58/124 (46%), Gaps = 8/124 (6%)
Query: 184 KTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGR 243
+ C P + G C PR+ FN E C F YGGC GN NNF++ C + C P R
Sbjct: 2 RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPER 61
Query: 244 TRV--------ICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECL 295
C D G C+ +R++Y+ + C F+Y GCGGN N + + EEC
Sbjct: 62 VNDFESADFKTGCEPAADSGSCAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECE 121
Query: 296 HYCS 299
C
Sbjct: 122 LVCK 125
|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 99.97 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 99.97 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 99.97 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 99.97 | |
| 1toc_R | 120 | Ornithodorin; vitamin K, zymogen, gamma-carboxyglu | 99.88 | |
| 1toc_R | 120 | Ornithodorin; vitamin K, zymogen, gamma-carboxyglu | 99.86 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.71 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 99.71 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 99.7 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 99.7 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 99.7 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 99.7 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 99.69 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 99.69 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 99.69 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 99.69 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.69 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 99.69 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 99.69 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 99.69 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 99.69 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 99.68 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 99.68 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 99.68 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} | 99.67 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 99.67 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 99.66 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.65 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 99.65 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 99.64 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 99.64 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 99.64 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 99.64 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 99.63 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.63 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 99.63 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 99.63 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 99.63 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 99.63 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 99.62 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 99.62 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} | 99.61 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 99.61 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 99.61 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 99.61 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 99.61 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 99.6 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 99.6 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 99.58 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 99.52 | |
| 2uuy_B | 52 | Tryptase inhibitor; calcium, zymogen, protease, hy | 99.52 | |
| 2uuy_B | 52 | Tryptase inhibitor; calcium, zymogen, protease, hy | 99.43 |
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} | Back alignment and structure |
|---|
Probab=99.97 E-value=3.5e-32 Score=232.78 Aligned_cols=113 Identities=42% Similarity=0.994 Sum_probs=108.1
Q ss_pred ccccccCCCCCCCCCCceeEEEcCCCCeEEEEEecCCCCCCCCccChhhhcccCCCCC-----------CCCCCCCccCC
Q psy10170 245 RVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPR-----------DPCEQPIERGD 313 (366)
Q Consensus 245 ~~~C~lp~~~G~C~~~~~rwyYD~~~~~C~~F~y~GC~GN~N~F~T~~eC~~~C~~~~-----------~~C~~p~~~G~ 313 (366)
..+|.||++.|+|.+.+.|||||+.+++|++|+|+||+||.|+|.|+++|+++|.... ++|.+|++.|+
T Consensus 3 ~~~C~~p~~~G~C~~~~~r~~yn~~t~~C~~F~y~GC~gN~N~F~t~~~C~~~C~~~~~~~~~~~~~~~~~C~~p~~~G~ 82 (127)
T 2ody_E 3 NGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADSGS 82 (127)
T ss_dssp BGGGGSCCCCCSSCCCEEEEEEETTTTEEEEEEECSSCCCSSCBSSHHHHHHHHSSCCCCCCCCCCCHHHHTSSCCCCCS
T ss_pred CCcccCCCCCccCcCceeeEEEECCCCeeeEeecCCcCCCccccCcHHHHHHhccccccccccccCCcCCcCCCcCCCCc
Confidence 4689999999999999999999999999999999999999999999999999999732 47999999999
Q ss_pred CCCCCCeeEEecCCCcceeeEecccCCCCCCcCChHHHHHhCCC
Q psy10170 314 CNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLH 357 (366)
Q Consensus 314 C~~~~~RwyYd~~~~~C~~F~Y~GC~GN~NnF~T~~eC~~~C~~ 357 (366)
|.+.+.|||||+++++|++|+|+||+||.|||.|+++|+++|.+
T Consensus 83 C~~~~~r~~yd~~~~~C~~F~Y~GC~GN~N~F~t~~eC~~~C~~ 126 (127)
T 2ody_E 83 CAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECELVCKN 126 (127)
T ss_dssp SCCCEEEEEEETTTTEEEEEEECSSCCCSCCBSSHHHHHHHHSC
T ss_pred ccCcceeEEECCCCCceeEEEECCcCCCCcCcCCHHHHHHHccC
Confidence 99999999999999999999999999999999999999999975
|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 | Back alignment and structure |
|---|
| >1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 | Back alignment and structure |
|---|
| >1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A | Back alignment and structure |
|---|
| >2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 366 | ||||
| d1zr0b1 | 63 | g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor | 1e-17 | |
| d1zr0b1 | 63 | g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor | 2e-16 | |
| d1zr0b1 | 63 | g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor | 3e-14 | |
| d1aapa_ | 56 | g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs | 9e-17 | |
| d1aapa_ | 56 | g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs | 2e-16 | |
| d1aapa_ | 56 | g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs | 2e-14 | |
| d1dtxa_ | 59 | g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr | 1e-16 | |
| d1dtxa_ | 59 | g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr | 4e-16 | |
| d1dtxa_ | 59 | g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr | 5e-14 | |
| d1ktha_ | 58 | g.8.1.1 (A:) Collagen type VI (domain C5 from alph | 2e-16 | |
| d1ktha_ | 58 | g.8.1.1 (A:) Collagen type VI (domain C5 from alph | 6e-16 | |
| d1ktha_ | 58 | g.8.1.1 (A:) Collagen type VI (domain C5 from alph | 6e-15 | |
| d1bf0a_ | 60 | g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend | 6e-16 | |
| d1bf0a_ | 60 | g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend | 1e-15 | |
| d1bf0a_ | 60 | g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend | 6e-14 | |
| d1dtka_ | 57 | g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp | 7e-16 | |
| d1dtka_ | 57 | g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp | 7e-16 | |
| d1dtka_ | 57 | g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp | 4e-14 | |
| d1bika2 | 56 | g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi | 8e-16 | |
| d1bika2 | 56 | g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi | 8e-16 | |
| d1bika2 | 56 | g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi | 4e-14 | |
| d1g6xa_ | 58 | g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C | 9e-16 | |
| d1g6xa_ | 58 | g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C | 9e-16 | |
| d1g6xa_ | 58 | g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C | 1e-13 | |
| d1tfxc_ | 58 | g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma | 1e-15 | |
| d1tfxc_ | 58 | g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma | 1e-15 | |
| d1tfxc_ | 58 | g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma | 2e-13 | |
| d1jc6a_ | 65 | g.8.1.1 (A:) Venom basic protease inhibitor IX (VI | 1e-15 | |
| d1jc6a_ | 65 | g.8.1.1 (A:) Venom basic protease inhibitor IX (VI | 2e-15 | |
| d1jc6a_ | 65 | g.8.1.1 (A:) Venom basic protease inhibitor IX (VI | 7e-14 | |
| d1irha_ | 61 | g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma | 1e-15 | |
| d1irha_ | 61 | g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma | 2e-15 | |
| d1irha_ | 61 | g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma | 1e-13 | |
| d1bunb_ | 61 | g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain | 2e-15 | |
| d1bunb_ | 61 | g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain | 2e-15 | |
| d1bunb_ | 61 | g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain | 1e-13 | |
| d1shpa_ | 55 | g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich | 3e-15 | |
| d1shpa_ | 55 | g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich | 3e-15 | |
| d1shpa_ | 55 | g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich | 5e-14 | |
| d1bika1 | 54 | g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit | 5e-15 | |
| d1bika1 | 54 | g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit | 5e-15 | |
| d1bika1 | 54 | g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit | 4e-13 |
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
class: Small proteins fold: BPTI-like superfamily: BPTI-like family: Small Kunitz-type inhibitors & BPTI-like toxins domain: Tissue factor pathway inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Score = 74.2 bits (182), Expect = 1e-17
Identities = 23/60 (38%), Positives = 34/60 (56%)
Query: 180 PDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL 239
P N + C P++ G C R+ +++ +SC QF YGGC+GN NNF + AC + C
Sbjct: 1 PTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACW 60
|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| d1aapa_ | 56 | Alzheimer's amyloid B-protein precursor, APPI {Hum | 99.74 | |
| d1ktha_ | 58 | Collagen type VI (domain C5 from alpha 3 chain) {H | 99.72 | |
| d1shpa_ | 55 | Trypsin inhibitor {Sea anemone (Stichodactyla heli | 99.72 | |
| d1dtka_ | 57 | Dendrotoxin K {Black mamba (Dendroaspis polylepis | 99.72 | |
| d1dtxa_ | 59 | alpha-Dendrotoxin {Green mamba (Dendroaspis angust | 99.72 | |
| d1bika1 | 54 | Bikunin from inter-alpha-inhibitor complex {Human | 99.71 | |
| d1bika2 | 56 | Bikunin from inter-alpha-inhibitor complex {Human | 99.71 | |
| d1g6xa_ | 58 | Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru | 99.7 | |
| d1zr0b1 | 63 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.7 | |
| d1irha_ | 61 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.69 | |
| d1bunb_ | 61 | beta2-bungarotoxin, neurotoxin chain {Many-banded | 99.69 | |
| d1tfxc_ | 58 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.69 | |
| d1aapa_ | 56 | Alzheimer's amyloid B-protein precursor, APPI {Hum | 99.68 | |
| d1jc6a_ | 65 | Venom basic protease inhibitor IX (VIIIb) {Banded | 99.68 | |
| d1dtxa_ | 59 | alpha-Dendrotoxin {Green mamba (Dendroaspis angust | 99.68 | |
| d1bf0a_ | 60 | Calcicludine (cac) {Green mamba (Dendroaspis angus | 99.67 | |
| d1dtka_ | 57 | Dendrotoxin K {Black mamba (Dendroaspis polylepis | 99.67 | |
| d1shpa_ | 55 | Trypsin inhibitor {Sea anemone (Stichodactyla heli | 99.66 | |
| d1bika2 | 56 | Bikunin from inter-alpha-inhibitor complex {Human | 99.66 | |
| d1ktha_ | 58 | Collagen type VI (domain C5 from alpha 3 chain) {H | 99.66 | |
| d1bika1 | 54 | Bikunin from inter-alpha-inhibitor complex {Human | 99.65 | |
| d1zr0b1 | 63 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.65 | |
| d1tfxc_ | 58 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.64 | |
| d1g6xa_ | 58 | Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru | 99.64 | |
| d1irha_ | 61 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.64 | |
| d1bunb_ | 61 | beta2-bungarotoxin, neurotoxin chain {Many-banded | 99.62 | |
| d1bf0a_ | 60 | Calcicludine (cac) {Green mamba (Dendroaspis angus | 99.62 | |
| d1jc6a_ | 65 | Venom basic protease inhibitor IX (VIIIb) {Banded | 99.61 | |
| d1tocr2 | 63 | Ornithodorin {Soft tick (Ornithodoros moubata) [Ta | 95.6 | |
| d1tocr2 | 63 | Ornithodorin {Soft tick (Ornithodoros moubata) [Ta | 94.07 |
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: BPTI-like superfamily: BPTI-like family: Small Kunitz-type inhibitors & BPTI-like toxins domain: Alzheimer's amyloid B-protein precursor, APPI species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74 E-value=3.7e-19 Score=129.47 Aligned_cols=56 Identities=39% Similarity=0.957 Sum_probs=53.8
Q ss_pred CCCCCCCCCccCCCCCCCCeeEEecCCCcceeeEecccCCCCCCcCChHHHHHhCC
Q psy10170 301 PRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL 356 (366)
Q Consensus 301 ~~~~C~~p~~~G~C~~~~~RwyYd~~~~~C~~F~Y~GC~GN~NnF~T~~eC~~~C~ 356 (366)
++++|.+|++.|+|.+.+.|||||+++++|++|+|+||+||.|||.|+++|+++|.
T Consensus 1 v~d~C~~p~~~G~C~~~~~rwyyd~~~~~C~~F~y~GCgGN~NnF~t~~~C~~~CG 56 (56)
T d1aapa_ 1 VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG 56 (56)
T ss_dssp CGGGGGBCCCCCSSSCCEEEEEEETTTTEEEEEEECSSSCCSCCBSSHHHHHHHHC
T ss_pred CCcccCCCCCCcCCCCceeEEEEECCCCcEeeeEcCCccCCccCcCCHHHHHHhhC
Confidence 46899999999999999999999999999999999999999999999999999984
|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} | Back information, alignment and structure |
|---|
| >d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|
| >d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|