Psyllid ID: psy10170


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MSDGTQSSLSTSDETSTITPGSSTIDSSTPGKEPAPTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVGPRQQDATASTTPTPDKSKPSEPPKEDCAATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRGVGT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccHHHHHHHccccccccccccccccccccccccccEEEEcccccEEccccccccccccccccHHHHcccccccccccccccccccccccccEEEEEcccccccEEEcccccccccccccHHHHHHHcccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHccccccccccccccccccccHcccccccccccccccEEEEccccccEEEEEEccccccccccccHHHHHHHHcccccccccccccccccccccccEEEEEccccccEEEEEEccccccccccccHHHHHHHccccccccccccccccccccEEEEEEEcccccEEEEEEccccccccccccHHHHHHHHccccccccccc
msdgtqsslstsdetstitpgsstidsstpgkepaptcrpnlegcgcvytpygccpdnqtvargpdnagcgcqytehkccpdkytpatgpnyegcpcytyqfgccpdgvtravgprqqdatasttptpdkskpseppkedcaatqfgccpdgtaatkktledcagidlkncsvsawgccpdsnktdpceqpiergdcngnyprwafnkeaKSCEQfyyggckgngnnfqsesaclekclhpgrtrvicrlpgdggmcseyhkryyyderrqtcvpfiytgcggnlnrfttseeclhycspprdpceqpiergdcngnyprwafnkeaKSCEQfyyggckgngnnfqsesaclekclhpgrtrgvgt
msdgtqsslstsdetstitpgsstidsstpgkePAPTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVGPRQqdatasttptpdkskpsepPKEDCAATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVicrlpgdggmcSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESAclekclhpgrtrgvgt
MSDGTQSSLSTSDETSTITPGSSTIDSSTPGKEPAPTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVGPRQQdatasttptpdkskpseppkedCAATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRGVGT
****************************************NLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRA*****************************AATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSN****C**PIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKC***********
*********************************************GCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVGPRQQDATASTTPT*************CAATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPG*******
*************************************CRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVG***************************AATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHP********
***************S**TPGSSTIDSSTPGKEPAPTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVGPRQQDATASTTPTPDKSKPSEPPKEDCAATQFGCCPDGTAATKKTLEDCAGIDLKNC***AWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHP********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDGTQSSLSTSDETSTITPGSSTIDSSTPGKEPAPTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYTYQFGCCPDGVTRAVGPRQQDATASTTPTPDKSKPSEPPKEDCAATQFGCCPDGTAATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRGVGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query366 2.2.26 [Sep-21-2011]
Q868Z9 2898 Papilin OS=Drosophila mel no N/A 0.833 0.105 0.417 5e-62
O76840 2167 Papilin OS=Caenorhabditis yes N/A 0.693 0.117 0.394 7e-37
P84875165 Carboxypeptidase inhibito N/A N/A 0.437 0.969 0.394 9e-30
Q7YRQ8234 Tissue factor pathway inh yes N/A 0.483 0.756 0.374 4e-29
P48307235 Tissue factor pathway inh yes N/A 0.469 0.731 0.344 5e-23
P19761300 Tissue factor pathway inh yes N/A 0.459 0.56 0.331 8e-22
O35536230 Tissue factor pathway inh yes N/A 0.491 0.782 0.324 2e-21
Q9EPX2 1280 Papilin OS=Mus musculus G no N/A 0.5 0.142 0.328 4e-21
P10646304 Tissue factor pathway inh no N/A 0.459 0.552 0.317 1e-20
Q28864304 Tissue factor pathway inh no N/A 0.439 0.529 0.323 5e-20
>sp|Q868Z9|PPN_DROME Papilin OS=Drosophila melanogaster GN=Ppn PE=1 SV=2 Back     alignment and function desciption
 Score =  238 bits (607), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 140/335 (41%), Positives = 182/335 (54%), Gaps = 30/335 (8%)

Query: 40   PNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYT 99
            PN EGC C YTPYGCCPDN++ A G +  GC C+ T++ CCPDK T A GP +EGCPC T
Sbjct: 1471 PNNEGCECHYTPYGCCPDNKSAATGYNQEGCACETTQYGCCPDKITAAKGPKHEGCPCET 1530

Query: 100  YQFGCCPDGVTRAVGPRQQDATASTTPTP---DKSKPSEPPKED---CAATQFGCCPDGT 153
             QFGCCPDG+T A GP       + T      D+  P++ P  D   C  ++FGCCPDG 
Sbjct: 1531 TQFGCCPDGLTFAKGPHHHGCHCTQTEFKCCDDEKTPAKGPNGDGCTCVESKFGCCPDG- 1589

Query: 154  AATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDP----CEQPIERGDCNGNYPRWAFNKE 209
              TK T E   G +               N  +P    C  P E G CN    ++ F+  
Sbjct: 1590 -VTKATDEKFGGCE---------------NVQEPPQKACGLPKETGTCNNYSVKYYFDTS 1633

Query: 210  AKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKRYYYDER 269
               C +F+YGGC GN N F+SE+ C + C      + +C LP   G C+ + K++Y+D  
Sbjct: 1634 YGGCARFWYGGCDGNDNRFESEAECKDTC-QDYTGKHVCLLPKSAGPCTGFTKKWYFDVD 1692

Query: 270  RQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPRD--PCEQPIERGDCNGNYPRWAFNKEA 327
            R  C  F Y GC G  NRF + E+C   C+   +   CEQP+E G C GN+ RW ++ E 
Sbjct: 1693 RNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNET 1752

Query: 328  KSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTR 362
              C  F YGGCKGN NN+ +E AC   C  PG  +
Sbjct: 1753 DICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLK 1787




Essential extracellular matrix (ECM) protein that influences cell rearrangements. May act by modulating metalloproteinases action during organogenesis. Able to non-competitively inhibit procollagen N-proteinase, an ADAMTS metalloproteinase.
Drosophila melanogaster (taxid: 7227)
>sp|O76840|PPN1_CAEEL Papilin OS=Caenorhabditis elegans GN=mig-6 PE=1 SV=1 Back     alignment and function description
>sp|P84875|PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica PE=1 SV=1 Back     alignment and function description
>sp|Q7YRQ8|TFPI2_BOVIN Tissue factor pathway inhibitor 2 OS=Bos taurus GN=TFPI2 PE=2 SV=1 Back     alignment and function description
>sp|P48307|TFPI2_HUMAN Tissue factor pathway inhibitor 2 OS=Homo sapiens GN=TFPI2 PE=1 SV=1 Back     alignment and function description
>sp|P19761|TFPI1_RABIT Tissue factor pathway inhibitor OS=Oryctolagus cuniculus GN=TFPI PE=2 SV=2 Back     alignment and function description
>sp|O35536|TFPI2_MOUSE Tissue factor pathway inhibitor 2 OS=Mus musculus GN=Tfpi2 PE=2 SV=1 Back     alignment and function description
>sp|Q9EPX2|PPN_MOUSE Papilin OS=Mus musculus GN=Papln PE=2 SV=2 Back     alignment and function description
>sp|P10646|TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens GN=TFPI PE=1 SV=1 Back     alignment and function description
>sp|Q28864|TFPI1_MACMU Tissue factor pathway inhibitor OS=Macaca mulatta GN=TFPI PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
328724570 2494 PREDICTED: papilin-like isoform 2 [Acyrt 0.852 0.125 0.452 7e-81
328724572 2553 PREDICTED: papilin-like isoform 1 [Acyrt 0.841 0.120 0.454 3e-80
307206898 2983 Papilin [Harpegnathos saltator] 0.844 0.103 0.483 4e-78
242022723 2838 papilin, putative [Pediculus humanus cor 0.849 0.109 0.477 5e-78
383852694 2894 PREDICTED: papilin-like [Megachile rotun 0.844 0.106 0.480 8e-77
270010741 2771 hypothetical protein TcasGA2_TC010195 [T 0.838 0.110 0.480 8e-76
350422357 2962 PREDICTED: LOW QUALITY PROTEIN: papilin- 0.849 0.104 0.468 9e-76
340713638 3067 PREDICTED: papilin-like [Bombus terrestr 0.844 0.100 0.468 3e-75
6164595 3198 lacunin [Manduca sexta] 0.816 0.093 0.449 7e-75
380025477 2813 PREDICTED: papilin-like [Apis florea] 0.844 0.109 0.471 1e-74
>gi|328724570|ref|XP_003248188.1| PREDICTED: papilin-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  306 bits (785), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 210/345 (60%), Gaps = 33/345 (9%)

Query: 35   APTCRPNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEG 94
             P   PNL+GCGC+YTP+GCCPDN T ARGP+N+GC CQYTEHKCCPD +TPA+GP Y+G
Sbjct: 1332 VPANGPNLQGCGCIYTPFGCCPDNTTTARGPNNSGCSCQYTEHKCCPDNFTPASGPQYQG 1391

Query: 95   CPCYTYQFGCCPDGVTRAVGPRQQD----------ATASTTPTPDKSKPSEPPKEDCAAT 144
            C C+TYQFGCCPDG+T+A+GP  Q            +   TP PD+SK        C A+
Sbjct: 1392 CACHTYQFGCCPDGITKAIGPNSQGCGCEYTQYGCCSDKNTPAPDESKNCS-----CEAS 1446

Query: 145  QFGCCPDGTAATK-KTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPR 203
            ++GCC DG   +K +  E C    +                 D C++P +RG C+    +
Sbjct: 1447 KYGCCLDGITESKGENFEGCQSKPIL--------------PGDRCKEPKDRGSCSDFTVK 1492

Query: 204  WAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRVICRLPGDGGMCSEYHKR 263
            W F+ E   C +F+YGGC GN N F+++  C + C+ P   R +C LP   G C  Y+  
Sbjct: 1493 WFFDTEYGGCSRFWYGGCNGNNNRFKTQEECKDICVEPS-GRDVCYLPKSVGPCEGYYPT 1551

Query: 264  YYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPP--RDPCEQPIERGDCNGNYPRW 321
            +YYD+ R+ C  F+Y GC GN N+F T EEC H C  P   DPCEQP+  G C GN+ RW
Sbjct: 1552 WYYDQDRKQCAQFVYGGCLGNNNKFQTREECEHLCVIPDTLDPCEQPLTPGPCKGNFSRW 1611

Query: 322  AFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGRTRGVGT 366
             ++K  +SC QF YGGCKG+ NNF ++ +C  KC++P + + + T
Sbjct: 1612 YYDKSTRSCSQFNYGGCKGSQNNFLNKESCNHKCINPLKAQEIDT 1656




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328724572|ref|XP_001951980.2| PREDICTED: papilin-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307206898|gb|EFN84744.1| Papilin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242022723|ref|XP_002431788.1| papilin, putative [Pediculus humanus corporis] gi|212517113|gb|EEB19050.1| papilin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383852694|ref|XP_003701860.1| PREDICTED: papilin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|270010741|gb|EFA07189.1| hypothetical protein TcasGA2_TC010195 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350422357|ref|XP_003493139.1| PREDICTED: LOW QUALITY PROTEIN: papilin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713638|ref|XP_003395347.1| PREDICTED: papilin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|6164595|gb|AAF04457.1|AF078161_1 lacunin [Manduca sexta] Back     alignment and taxonomy information
>gi|380025477|ref|XP_003696500.1| PREDICTED: papilin-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
FB|FBgn0003137 2898 Ppn "Papilin" [Drosophila mela 0.833 0.105 0.419 5.1e-70
WB|WBGene00003242 2167 mig-6 [Caenorhabditis elegans 0.693 0.117 0.379 1.4e-53
WB|WBGene00012186 3129 mlt-11 [Caenorhabditis elegans 0.486 0.056 0.389 1.3e-36
ZFIN|ZDB-GENE-060503-38233 tfpi2 "tissue factor pathway i 0.459 0.721 0.391 3.1e-35
UNIPROTKB|Q7YRQ8234 TFPI2 "Tissue factor pathway i 0.483 0.756 0.374 3.6e-34
UNIPROTKB|F1SFC1232 LOC100520144 "Uncharacterized 0.475 0.75 0.375 5.8e-34
UNIPROTKB|E1BVF2239 TFPI2 "Uncharacterized protein 0.486 0.744 0.370 9.5e-34
UNIPROTKB|E2RBF0235 TFPI2 "Uncharacterized protein 0.483 0.753 0.357 2.3e-32
UNIPROTKB|B5ST96303 LOC100155068 "Uncharacterized 0.303 0.366 0.387 1.1e-31
ZFIN|ZDB-GENE-030711-1 292 tfpia "tissue factor pathway i 0.295 0.369 0.409 3.4e-22
FB|FBgn0003137 Ppn "Papilin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 705 (253.2 bits), Expect = 5.1e-70, Sum P(2) = 5.1e-70
 Identities = 138/329 (41%), Positives = 176/329 (53%)

Query:    40 PNLEGCGCVYTPYGCCPDNQTVARGPDNAGCGCQYTEHKCCPDKYTPATGPNYEGCPCYT 99
             PN EGC C YTPYGCCPDN++ A G +  GC C+ T++ CCPDK T A GP +EGCPC T
Sbjct:  1471 PNNEGCECHYTPYGCCPDNKSAATGYNQEGCACETTQYGCCPDKITAAKGPKHEGCPCET 1530

Query:   100 YQFGCCPDGVTRAVGPRQ------QXXXXXXXXXXXXXXXXXXXXXXCAATQFGCCPDGT 153
              QFGCCPDG+T A GP        Q                      C  ++FGCCPDG 
Sbjct:  1531 TQFGCCPDGLTFAKGPHHHGCHCTQTEFKCCDDEKTPAKGPNGDGCTCVESKFGCCPDGV 1590

Query:   154 AATKKTLEDCAGIDLKNCSVSAWGCCPDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSC 213
               TK T E   G +    +V      P       C  P E G CN    ++ F+     C
Sbjct:  1591 --TKATDEKFGGCE----NVQE----PPQKA---CGLPKETGTCNNYSVKYYFDTSYGGC 1637

Query:   214 EQFYYGGCKGNGNNFQSESACLEKCL-HPGRTRVICRLPGDGGMCSEYHKRYYYDERRQT 272
              +F+YGGC GN N F+SE+ C + C  + G+   +C LP   G C+ + K++Y+D  R  
Sbjct:  1638 ARFWYGGCDGNDNRFESEAECKDTCQDYTGKH--VCLLPKSAGPCTGFTKKWYFDVDRNR 1695

Query:   273 CVPFIYTGCGGNLNRFTTSEECLHYCSPPRD-P-CEQPIERGDCNGNYPRWAFNKEAKSC 330
             C  F Y GC G  NRF + E+C   C+   + P CEQP+E G C GN+ RW ++ E   C
Sbjct:  1696 CEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDNETDIC 1755

Query:   331 EQFYYGGCKGNGNNFQSESACLEKCLHPG 359
               F YGGCKGN NN+ +E AC   C  PG
Sbjct:  1756 RPFTYGGCKGNKNNYPTEHACNYNCRQPG 1784


GO:0005604 "basement membrane" evidence=IDA
GO:0005578 "proteinaceous extracellular matrix" evidence=NAS
GO:0030198 "extracellular matrix organization" evidence=IMP
GO:0005201 "extracellular matrix structural constituent" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA
WB|WBGene00003242 mig-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00012186 mlt-11 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-38 tfpi2 "tissue factor pathway inhibitor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YRQ8 TFPI2 "Tissue factor pathway inhibitor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFC1 LOC100520144 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVF2 TFPI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBF0 TFPI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B5ST96 LOC100155068 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030711-1 tfpia "tissue factor pathway inhibitor a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
cd0010954 cd00109, KU, BPTI/Kunitz family of serine protease 9e-17
cd0010954 cd00109, KU, BPTI/Kunitz family of serine protease 9e-17
smart0013153 smart00131, KU, BPTI/Kunitz family of serine prote 4e-16
smart0013153 smart00131, KU, BPTI/Kunitz family of serine prote 4e-16
cd0010954 cd00109, KU, BPTI/Kunitz family of serine protease 2e-15
pfam0001453 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t 2e-15
pfam0001453 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t 2e-15
smart0013153 smart00131, KU, BPTI/Kunitz family of serine prote 7e-15
pfam0001453 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t 3e-14
>gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
 Score = 73.1 bits (180), Expect = 9e-17
 Identities = 22/54 (40%), Positives = 28/54 (51%)

Query: 186 DPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL 239
           D C  P + G C    PR+ ++   K CE F YGGC GN NNF ++  C   C 
Sbjct: 1   DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG 54


BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. Length = 54

>gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
>gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
>gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain Back     alignment and domain information
>gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain Back     alignment and domain information
>gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
cd0010954 KU BPTI/Kunitz family of serine protease inhibitor 99.5
smart0013153 KU BPTI/Kunitz family of serine protease inhibitor 99.48
PF0001453 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi 99.45
cd0010954 KU BPTI/Kunitz family of serine protease inhibitor 99.43
smart0013153 KU BPTI/Kunitz family of serine protease inhibitor 99.4
PF0001453 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi 99.4
KOG4295|consensus295 99.33
KOG4295|consensus 295 99.3
KOG4597|consensus 560 98.6
KOG4597|consensus560 98.56
KOG3540|consensus 615 90.57
KOG3540|consensus 615 86.83
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
Probab=99.50  E-value=3.3e-14  Score=104.33  Aligned_cols=54  Identities=41%  Similarity=0.975  Sum_probs=51.8

Q ss_pred             CCCCCCCccCCCCCCCCeeEEecCCCcceeeEecccCCCCCCcCChHHHHHhCC
Q psy10170        303 DPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL  356 (366)
Q Consensus       303 ~~C~~p~~~G~C~~~~~RwyYd~~~~~C~~F~Y~GC~GN~NnF~T~~eC~~~C~  356 (366)
                      ++|.+|++.|.|...+.|||||+++++|++|.|+||.+|.|+|.|+++|+++|.
T Consensus         1 ~~C~~~~~~g~C~~~~~~~~yd~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~   54 (54)
T cd00109           1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG   54 (54)
T ss_pred             CcccCCCCCCCCCCCccEEEEeCCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence            479999999999999999999999999999999999999999999999999995



BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure.

>smart00131 KU BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus Back     alignment and domain information
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus Back     alignment and domain information
>KOG4295|consensus Back     alignment and domain information
>KOG4295|consensus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG3540|consensus Back     alignment and domain information
>KOG3540|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
1bik_A147 X-Ray Structure Of Bikunin From The Human Inter-Alp 4e-19
1bik_A147 X-Ray Structure Of Bikunin From The Human Inter-Alp 2e-16
2ody_E127 Thrombin-bound Boophilin Displays A Functional And 2e-18
2ody_E127 Thrombin-bound Boophilin Displays A Functional And 6e-06
2ddi_A70 Nmr Structure Of The Second Kunitz Domain Of Human 8e-09
2ddi_A70 Nmr Structure Of The Second Kunitz Domain Of Human 4e-08
1kth_A58 The Anisotropic Refinement Of Kunitz Type Domain C5 1e-08
1kth_A58 The Anisotropic Refinement Of Kunitz Type Domain C5 3e-05
2jot_A55 Nuclear Magnetic Resonance Studies On Huwentoxin-Xi 2e-08
2jot_A55 Nuclear Magnetic Resonance Studies On Huwentoxin-Xi 2e-08
1irh_A61 The Solution Structure Of The Third Kunitz Domain O 3e-07
1irh_A61 The Solution Structure Of The Third Kunitz Domain O 2e-04
1zr0_B63 Crystal Structure Of Kunitz Domain 1 Of Tissue Fact 3e-07
1zr0_B63 Crystal Structure Of Kunitz Domain 1 Of Tissue Fact 2e-06
1zr0_B63 Crystal Structure Of Kunitz Domain 1 Of Tissue Fact 4e-06
1dtk_A57 The Nmr Solution Structure Of Dendrotoxin K From Th 1e-06
3byb_A59 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 2e-06
3byb_A59 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 3e-06
3d65_I57 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 2e-06
3d65_I57 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 3e-06
1aap_A58 X-Ray Crystal Structure Of The Protease Inhibitor D 4e-06
1brc_I56 Relocating A Negative Charge In The Binding Pocket 4e-06
1yc0_I75 Short Form Hgfa With First Kunitz Domain From Hai-1 5e-06
1yc0_I75 Short Form Hgfa With First Kunitz Domain From Hai-1 5e-06
4dtg_K66 Hemostatic Effect Of A Monoclonal Antibody Mab 2021 1e-05
4dtg_K66 Hemostatic Effect Of A Monoclonal Antibody Mab 2021 1e-04
1tfx_C58 Complex Of The Second Kunitz Domain Of Tissue Facto 1e-05
1tfx_C58 Complex Of The Second Kunitz Domain Of Tissue Facto 1e-04
1bti_A58 Crevice-Forming Mutants In The Rigid Core Of Bovine 1e-05
1bti_A58 Crevice-Forming Mutants In The Rigid Core Of Bovine 2e-05
3l3t_E57 Human Mesotrypsin Complexed With Amyloid Precursor 2e-05
3l3t_E57 Human Mesotrypsin Complexed With Amyloid Precursor 2e-05
1zjd_B57 Crystal Structure Of The Catalytic Domain Of Coagul 2e-05
1zjd_B57 Crystal Structure Of The Catalytic Domain Of Coagul 2e-05
1dem_A60 Proteinase Inhibitor Homologues As Potassium Channe 2e-05
1ca0_D54 Bovine Chymotrypsin Complexed To Appi Length = 54 2e-05
1ca0_D54 Bovine Chymotrypsin Complexed To Appi Length = 54 2e-05
1bf0_A60 Calcicludine (Cac) From Green Mamba Dendroaspis Ang 2e-05
1bf0_A60 Calcicludine (Cac) From Green Mamba Dendroaspis Ang 5e-05
1adz_A71 The Solution Structure Of The Second Kunitz Domain 2e-05
1adz_A71 The Solution Structure Of The Second Kunitz Domain 2e-04
3l33_E52 Human Mesotrypsin Complexed With Amyloid Precursor 2e-05
3l33_E52 Human Mesotrypsin Complexed With Amyloid Precursor 2e-05
3bth_I58 The Crystal Structures Of The Complexes Between Bov 2e-05
3bth_I58 The Crystal Structures Of The Complexes Between Bov 3e-05
3btd_I58 The Crystal Structures Of The Complexes Between The 2e-05
3btd_I58 The Crystal Structures Of The Complexes Between The 3e-05
1fak_I55 Human Tissue Factor Complexed With Coagulation Fact 3e-05
1fak_I55 Human Tissue Factor Complexed With Coagulation Fact 3e-05
1qlq_A58 Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant W 3e-05
1qlq_A58 Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant W 3e-05
3btt_I58 The Crystal Structures Of The Complexes Between Bov 3e-05
3btt_I58 The Crystal Structures Of The Complexes Between Bov 3e-05
1y62_A60 A 2.4 Crystal Structure Of Conkunitzin-S1, A Novel 3e-05
1dtx_A59 Crystal Structure Of Alpha-Dendrotoxin From The Gre 3e-05
1co7_I99 R117h Mutant Rat Anionic Trypsin Complexed With Bov 3e-05
1co7_I99 R117h Mutant Rat Anionic Trypsin Complexed With Bov 4e-05
1t8l_B59 Crystal Structure Of The P1 Met Bpti Mutant- Bovine 3e-05
1t8l_B59 Crystal Structure Of The P1 Met Bpti Mutant- Bovine 4e-05
3btq_I58 The Crystal Structures Of The Complexes Between Bov 4e-05
3btq_I58 The Crystal Structures Of The Complexes Between Bov 4e-05
3btm_I58 The Crystal Structures Of The Complexes Between Bov 4e-05
3btm_I58 The Crystal Structures Of The Complexes Between Bov 4e-05
3btg_I58 The Crystal Structures Of The Complexes Between Bov 4e-05
3btg_I58 The Crystal Structures Of The Complexes Between Bov 5e-05
3bte_I58 The Crystal Structures Of The Complexes Between Bov 4e-05
3bte_I58 The Crystal Structures Of The Complexes Between Bov 5e-05
3p95_E58 Human Mesotrypsin Complexed With Bovine Pancreatic 4e-05
3p95_E58 Human Mesotrypsin Complexed With Bovine Pancreatic 5e-05
1p2k_I58 Structural Consequences Of Accommodation Of Four No 4e-05
1p2k_I58 Structural Consequences Of Accommodation Of Four No 5e-05
1p2j_I58 Structural Consequences Of Accommodation Of Four No 5e-05
1p2j_I58 Structural Consequences Of Accommodation Of Four No 5e-05
3btf_I58 The Crystal Structures Of The Complexes Between Bov 5e-05
3btf_I58 The Crystal Structures Of The Complexes Between Bov 6e-05
1uub_A56 Solution Structure Of A Truncated Bovine Pancreatic 6e-05
1uub_A56 Solution Structure Of A Truncated Bovine Pancreatic 6e-05
1ld5_A58 Structure Of Bpti Mutant A16v Length = 58 6e-05
1ld5_A58 Structure Of Bpti Mutant A16v Length = 58 6e-05
1ykt_B56 TrypsinBPTI COMPLEX MUTANT Length = 56 6e-05
1ykt_B56 TrypsinBPTI COMPLEX MUTANT Length = 56 6e-05
1ejm_B58 Crystal Structure Of The Bpti Ala16leu Mutant In Co 6e-05
1ejm_B58 Crystal Structure Of The Bpti Ala16leu Mutant In Co 7e-05
4tpi_I58 The Refined 2.2-angstroms (0.22-nm) X-ray Crystal S 6e-05
4tpi_I58 The Refined 2.2-angstroms (0.22-nm) X-ray Crystal S 7e-05
1tpa_I58 The Geometry Of The Reactive Site And Of The Peptid 7e-05
1tpa_I58 The Geometry Of The Reactive Site And Of The Peptid 7e-05
1pit_A58 Determination Of A High-Quality Nuclear Magnetic Re 7e-05
1pit_A58 Determination Of A High-Quality Nuclear Magnetic Re 7e-05
3p92_E58 Human Mesotrypsin Complexed With Bovine Pancreatic 7e-05
3p92_E58 Human Mesotrypsin Complexed With Bovine Pancreatic 8e-05
1uua_A56 Solution Structure Of A Truncated Bovine Pancreatic 7e-05
1uua_A56 Solution Structure Of A Truncated Bovine Pancreatic 7e-05
3btw_I58 The Crystal Structures Of The Complexes Between Bov 8e-05
3btw_I58 The Crystal Structures Of The Complexes Between Bov 1e-04
3tgi_I65 Wild-Type Rat Anionic Trypsin Complexed With Bovine 9e-05
3tgi_I65 Wild-Type Rat Anionic Trypsin Complexed With Bovine 1e-04
1jv8_A58 Nmr Structure Of Bpti Mutant G37a Length = 58 2e-04
1jv8_A58 Nmr Structure Of Bpti Mutant G37a Length = 58 2e-04
1jc6_A65 Solution Structure Of Bungarus Faciatus Ix, A Kunit 2e-04
1jc6_A65 Solution Structure Of Bungarus Faciatus Ix, A Kunit 3e-04
1bun_B61 Structure Of Beta2-Bungarotoxin: Potassium Channel 2e-04
1bun_B61 Structure Of Beta2-Bungarotoxin: Potassium Channel 2e-04
9pti_A58 Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized 2e-04
9pti_A58 Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized 2e-04
1bpt_A58 Crevice-Forming Mutants Of Bpti: Crystal Structures 2e-04
1bpt_A58 Crevice-Forming Mutants Of Bpti: Crystal Structures 3e-04
1nag_A58 Crevice-forming Mutants In The Rigid Core Of Bovine 3e-04
1nag_A58 Crevice-forming Mutants In The Rigid Core Of Bovine 3e-04
2fi4_I58 Crystal Structure Of A Bpti Variant (Cys14->ser) In 5e-04
2fi4_I58 Crystal Structure Of A Bpti Variant (Cys14->ser) In 6e-04
2fi5_I58 Crystal Structure Of A Bpti Variant (Cys38->ser) In 5e-04
2fi5_I58 Crystal Structure Of A Bpti Variant (Cys38->ser) In 6e-04
1fan_A58 Crevice-Forming Mutants In The Rigid Core Of Bovine 6e-04
1fan_A58 Crevice-Forming Mutants In The Rigid Core Of Bovine 7e-04
>pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 Back     alignment and structure

Iteration: 1

Score = 92.4 bits (228), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 4/128 (3%) Query: 182 SNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHP 241 + K D C+ G C G R+ +N + +CE F YGGC GNGNNF +E CL+ C Sbjct: 20 TKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTC--- 76 Query: 242 GRTRVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPP 301 RT C LP G C + + + +D + CV F Y GC GN N+F + +EC YC P Sbjct: 77 -RTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVP 135 Query: 302 RDPCEQPI 309 D E+ + Sbjct: 136 GDGDEELL 143
>pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 Back     alignment and structure
>pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 Back     alignment and structure
>pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 Back     alignment and structure
>pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 Back     alignment and structure
>pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 Back     alignment and structure
>pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 Back     alignment and structure
>pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 Back     alignment and structure
>pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 Back     alignment and structure
>pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 Back     alignment and structure
>pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 Back     alignment and structure
>pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 Back     alignment and structure
>pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 Back     alignment and structure
>pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 Back     alignment and structure
>pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 Back     alignment and structure
>pdb|1DTK|A Chain A, The Nmr Solution Structure Of Dendrotoxin K From The Venom Of Dendroaspis Polylepis Polylepis Length = 57 Back     alignment and structure
>pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 Back     alignment and structure
>pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 Back     alignment and structure
>pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 Back     alignment and structure
>pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 Back     alignment and structure
>pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 Back     alignment and structure
>pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 Back     alignment and structure
>pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 Back     alignment and structure
>pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 Back     alignment and structure
>pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 Back     alignment and structure
>pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 Back     alignment and structure
>pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 Back     alignment and structure
>pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 Back     alignment and structure
>pdb|1BTI|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|1BTI|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 Back     alignment and structure
>pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 Back     alignment and structure
>pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 Back     alignment and structure
>pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 Back     alignment and structure
>pdb|1DEM|A Chain A, Proteinase Inhibitor Homologues As Potassium Channel Blockers Length = 60 Back     alignment and structure
>pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 Back     alignment and structure
>pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 Back     alignment and structure
>pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 Back     alignment and structure
>pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 Back     alignment and structure
>pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 Back     alignment and structure
>pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 Back     alignment and structure
>pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 Back     alignment and structure
>pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 Back     alignment and structure
>pdb|3BTH|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTH|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTD|I Chain I, The Crystal Structures Of The Complexes Between The Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTD|I Chain I, The Crystal Structures Of The Complexes Between The Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|1FAK|I Chain I, Human Tissue Factor Complexed With Coagulation Factor Viia Inhibited With A Bpti-Mutant Length = 55 Back     alignment and structure
>pdb|1FAK|I Chain I, Human Tissue Factor Complexed With Coagulation Factor Viia Inhibited With A Bpti-Mutant Length = 55 Back     alignment and structure
>pdb|1QLQ|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant With Altered Binding Loop Sequence Length = 58 Back     alignment and structure
>pdb|1QLQ|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant With Altered Binding Loop Sequence Length = 58 Back     alignment and structure
>pdb|3BTT|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTT|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|1Y62|A Chain A, A 2.4 Crystal Structure Of Conkunitzin-S1, A Novel Kunitz- Fold Cone Snail Neurotoxin. Length = 60 Back     alignment and structure
>pdb|1DTX|A Chain A, Crystal Structure Of Alpha-Dendrotoxin From The Green Mamba Venom And Its Comparison With The Structure Of Bovine Pancreatic Trypsin Inhibitor Length = 59 Back     alignment and structure
>pdb|1CO7|I Chain I, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 99 Back     alignment and structure
>pdb|1CO7|I Chain I, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 99 Back     alignment and structure
>pdb|1T8L|B Chain B, Crystal Structure Of The P1 Met Bpti Mutant- Bovine Chymotrypsin Complex Length = 59 Back     alignment and structure
>pdb|1T8L|B Chain B, Crystal Structure Of The P1 Met Bpti Mutant- Bovine Chymotrypsin Complex Length = 59 Back     alignment and structure
>pdb|3BTQ|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTQ|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTM|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTM|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTG|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTG|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTE|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta-Trypsin And Ten P1 Variants Of Bpti. Length = 58 Back     alignment and structure
>pdb|3BTE|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta-Trypsin And Ten P1 Variants Of Bpti. Length = 58 Back     alignment and structure
>pdb|3P95|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17D) Length = 58 Back     alignment and structure
>pdb|3P95|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17D) Length = 58 Back     alignment and structure
>pdb|1P2K|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 Back     alignment and structure
>pdb|1P2K|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 Back     alignment and structure
>pdb|1P2J|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 Back     alignment and structure
>pdb|1P2J|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 Back     alignment and structure
>pdb|3BTF|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti. Length = 58 Back     alignment and structure
>pdb|3BTF|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti. Length = 58 Back     alignment and structure
>pdb|1UUB|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor Mutant, 3-58 Bpti (K15r, R17a, R42s) Length = 56 Back     alignment and structure
>pdb|1UUB|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor Mutant, 3-58 Bpti (K15r, R17a, R42s) Length = 56 Back     alignment and structure
>pdb|1LD5|A Chain A, Structure Of Bpti Mutant A16v Length = 58 Back     alignment and structure
>pdb|1LD5|A Chain A, Structure Of Bpti Mutant A16v Length = 58 Back     alignment and structure
>pdb|1YKT|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 Back     alignment and structure
>pdb|1YKT|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 Back     alignment and structure
>pdb|1EJM|B Chain B, Crystal Structure Of The Bpti Ala16leu Mutant In Complex With Bovine Trypsin Length = 58 Back     alignment and structure
>pdb|1EJM|B Chain B, Crystal Structure Of The Bpti Ala16leu Mutant In Complex With Bovine Trypsin Length = 58 Back     alignment and structure
>pdb|4TPI|I Chain I, The Refined 2.2-angstroms (0.22-nm) X-ray Crystal Structure Of The Ternary Complex Formed By Bovine Trypsinogen, Valine-valine And The Arg15 Analogue Of Bovine Pancreatic Trypsin Inhibitor Length = 58 Back     alignment and structure
>pdb|4TPI|I Chain I, The Refined 2.2-angstroms (0.22-nm) X-ray Crystal Structure Of The Ternary Complex Formed By Bovine Trypsinogen, Valine-valine And The Arg15 Analogue Of Bovine Pancreatic Trypsin Inhibitor Length = 58 Back     alignment and structure
>pdb|1TPA|I Chain I, The Geometry Of The Reactive Site And Of The Peptide Groups In Trypsin, Trypsinogen And Its Complexes With Inhibitors Length = 58 Back     alignment and structure
>pdb|1TPA|I Chain I, The Geometry Of The Reactive Site And Of The Peptide Groups In Trypsin, Trypsinogen And Its Complexes With Inhibitors Length = 58 Back     alignment and structure
>pdb|1PIT|A Chain A, Determination Of A High-Quality Nuclear Magnetic Resonance Solution Structure Of The Bovine Pancreatic Trypsin Inhibitor And Comparison With Three Crystal Structures Length = 58 Back     alignment and structure
>pdb|1PIT|A Chain A, Determination Of A High-Quality Nuclear Magnetic Resonance Solution Structure Of The Bovine Pancreatic Trypsin Inhibitor And Comparison With Three Crystal Structures Length = 58 Back     alignment and structure
>pdb|3P92|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17G) Length = 58 Back     alignment and structure
>pdb|3P92|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17G) Length = 58 Back     alignment and structure
>pdb|1UUA|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor, 3-58 Bpti Length = 56 Back     alignment and structure
>pdb|1UUA|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor, 3-58 Bpti Length = 56 Back     alignment and structure
>pdb|3BTW|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3BTW|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|3TGI|I Chain I, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 65 Back     alignment and structure
>pdb|3TGI|I Chain I, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 65 Back     alignment and structure
>pdb|1JV8|A Chain A, Nmr Structure Of Bpti Mutant G37a Length = 58 Back     alignment and structure
>pdb|1JV8|A Chain A, Nmr Structure Of Bpti Mutant G37a Length = 58 Back     alignment and structure
>pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 Back     alignment and structure
>pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 Back     alignment and structure
>pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 Back     alignment and structure
>pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 Back     alignment and structure
>pdb|9PTI|A Chain A, Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized) Length = 58 Back     alignment and structure
>pdb|9PTI|A Chain A, Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized) Length = 58 Back     alignment and structure
>pdb|1BPT|A Chain A, Crevice-Forming Mutants Of Bpti: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|1BPT|A Chain A, Crevice-Forming Mutants Of Bpti: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|1NAG|A Chain A, Crevice-forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|1NAG|A Chain A, Crevice-forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|2FI4|I Chain I, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 58 Back     alignment and structure
>pdb|2FI4|I Chain I, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 58 Back     alignment and structure
>pdb|2FI5|I Chain I, Crystal Structure Of A Bpti Variant (Cys38->ser) In Complex With Trypsin Length = 58 Back     alignment and structure
>pdb|2FI5|I Chain I, Crystal Structure Of A Bpti Variant (Cys38->ser) In Complex With Trypsin Length = 58 Back     alignment and structure
>pdb|1FAN|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure
>pdb|1FAN|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 7e-35
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 1e-33
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 2e-16
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 1e-14
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 3e-32
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 7e-31
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 1e-14
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 8e-21
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 7e-19
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 4e-17
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 1e-19
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 2e-18
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 6e-16
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 2e-19
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 6e-18
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 2e-17
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 2e-19
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 6e-19
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 1e-16
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 4e-19
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 3e-18
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 6e-17
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 6e-19
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 1e-18
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 2e-16
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 6e-19
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 3e-18
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 3e-16
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 7e-19
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 2e-18
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 2e-16
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 1e-18
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 1e-18
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 2e-16
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 1e-18
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 2e-18
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 2e-16
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} Length = 6 2e-18
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} Length = 6 5e-18
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} Length = 6 4e-16
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 3e-18
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 6e-18
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 3e-16
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 3e-18
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 7e-18
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 4e-16
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 4e-18
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 7e-18
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 2e-15
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 4e-18
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 1e-17
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 5e-17
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 4e-18
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 7e-18
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 1e-15
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 4e-18
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 9e-18
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 1e-16
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 6e-18
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 9e-18
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 6e-17
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 8e-18
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 1e-17
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 9e-16
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 1e-17
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 5e-17
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 6e-16
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 1e-17
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 4e-17
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 6e-17
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 2e-16
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 2e-16
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 6e-15
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
 Score =  123 bits (311), Expect = 7e-35
 Identities = 43/124 (34%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 184 KTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLHPGR 243
           +   C  P + G C    PR+ FN E   C  F YGGC GN NNF++   C + C  P R
Sbjct: 2   RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPER 61

Query: 244 TRV--------ICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECL 295
                       C    D G C+   +R++Y+ +   C  F+Y GCGGN N + + EEC 
Sbjct: 62  VNDFESADFKTGCEPAADSGSCAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECE 121

Query: 296 HYCS 299
             C 
Sbjct: 122 LVCK 125


>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 99.97
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 99.97
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 99.97
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 99.97
1toc_R120 Ornithodorin; vitamin K, zymogen, gamma-carboxyglu 99.88
1toc_R120 Ornithodorin; vitamin K, zymogen, gamma-carboxyglu 99.86
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 99.71
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 99.71
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 99.7
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 99.7
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 99.7
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 99.7
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 99.69
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 99.69
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 99.69
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 99.69
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 99.69
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 99.69
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 99.69
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 99.69
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 99.69
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 99.68
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 99.68
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 99.68
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} 99.67
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 99.67
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 99.66
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 99.65
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 99.65
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 99.64
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 99.64
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 99.64
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 99.64
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 99.63
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 99.63
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 99.63
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 99.63
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 99.63
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 99.63
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 99.62
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 99.62
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} 99.61
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 99.61
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 99.61
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 99.61
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 99.61
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 99.6
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 99.6
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 99.58
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 99.52
2uuy_B52 Tryptase inhibitor; calcium, zymogen, protease, hy 99.52
2uuy_B52 Tryptase inhibitor; calcium, zymogen, protease, hy 99.43
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Back     alignment and structure
Probab=99.97  E-value=3.5e-32  Score=232.78  Aligned_cols=113  Identities=42%  Similarity=0.994  Sum_probs=108.1

Q ss_pred             ccccccCCCCCCCCCCceeEEEcCCCCeEEEEEecCCCCCCCCccChhhhcccCCCCC-----------CCCCCCCccCC
Q psy10170        245 RVICRLPGDGGMCSEYHKRYYYDERRQTCVPFIYTGCGGNLNRFTTSEECLHYCSPPR-----------DPCEQPIERGD  313 (366)
Q Consensus       245 ~~~C~lp~~~G~C~~~~~rwyYD~~~~~C~~F~y~GC~GN~N~F~T~~eC~~~C~~~~-----------~~C~~p~~~G~  313 (366)
                      ..+|.||++.|+|.+.+.|||||+.+++|++|+|+||+||.|+|.|+++|+++|....           ++|.+|++.|+
T Consensus         3 ~~~C~~p~~~G~C~~~~~r~~yn~~t~~C~~F~y~GC~gN~N~F~t~~~C~~~C~~~~~~~~~~~~~~~~~C~~p~~~G~   82 (127)
T 2ody_E            3 NGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADSGS   82 (127)
T ss_dssp             BGGGGSCCCCCSSCCCEEEEEEETTTTEEEEEEECSSCCCSSCBSSHHHHHHHHSSCCCCCCCCCCCHHHHTSSCCCCCS
T ss_pred             CCcccCCCCCccCcCceeeEEEECCCCeeeEeecCCcCCCccccCcHHHHHHhccccccccccccCCcCCcCCCcCCCCc
Confidence            4689999999999999999999999999999999999999999999999999999732           47999999999


Q ss_pred             CCCCCCeeEEecCCCcceeeEecccCCCCCCcCChHHHHHhCCC
Q psy10170        314 CNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCLH  357 (366)
Q Consensus       314 C~~~~~RwyYd~~~~~C~~F~Y~GC~GN~NnF~T~~eC~~~C~~  357 (366)
                      |.+.+.|||||+++++|++|+|+||+||.|||.|+++|+++|.+
T Consensus        83 C~~~~~r~~yd~~~~~C~~F~Y~GC~GN~N~F~t~~eC~~~C~~  126 (127)
T 2ody_E           83 CAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECELVCKN  126 (127)
T ss_dssp             SCCCEEEEEEETTTTEEEEEEECSSCCCSCCBSSHHHHHHHHSC
T ss_pred             ccCcceeEEECCCCCceeEEEECCcCCCCcCcCCHHHHHHHccC
Confidence            99999999999999999999999999999999999999999975



>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Back     alignment and structure
>1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 Back     alignment and structure
>1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Back     alignment and structure
>2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A Back     alignment and structure
>2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d1zr0b163 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor 1e-17
d1zr0b163 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor 2e-16
d1zr0b163 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor 3e-14
d1aapa_56 g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs 9e-17
d1aapa_56 g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs 2e-16
d1aapa_56 g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs 2e-14
d1dtxa_59 g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr 1e-16
d1dtxa_59 g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr 4e-16
d1dtxa_59 g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr 5e-14
d1ktha_58 g.8.1.1 (A:) Collagen type VI (domain C5 from alph 2e-16
d1ktha_58 g.8.1.1 (A:) Collagen type VI (domain C5 from alph 6e-16
d1ktha_58 g.8.1.1 (A:) Collagen type VI (domain C5 from alph 6e-15
d1bf0a_60 g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend 6e-16
d1bf0a_60 g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend 1e-15
d1bf0a_60 g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend 6e-14
d1dtka_57 g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp 7e-16
d1dtka_57 g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp 7e-16
d1dtka_57 g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp 4e-14
d1bika256 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi 8e-16
d1bika256 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi 8e-16
d1bika256 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi 4e-14
d1g6xa_58 g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C 9e-16
d1g6xa_58 g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C 9e-16
d1g6xa_58 g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C 1e-13
d1tfxc_58 g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma 1e-15
d1tfxc_58 g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma 1e-15
d1tfxc_58 g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma 2e-13
d1jc6a_65 g.8.1.1 (A:) Venom basic protease inhibitor IX (VI 1e-15
d1jc6a_65 g.8.1.1 (A:) Venom basic protease inhibitor IX (VI 2e-15
d1jc6a_65 g.8.1.1 (A:) Venom basic protease inhibitor IX (VI 7e-14
d1irha_61 g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma 1e-15
d1irha_61 g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma 2e-15
d1irha_61 g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma 1e-13
d1bunb_61 g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain 2e-15
d1bunb_61 g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain 2e-15
d1bunb_61 g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain 1e-13
d1shpa_55 g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich 3e-15
d1shpa_55 g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich 3e-15
d1shpa_55 g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich 5e-14
d1bika154 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit 5e-15
d1bika154 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit 5e-15
d1bika154 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit 4e-13
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure

class: Small proteins
fold: BPTI-like
superfamily: BPTI-like
family: Small Kunitz-type inhibitors & BPTI-like toxins
domain: Tissue factor pathway inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.2 bits (182), Expect = 1e-17
 Identities = 23/60 (38%), Positives = 34/60 (56%)

Query: 180 PDSNKTDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL 239
           P  N  + C  P++ G C     R+ +++  +SC QF YGGC+GN NNF +  AC + C 
Sbjct: 1   PTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACW 60


>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d1aapa_56 Alzheimer's amyloid B-protein precursor, APPI {Hum 99.74
d1ktha_58 Collagen type VI (domain C5 from alpha 3 chain) {H 99.72
d1shpa_55 Trypsin inhibitor {Sea anemone (Stichodactyla heli 99.72
d1dtka_57 Dendrotoxin K {Black mamba (Dendroaspis polylepis 99.72
d1dtxa_59 alpha-Dendrotoxin {Green mamba (Dendroaspis angust 99.72
d1bika154 Bikunin from inter-alpha-inhibitor complex {Human 99.71
d1bika256 Bikunin from inter-alpha-inhibitor complex {Human 99.71
d1g6xa_58 Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru 99.7
d1zr0b163 Tissue factor pathway inhibitor {Human (Homo sapie 99.7
d1irha_61 Tissue factor pathway inhibitor {Human (Homo sapie 99.69
d1bunb_61 beta2-bungarotoxin, neurotoxin chain {Many-banded 99.69
d1tfxc_58 Tissue factor pathway inhibitor {Human (Homo sapie 99.69
d1aapa_56 Alzheimer's amyloid B-protein precursor, APPI {Hum 99.68
d1jc6a_65 Venom basic protease inhibitor IX (VIIIb) {Banded 99.68
d1dtxa_59 alpha-Dendrotoxin {Green mamba (Dendroaspis angust 99.68
d1bf0a_60 Calcicludine (cac) {Green mamba (Dendroaspis angus 99.67
d1dtka_57 Dendrotoxin K {Black mamba (Dendroaspis polylepis 99.67
d1shpa_55 Trypsin inhibitor {Sea anemone (Stichodactyla heli 99.66
d1bika256 Bikunin from inter-alpha-inhibitor complex {Human 99.66
d1ktha_58 Collagen type VI (domain C5 from alpha 3 chain) {H 99.66
d1bika154 Bikunin from inter-alpha-inhibitor complex {Human 99.65
d1zr0b163 Tissue factor pathway inhibitor {Human (Homo sapie 99.65
d1tfxc_58 Tissue factor pathway inhibitor {Human (Homo sapie 99.64
d1g6xa_58 Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru 99.64
d1irha_61 Tissue factor pathway inhibitor {Human (Homo sapie 99.64
d1bunb_61 beta2-bungarotoxin, neurotoxin chain {Many-banded 99.62
d1bf0a_60 Calcicludine (cac) {Green mamba (Dendroaspis angus 99.62
d1jc6a_65 Venom basic protease inhibitor IX (VIIIb) {Banded 99.61
d1tocr263 Ornithodorin {Soft tick (Ornithodoros moubata) [Ta 95.6
d1tocr263 Ornithodorin {Soft tick (Ornithodoros moubata) [Ta 94.07
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: BPTI-like
superfamily: BPTI-like
family: Small Kunitz-type inhibitors & BPTI-like toxins
domain: Alzheimer's amyloid B-protein precursor, APPI
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=3.7e-19  Score=129.47  Aligned_cols=56  Identities=39%  Similarity=0.957  Sum_probs=53.8

Q ss_pred             CCCCCCCCCccCCCCCCCCeeEEecCCCcceeeEecccCCCCCCcCChHHHHHhCC
Q psy10170        301 PRDPCEQPIERGDCNGNYPRWAFNKEAKSCEQFYYGGCKGNGNNFQSESACLEKCL  356 (366)
Q Consensus       301 ~~~~C~~p~~~G~C~~~~~RwyYd~~~~~C~~F~Y~GC~GN~NnF~T~~eC~~~C~  356 (366)
                      ++++|.+|++.|+|.+.+.|||||+++++|++|+|+||+||.|||.|+++|+++|.
T Consensus         1 v~d~C~~p~~~G~C~~~~~rwyyd~~~~~C~~F~y~GCgGN~NnF~t~~~C~~~CG   56 (56)
T d1aapa_           1 VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG   56 (56)
T ss_dssp             CGGGGGBCCCCCSSSCCEEEEEEETTTTEEEEEEECSSSCCSCCBSSHHHHHHHHC
T ss_pred             CCcccCCCCCCcCCCCceeEEEEECCCCcEeeeEcCCccCCccCcCCHHHHHHhhC
Confidence            46899999999999999999999999999999999999999999999999999984



>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Back     information, alignment and structure
>d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} Back     information, alignment and structure
>d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} Back     information, alignment and structure