Psyllid ID: psy1025
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 310769193 | 311 | P70S6K [Bombyx mori] | 0.713 | 0.591 | 0.696 | 1e-67 | |
| 12060812 | 484 | p70 ribosomal protein S6 kinase [Artemia | 0.569 | 0.303 | 0.771 | 3e-62 | |
| 242008699 | 451 | RAC protein kinase DRAC-PK85, putative [ | 0.565 | 0.323 | 0.802 | 4e-61 | |
| 321475078 | 386 | S6 kinase-like protein [Daphnia pulex] | 0.562 | 0.375 | 0.748 | 1e-59 | |
| 340712000 | 456 | PREDICTED: LOW QUALITY PROTEIN: ribosoma | 0.631 | 0.357 | 0.645 | 5e-59 | |
| 388261310 | 372 | 70 kDa ribosomal protein S6 kinase, part | 0.550 | 0.381 | 0.765 | 1e-58 | |
| 157109407 | 508 | ribosomal protein S6 kinase [Aedes aegyp | 0.562 | 0.285 | 0.721 | 2e-58 | |
| 328778784 | 456 | PREDICTED: ribosomal protein S6 kinase b | 0.631 | 0.357 | 0.645 | 3e-58 | |
| 170033167 | 721 | ribosomal protein S6 kinase [Culex quinq | 0.562 | 0.201 | 0.714 | 6e-58 | |
| 156544249 | 454 | PREDICTED: ribosomal protein S6 kinase b | 0.635 | 0.361 | 0.627 | 6e-58 |
| >gi|310769193|gb|ADP21244.1| P70S6K [Bombyx mori] | Back alignment and taxonomy information |
|---|
Score = 262 bits (669), Expect = 1e-67, Method: Compositional matrix adjust.
Identities = 131/188 (69%), Positives = 156/188 (82%), Gaps = 4/188 (2%)
Query: 1 MKVLRKASIVRNQKDTAHTKAERNILEAVKPPFTADNRKKTIEKILRGKLILPPYLTPDA 60
MKVL+KASIVRNQKDTAHTKAERNILEAVKPP+T DNR KTIEKIL+GKL+LP YLT DA
Sbjct: 105 MKVLKKASIVRNQKDTAHTKAERNILEAVKPPYTGDNRTKTIEKILKGKLMLPAYLTQDA 164
Query: 61 RELIRKLLKRQVAQRLGSGPNDGEAVRVHPFFRSINWSDVLSRKLEPPFKPSLTGEDDVS 120
R+LIR+L+KR QRLG+ AVR H FF+ ++W DV +R+LEPP KP LT EDDVS
Sbjct: 165 RDLIRRLMKRSETQRLGA--AGAAAVRGHAFFKHVHWDDVFARRLEPPIKPRLTSEDDVS 222
Query: 121 QFDTKFTRQTPVDSPDESLLSESANLVFQGFTYVAPSVLEEMHHDKPRIVKARSPRKETS 180
QFDT+FT QTP+DSPDES LSESANL+FQGFTYVAPSV++E+H KPR++ ARSPR+
Sbjct: 223 QFDTRFTLQTPIDSPDESTLSESANLMFQGFTYVAPSVMDEIH--KPRVITARSPRRPRP 280
Query: 181 SYNYYLKP 188
+N+ + P
Sbjct: 281 HHNFTIPP 288
|
Source: Bombyx mori Species: Bombyx mori Genus: Bombyx Family: Bombycidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|12060812|gb|AAG48248.1|AF282407_1 p70 ribosomal protein S6 kinase [Artemia franciscana] | Back alignment and taxonomy information |
|---|
| >gi|242008699|ref|XP_002425139.1| RAC protein kinase DRAC-PK85, putative [Pediculus humanus corporis] gi|212508820|gb|EEB12401.1| RAC protein kinase DRAC-PK85, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321475078|gb|EFX86042.1| S6 kinase-like protein [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|340712000|ref|XP_003394553.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S6 kinase beta-1-like [Bombus terrestris] gi|350402479|ref|XP_003486501.1| PREDICTED: ribosomal protein S6 kinase beta-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|388261310|gb|ADM87427.3| 70 kDa ribosomal protein S6 kinase, partial [Gecarcinus lateralis] | Back alignment and taxonomy information |
|---|
| >gi|157109407|ref|XP_001650654.1| ribosomal protein S6 kinase [Aedes aegypti] gi|108883975|gb|EAT48200.1| AAEL000743-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|328778784|ref|XP_395876.4| PREDICTED: ribosomal protein S6 kinase beta-1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|170033167|ref|XP_001844450.1| ribosomal protein S6 kinase [Culex quinquefasciatus] gi|167873729|gb|EDS37112.1| ribosomal protein S6 kinase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|156544249|ref|XP_001606867.1| PREDICTED: ribosomal protein S6 kinase beta-1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| FB|FBgn0015806 | 637 | S6k "RPS6-p70-protein kinase" | 0.562 | 0.227 | 0.693 | 8.7e-67 | |
| UNIPROTKB|F1RUZ0 | 485 | RPS6KB2 "Uncharacterized prote | 0.585 | 0.311 | 0.642 | 1.6e-63 | |
| UNIPROTKB|F1S224 | 525 | RPS6KB1 "Uncharacterized prote | 0.569 | 0.28 | 0.680 | 5.4e-63 | |
| UNIPROTKB|E2R7K9 | 482 | RPS6KB2 "Uncharacterized prote | 0.585 | 0.313 | 0.635 | 8.8e-63 | |
| UNIPROTKB|J9NU84 | 482 | RPS6KB2 "Uncharacterized prote | 0.585 | 0.313 | 0.635 | 8.8e-63 | |
| UNIPROTKB|F1P4J0 | 502 | RPS6KB1 "Uncharacterized prote | 0.569 | 0.292 | 0.673 | 1.4e-62 | |
| UNIPROTKB|F1MNP4 | 525 | RPS6KB1 "Ribosomal protein S6 | 0.569 | 0.28 | 0.673 | 1.4e-62 | |
| UNIPROTKB|Q6TJY3 | 527 | RPS6KB1 "Ribosomal protein S6 | 0.569 | 0.278 | 0.673 | 1.4e-62 | |
| UNIPROTKB|E2RMD8 | 525 | RPS6KB1 "Uncharacterized prote | 0.569 | 0.28 | 0.673 | 1.4e-62 | |
| UNIPROTKB|B4DLT4 | 472 | RPS6KB1 "cDNA FLJ53847, highly | 0.569 | 0.311 | 0.673 | 1.4e-62 |
| FB|FBgn0015806 S6k "RPS6-p70-protein kinase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 553 (199.7 bits), Expect = 8.7e-67, Sum P(2) = 8.7e-67
Identities = 102/147 (69%), Positives = 124/147 (84%)
Query: 31 PPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGSGPNDGEAVRVHP 90
PPFTA+NRKKTIE IL+ KL LP YLTP+AR+L+R+L+KRQ QRLGSGP D AV++HP
Sbjct: 277 PPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHP 336
Query: 91 FFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSPDESLLSESANLVFQG 150
FF+ +NW DVL+R+LEPP KP L EDDVSQFDT+FTRQ PVDSPD++ LSESANL+FQG
Sbjct: 337 FFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQG 396
Query: 151 FTYVAPSVLEEMHHDKPRIVKARSPRK 177
FTYVAPS+LE+MH + + ARSPR+
Sbjct: 397 FTYVAPSILEDMH--RANRMPARSPRR 421
|
|
| UNIPROTKB|F1RUZ0 RPS6KB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S224 RPS6KB1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R7K9 RPS6KB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NU84 RPS6KB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4J0 RPS6KB1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MNP4 RPS6KB1 "Ribosomal protein S6 kinase beta-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6TJY3 RPS6KB1 "Ribosomal protein S6 kinase beta-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMD8 RPS6KB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DLT4 RPS6KB1 "cDNA FLJ53847, highly similar to Ribosomal protein S6 kinase beta-1 (EC 2.7.11.1)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 3e-80 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 2e-34 | |
| cd05582 | 318 | cd05582, STKc_RSK_N, N-terminal catalytic domain o | 4e-34 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 2e-30 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 8e-30 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 1e-28 | |
| cd05575 | 323 | cd05575, STKc_SGK, Catalytic domain of the Protein | 1e-28 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 9e-28 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 8e-27 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 9e-27 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 4e-26 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 4e-26 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 1e-24 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 2e-24 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 4e-22 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 9e-22 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 1e-21 | |
| cd05602 | 325 | cd05602, STKc_SGK1, Catalytic domain of the Protei | 5e-21 | |
| smart00133 | 64 | smart00133, S_TK_X, Extension to Ser/Thr-type prot | 3e-20 | |
| cd05620 | 316 | cd05620, STKc_nPKC_delta, Catalytic domain of the | 3e-20 | |
| cd05604 | 325 | cd05604, STKc_SGK3, Catalytic domain of the Protei | 7e-20 | |
| cd05615 | 323 | cd05615, STKc_cPKC_alpha, Catalytic domain of the | 8e-20 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 2e-19 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 5e-19 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 2e-18 | |
| cd05603 | 321 | cd05603, STKc_SGK2, Catalytic domain of the Protei | 3e-18 | |
| cd05616 | 323 | cd05616, STKc_cPKC_beta, Catalytic domain of the P | 6e-18 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 6e-18 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 4e-17 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 5e-16 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 5e-16 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 1e-15 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 2e-15 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 3e-15 | |
| cd05588 | 329 | cd05588, STKc_aPKC, Catalytic domain of the Protei | 4e-15 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 6e-15 | |
| cd05618 | 329 | cd05618, STKc_aPKC_iota, Catalytic domain of the P | 2e-14 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 5e-14 | |
| cd05617 | 327 | cd05617, STKc_aPKC_zeta, Catalytic domain of the P | 8e-14 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 8e-14 | |
| pfam00433 | 47 | pfam00433, Pkinase_C, Protein kinase C terminal do | 6e-13 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 8e-13 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 1e-12 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 2e-12 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 2e-11 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 3e-11 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 3e-11 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 4e-11 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 2e-10 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 2e-10 | |
| cd05605 | 285 | cd05605, STKc_GRK4_like, Catalytic domain of G pro | 3e-10 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 4e-10 | |
| cd05625 | 382 | cd05625, STKc_LATS1, Catalytic domain of the Prote | 2e-09 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 3e-09 | |
| cd05623 | 332 | cd05623, STKc_MRCK_alpha, Catalytic domain of the | 5e-08 | |
| cd05606 | 278 | cd05606, STKc_beta_ARK, Catalytic domain of the Pr | 5e-08 | |
| cd05633 | 279 | cd05633, STKc_GRK3, Catalytic domain of the Protei | 1e-07 | |
| cd05630 | 285 | cd05630, STKc_GRK6, Catalytic domain of the Protei | 2e-07 | |
| cd05608 | 280 | cd05608, STKc_GRK1, Catalytic domain of the Protei | 3e-07 | |
| cd05631 | 285 | cd05631, STKc_GRK4, Catalytic domain of the Protei | 6e-07 | |
| cd05626 | 381 | cd05626, STKc_LATS2, Catalytic domain of the Prote | 1e-06 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 2e-06 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 5e-06 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 6e-06 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 7e-06 | |
| cd05632 | 285 | cd05632, STKc_GRK5, Catalytic domain of the Protei | 9e-06 | |
| cd05607 | 277 | cd05607, STKc_GRK7, Catalytic domain of the Protei | 2e-05 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 9e-05 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 1e-04 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 1e-04 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 4e-04 | |
| cd05576 | 237 | cd05576, STKc_RPK118_like, Catalytic domain of the | 8e-04 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 0.001 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 0.001 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 0.003 |
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
Score = 243 bits (623), Expect = 3e-80
Identities = 91/126 (72%), Positives = 109/126 (86%)
Query: 31 PPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGSGPNDGEAVRVHP 90
PPFTA+NRKKTI+KIL+GKL LPPYLTP+AR+L++KLLKR + RLG+GP D V+ HP
Sbjct: 198 PPFTAENRKKTIDKILKGKLNLPPYLTPEARDLLKKLLKRNPSSRLGAGPGDAAEVQSHP 257
Query: 91 FFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSPDESLLSESANLVFQG 150
FFR +NW D+L+RK+EPPFKP L E+DVSQFD+KFTRQTPVDSPD+S LSESAN +F G
Sbjct: 258 FFRHVNWDDLLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQIFLG 317
Query: 151 FTYVAP 156
FTYVAP
Sbjct: 318 FTYVAP 323
|
Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the insulin receptor substrate IRS-1, among others. Mammals contain two isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta). Length = 323 |
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|215917 pfam00433, Pkinase_C, Protein kinase C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| KOG0694|consensus | 694 | 99.97 | ||
| KOG0696|consensus | 683 | 99.96 | ||
| KOG0690|consensus | 516 | 99.95 | ||
| KOG0598|consensus | 357 | 99.95 | ||
| KOG0605|consensus | 550 | 99.95 | ||
| KOG0616|consensus | 355 | 99.93 | ||
| KOG0612|consensus | 1317 | 99.91 | ||
| KOG0695|consensus | 593 | 99.91 | ||
| KOG0610|consensus | 459 | 99.88 | ||
| KOG0614|consensus | 732 | 99.83 | ||
| KOG0608|consensus | 1034 | 99.82 | ||
| KOG0986|consensus | 591 | 99.77 | ||
| KOG0603|consensus | 612 | 99.75 | ||
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.71 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.71 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.7 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.7 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.68 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.67 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.67 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.67 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.66 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.65 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.64 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.64 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.64 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.63 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.62 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.6 | |
| KOG0592|consensus | 604 | 99.59 | ||
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.59 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.59 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.59 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.59 | |
| KOG0606|consensus | 1205 | 99.57 | ||
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.57 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.56 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.56 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.55 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 99.55 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.54 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.53 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.51 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.49 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.48 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.48 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.48 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.46 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.45 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.45 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.44 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.43 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.4 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.39 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.38 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.33 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.28 | |
| KOG0033|consensus | 355 | 99.27 | ||
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.27 | |
| KOG0588|consensus | 786 | 99.27 | ||
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.24 | |
| KOG0575|consensus | 592 | 99.23 | ||
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.21 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.16 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.15 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.13 | |
| KOG0615|consensus | 475 | 99.09 | ||
| KOG0606|consensus | 1205 | 99.06 | ||
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.06 | |
| KOG0580|consensus | 281 | 99.06 | ||
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.06 | |
| KOG4717|consensus | 864 | 99.05 | ||
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.03 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.01 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.01 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.01 | |
| smart00133 | 64 | S_TK_X Extension to Ser/Thr-type protein kinases. | 98.99 | |
| KOG0604|consensus | 400 | 98.99 | ||
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 98.99 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 98.99 | |
| KOG0583|consensus | 370 | 98.97 | ||
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 98.96 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 98.95 | |
| KOG0603|consensus | 612 | 98.89 | ||
| KOG0607|consensus | 463 | 98.87 | ||
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 98.86 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 98.85 | |
| KOG0032|consensus | 382 | 98.84 | ||
| KOG0585|consensus | 576 | 98.83 | ||
| KOG0599|consensus | 411 | 98.82 | ||
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 98.77 | |
| KOG0597|consensus | 808 | 98.76 | ||
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 98.68 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 98.66 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 98.64 | |
| KOG0578|consensus | 550 | 98.59 | ||
| KOG0581|consensus | 364 | 98.59 | ||
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 98.42 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 98.42 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 98.4 | |
| PTZ00284 | 467 | protein kinase; Provisional | 98.4 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 98.36 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 98.34 | |
| KOG0198|consensus | 313 | 98.31 | ||
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 98.3 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 98.29 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 98.28 | |
| PF00433 | 48 | Pkinase_C: Protein kinase C terminal domain; Inter | 98.28 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 98.27 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 98.27 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 98.24 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 98.22 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 98.18 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 98.18 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 98.18 | |
| KOG0660|consensus | 359 | 98.18 | ||
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 98.16 | |
| KOG0593|consensus | 396 | 98.14 | ||
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 98.13 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 98.11 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 98.11 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 98.11 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 98.09 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 98.08 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 98.07 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 98.07 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 98.06 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 98.05 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 98.05 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 98.04 | |
| KOG0586|consensus | 596 | 98.03 | ||
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 98.03 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 98.03 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 98.03 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 98.03 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 98.02 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 98.02 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 98.02 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 98.02 | |
| KOG4279|consensus | 1226 | 98.01 | ||
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 98.01 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 98.0 | |
| KOG4645|consensus | 1509 | 98.0 | ||
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 98.0 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 97.99 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 97.99 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 97.96 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 97.96 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 97.95 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 97.93 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 97.92 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 97.92 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 97.91 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 97.91 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 97.91 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 97.91 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 97.9 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 97.9 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 97.9 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 97.88 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 97.88 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.88 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 97.88 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 97.87 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 97.87 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 97.86 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 97.86 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 97.86 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 97.86 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 97.86 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 97.86 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 97.85 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 97.83 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 97.83 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 97.82 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 97.82 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 97.81 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 97.81 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 97.81 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 97.8 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 97.8 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 97.8 | |
| KOG0663|consensus | 419 | 97.79 | ||
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 97.79 | |
| KOG0201|consensus | 467 | 97.79 | ||
| KOG0600|consensus | 560 | 97.78 | ||
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 97.77 | |
| KOG0611|consensus | 668 | 97.77 | ||
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 97.76 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 97.76 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 97.75 | |
| KOG0582|consensus | 516 | 97.75 | ||
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 97.75 | |
| KOG0658|consensus | 364 | 97.75 | ||
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 97.75 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 97.74 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 97.74 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 97.74 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 97.74 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 97.73 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 97.73 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 97.73 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 97.73 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 97.72 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 97.72 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 97.72 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 97.72 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 97.71 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 97.7 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 97.68 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 97.67 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 97.67 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 97.66 | |
| KOG0579|consensus | 1187 | 97.66 | ||
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 97.66 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 97.66 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 97.65 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 97.64 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 97.63 | |
| KOG4236|consensus | 888 | 97.63 | ||
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 97.63 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 97.62 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 97.62 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 97.62 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 97.61 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 97.61 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 97.59 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 97.58 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 97.58 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 97.58 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 97.57 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 97.57 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 97.57 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 97.55 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 97.55 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 97.54 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 97.54 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 97.54 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 97.53 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 97.53 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 97.52 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 97.52 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 97.51 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 97.51 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 97.51 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 97.5 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 97.5 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 97.49 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 97.49 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 97.48 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 97.47 | |
| smart00750 | 176 | KIND kinase non-catalytic C-lobe domain. It is an | 97.46 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 97.45 | |
| KOG0595|consensus | 429 | 97.42 | ||
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 97.42 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 97.39 | |
| KOG0671|consensus | 415 | 97.33 | ||
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 97.29 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 97.21 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 97.19 | |
| KOG0591|consensus | 375 | 97.16 | ||
| KOG0659|consensus | 318 | 97.16 | ||
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 97.13 | |
| KOG0596|consensus | 677 | 97.11 | ||
| KOG0589|consensus | 426 | 97.1 | ||
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 97.09 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 97.09 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 97.09 | |
| KOG0667|consensus | 586 | 97.09 | ||
| KOG0661|consensus | 538 | 97.05 | ||
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 97.02 | |
| KOG0574|consensus | 502 | 97.01 | ||
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 97.0 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 96.97 | |
| KOG0594|consensus | 323 | 96.96 | ||
| KOG0983|consensus | 391 | 96.95 | ||
| KOG1027|consensus | 903 | 96.93 | ||
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 96.89 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 96.87 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 96.84 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 96.84 | |
| KOG0665|consensus | 369 | 96.84 | ||
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 96.79 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 96.79 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 96.75 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 96.72 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 96.7 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 96.69 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 96.65 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 96.64 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 96.61 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 96.6 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 96.59 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 96.59 | |
| KOG0669|consensus | 376 | 96.58 | ||
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 96.58 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 96.57 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 96.56 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 96.55 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 96.54 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 96.51 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 96.5 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 96.49 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 96.47 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 96.47 | |
| KOG0670|consensus | 752 | 96.45 | ||
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 96.44 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 96.44 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 96.43 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 96.43 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 96.42 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 96.41 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 96.39 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 96.39 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 96.38 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 96.38 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 96.37 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 96.33 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 96.33 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 96.32 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 96.29 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 96.28 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 96.28 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 96.25 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 96.24 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 96.21 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 96.19 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 96.17 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 96.16 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 96.12 | |
| KOG1290|consensus | 590 | 96.11 | ||
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 96.08 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 96.07 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 96.04 | |
| KOG0192|consensus | 362 | 96.03 | ||
| KOG0666|consensus | 438 | 96.02 | ||
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 96.01 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 96.0 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 95.96 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 95.87 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 95.84 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 95.84 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 95.82 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 95.76 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 95.72 | |
| KOG0584|consensus | 632 | 95.7 | ||
| KOG0662|consensus | 292 | 95.67 | ||
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 95.63 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 95.62 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 95.54 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 95.46 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 95.39 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 95.33 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 95.26 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 95.15 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 95.14 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 95.13 | |
| KOG0668|consensus | 338 | 94.91 | ||
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 94.73 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 94.69 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 94.4 | |
| KOG0590|consensus | 601 | 94.4 | ||
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 94.22 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 94.19 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 94.14 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 93.84 | |
| KOG4721|consensus | 904 | 93.74 | ||
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 93.59 | |
| KOG0577|consensus | 948 | 93.45 | ||
| KOG1167|consensus | 418 | 93.36 | ||
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 92.86 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 92.69 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 92.39 | |
| KOG2345|consensus | 302 | 91.8 | ||
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 91.68 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 91.58 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 90.77 | |
| KOG1151|consensus | 775 | 90.59 | ||
| KOG1989|consensus | 738 | 90.5 | ||
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 90.44 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 90.25 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 90.23 | |
| KOG1006|consensus | 361 | 88.31 | ||
| KOG1035|consensus | 1351 | 86.31 | ||
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 85.8 | |
| KOG0587|consensus | 953 | 85.67 | ||
| KOG1026|consensus | 774 | 83.64 | ||
| KOG0197|consensus | 468 | 82.74 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 82.6 | |
| KOG0193|consensus | 678 | 82.28 | ||
| KOG4158|consensus | 598 | 80.52 |
| >KOG0694|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.4e-31 Score=257.80 Aligned_cols=148 Identities=34% Similarity=0.720 Sum_probs=138.7
Q ss_pred cccccCCCCCCCCceehH--------hhhcCCCCCCCCCHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHhhcccccccCC
Q psy1025 7 ASIVRNQKDTAHTKAERN--------ILEAVKPPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGS 78 (258)
Q Consensus 7 ~EIi~~~~~~gh~~~vD~--------~ml~G~pPF~~~~~~~l~~~Il~~~~~~P~~~S~ea~dLI~~LL~kdP~~RLg~ 78 (258)
-||+.+ ..|+.+||| +||.|.+||.+++..++|+.|++..+.||.++|.++.+++++||.++|.+|||+
T Consensus 537 PEil~e---~~Yt~aVDWW~lGVLlyeML~Gq~PF~gddEee~FdsI~~d~~~yP~~ls~ea~~il~~ll~k~p~kRLG~ 613 (694)
T KOG0694|consen 537 PEVLTE---QSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSKEAIAIMRRLLRKNPEKRLGS 613 (694)
T ss_pred hhhhcc---CcccchhhHHHHHHHHHHHHcCCCCCCCCCHHHHHHHHhcCCCCCCCcccHHHHHHHHHHhccCcccccCC
Confidence 378885 689999998 999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCchhhccCCccccCChhhhhcCCCCCCCcCcCCCCCCCCCCChhcccCCCCCCCCc-cccccccCCCccCeeeeCch
Q psy1025 79 GPNDGEAVRVHPFFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSPDE-SLLSESANLVFQGFTYVAPS 157 (258)
Q Consensus 79 ~~~g~~eIk~HpfF~~idW~~l~~r~~~pPf~P~~~~~~D~s~Fd~~f~~~~~~~s~~~-~~~~~~~~~~F~gFsy~~~~ 157 (258)
+++|+++|+.||||++|||++|++|+++|||+|.+++..|++|||++|+.+.+..++.+ ..+....+..|.||+|+++.
T Consensus 614 ~e~d~~~i~~hpFFr~i~w~~L~~r~i~PPf~P~i~~~~D~snFd~eFt~e~p~Lt~~~~~~l~~~~q~~F~~Fs~~~~~ 693 (694)
T KOG0694|consen 614 GERDAEDIKKHPFFRSIDWDDLLNRRIKPPFVPTIKGPEDVSNFDEEFTSEKPALTPSDPRPLTEEEQEAFRDFSFVAEW 693 (694)
T ss_pred CCCCchhhhhCCccccCCHHHHhhccCCCCCCcccCChhhhcccchhhhcCCCccCCCCccccchhhHHHhcCccccCCC
Confidence 99999999999999999999999999999999999999999999999999999999644 44566778899999999875
|
|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >KOG0033|consensus | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >KOG4717|consensus | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >smart00133 S_TK_X Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >KOG0607|consensus | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >KOG0599|consensus | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0578|consensus | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF00433 Pkinase_C: Protein kinase C terminal domain; InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >KOG0660|consensus | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >KOG0586|consensus | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >KOG4279|consensus | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >KOG4645|consensus | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >KOG0663|consensus | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >KOG0611|consensus | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0658|consensus | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >KOG0579|consensus | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >smart00750 KIND kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0671|consensus | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >KOG0659|consensus | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >KOG0596|consensus | Back alignment and domain information |
|---|
| >KOG0589|consensus | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >KOG0667|consensus | Back alignment and domain information |
|---|
| >KOG0661|consensus | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >KOG0574|consensus | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >KOG0594|consensus | Back alignment and domain information |
|---|
| >KOG0983|consensus | Back alignment and domain information |
|---|
| >KOG1027|consensus | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >KOG0665|consensus | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0669|consensus | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >KOG0670|consensus | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG1290|consensus | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >KOG0666|consensus | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >KOG0584|consensus | Back alignment and domain information |
|---|
| >KOG0662|consensus | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG0668|consensus | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG0590|consensus | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >KOG0577|consensus | Back alignment and domain information |
|---|
| >KOG1167|consensus | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >KOG2345|consensus | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >KOG1151|consensus | Back alignment and domain information |
|---|
| >KOG1989|consensus | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >KOG1006|consensus | Back alignment and domain information |
|---|
| >KOG1035|consensus | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >KOG0587|consensus | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >KOG4158|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 3a60_A | 327 | Crystal Structure Of Unphosphorylated P70s6k1 (Form | 1e-41 | ||
| 3a62_A | 327 | Crystal Structure Of Phosphorylated P70s6k1 Length | 1e-41 | ||
| 3g51_A | 325 | Structural Diversity Of The Active Conformation Of | 1e-20 | ||
| 2jdo_A | 342 | Structure Of Pkb-Beta (Akt2) Complexed With Isoquin | 2e-20 | ||
| 1o6l_A | 337 | Crystal Structure Of An Activated Akt/protein Kinas | 2e-20 | ||
| 1mrv_A | 339 | Crystal Structure Of An Inactive Akt2 Kinase Domain | 6e-20 | ||
| 1gzn_A | 335 | Structure Of Pkb Kinase Domain Length = 335 | 6e-20 | ||
| 1o6k_A | 336 | Structure Of Activated Form Of Pkb Kinase Domain S4 | 7e-20 | ||
| 1gzk_A | 315 | Molecular Mechanism For The Regulation Of Protein K | 7e-20 | ||
| 3e87_A | 335 | Crystal Structures Of The Kinase Domain Of Akt2 In | 1e-19 | ||
| 2z7q_A | 321 | Crystal Structure Of The N-Terminal Kinase Domain O | 3e-19 | ||
| 3txo_A | 353 | Pkc Eta Kinase In Complex With A Naphthyridine Leng | 4e-19 | ||
| 3iw4_A | 360 | Crystal Structure Of Pkc Alpha In Complex With Nvp- | 5e-18 | ||
| 2r5t_A | 373 | Crystal Structure Of Inactive Serum And Glucocortic | 1e-17 | ||
| 3ubd_A | 304 | Structure Of N-Terminal Domain Of Rsk2 Kinase In Co | 4e-17 | ||
| 1fot_A | 318 | Structure Of The Unliganded Camp-Dependent Protein | 4e-17 | ||
| 4el9_A | 305 | Structure Of N-Terminal Kinase Domain Of Rsk2 With | 4e-17 | ||
| 3ocb_A | 341 | Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor | 7e-17 | ||
| 4gv1_A | 340 | Pkb Alpha In Complex With Azd5363 Length = 340 | 8e-17 | ||
| 3cqu_A | 342 | Crystal Structure Of Akt-1 Complexed With Substrate | 8e-17 | ||
| 4ejn_A | 446 | Crystal Structure Of Autoinhibited Form Of Akt1 In | 2e-16 | ||
| 3o96_A | 446 | Crystal Structure Of Human Akt1 With An Allosteric | 7e-16 | ||
| 3pfq_A | 674 | Crystal Structure And Allosteric Activation Of Prot | 2e-14 | ||
| 1vzo_A | 355 | The Structure Of The N-Terminal Kinase Domain Of Ms | 6e-14 | ||
| 2i0e_A | 353 | Structure Of Catalytic Domain Of Human Protein Kina | 6e-14 | ||
| 4dg3_E | 371 | Crystal Structure Of R336a Mutant Of Camp-dependent | 1e-13 | ||
| 4dfy_A | 371 | Crystal Structure Of R194a Mutant Of Camp-Dependent | 1e-13 | ||
| 2f7e_E | 351 | Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu | 1e-13 | ||
| 2vo0_A | 351 | Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 | 1e-13 | ||
| 2uvy_A | 351 | Structure Of Pka-pkb Chimera Complexed With Methyl- | 1e-13 | ||
| 2jdt_A | 351 | Structure Of Pka-Pkb Chimera Complexed With Isoquin | 1e-13 | ||
| 2gng_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 1e-13 | ||
| 1szm_A | 350 | Dual Binding Mode Of Bisindolylmaleimide 2 To Prote | 1e-13 | ||
| 1ctp_E | 350 | Structure Of The Mammalian Catalytic Subunit Of Cam | 1e-13 | ||
| 3mvj_A | 371 | Human Cyclic Amp-Dependent Protein Kinase Pka Inhib | 1e-13 | ||
| 2gnf_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 1e-13 | ||
| 1q24_A | 350 | Pka Double Mutant Model Of Pkb In Complex With Mgat | 1e-13 | ||
| 4ae9_A | 343 | Structure And Function Of The Human Sperm-specific | 1e-13 | ||
| 2c1a_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 1e-13 | ||
| 1svh_A | 350 | Crystal Structure Of Protein Kinase A In Complex Wi | 1e-13 | ||
| 3o7l_B | 350 | Crystal Structure Of Phospholamban (1-19):pka C-Sub | 1e-13 | ||
| 1xh7_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 1e-13 | ||
| 1smh_A | 350 | Protein Kinase A Variant Complex With Completely Or | 1e-13 | ||
| 1q61_A | 350 | Pka Triple Mutant Model Of Pkb Length = 350 | 1e-13 | ||
| 3l9m_A | 351 | Crystal Structure Of Pkab3 (Pka Triple Mutant V123a | 1e-13 | ||
| 1syk_A | 350 | Crystal Structure Of E230q Mutant Of Camp-Dependent | 1e-13 | ||
| 3agm_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 1e-13 | ||
| 1xh9_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 1e-13 | ||
| 2jds_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 1e-13 | ||
| 1q8w_A | 350 | The Catalytic Subunit Of Camp-Dependent Protein Kin | 1e-13 | ||
| 2gnj_A | 350 | Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 | 1e-13 | ||
| 1stc_E | 350 | Camp-Dependent Protein Kinase, Alpha-Catalytic Subu | 1e-13 | ||
| 4ae6_A | 343 | Structure And Function Of The Human Sperm-specific | 1e-13 | ||
| 3agl_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 1e-13 | ||
| 3qam_E | 350 | Crystal Structure Of Glu208ala Mutant Of Catalytic | 1e-13 | ||
| 1fmo_E | 350 | Crystal Structure Of A Polyhistidine-Tagged Recombi | 1e-13 | ||
| 4dfx_E | 350 | Crystal Structure Of Myristoylated K7c Catalytic Su | 1e-13 | ||
| 1apm_E | 350 | 2.0 Angstrom Refined Crystal Structure Of The Catal | 1e-13 | ||
| 2erz_E | 351 | Crystal Structure Of C-amp Dependent Kinase (pka) B | 1e-13 | ||
| 1j3h_A | 350 | Crystal Structure Of Apoenzyme Camp-Dependent Prote | 1e-13 | ||
| 3ama_A | 351 | Protein Kinase A Sixfold Mutant Model Of Aurora B W | 1e-13 | ||
| 2qcs_A | 350 | A Complex Structure Between The Catalytic And Regul | 1e-13 | ||
| 1bkx_A | 350 | A Binary Complex Of The Catalytic Subunit Of Camp-D | 1e-13 | ||
| 3fhi_A | 350 | Crystal Structure Of A Complex Between The Catalyti | 2e-13 | ||
| 1l3r_E | 350 | Crystal Structure Of A Transition State Mimic Of Th | 2e-13 | ||
| 1rdq_E | 350 | Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of | 2e-13 | ||
| 1jbp_E | 350 | Crystal Structure Of The Catalytic Subunit Of Camp- | 2e-13 | ||
| 3pvb_A | 345 | Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca | 2e-13 | ||
| 2gu8_A | 337 | Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel | 2e-13 | ||
| 2qur_A | 350 | Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe | 2e-13 | ||
| 4dc2_A | 396 | Structure Of Pkc In Complex With A Substrate Peptid | 2e-13 | ||
| 3zh8_A | 349 | A Novel Small Molecule Apkc Inhibitor Length = 349 | 3e-13 | ||
| 3nx8_A | 351 | Human Camp Dependent Protein Kinase In Complex With | 3e-13 | ||
| 3a8w_A | 345 | Crystal Structure Of Pkciota Kinase Domain Length = | 5e-13 | ||
| 1zrz_A | 364 | Crystal Structure Of The Catalytic Domain Of Atypic | 5e-13 | ||
| 1cdk_A | 350 | Camp-Dependent Protein Kinase Catalytic Subunit (E. | 5e-13 | ||
| 1ydt_E | 350 | Structure Of Camp-Dependent Protein Kinase, Alpha-C | 5e-13 | ||
| 3dnd_A | 350 | Camp-Dependent Protein Kinase Pka Catalytic Subunit | 5e-13 | ||
| 1cmk_E | 350 | Crystal Structures Of The Myristylated Catalytic Su | 5e-13 | ||
| 2uzt_A | 336 | Pka Structures Of Akt, Indazole-Pyridine Inhibitors | 6e-13 | ||
| 3qal_E | 350 | Crystal Structure Of Arg280ala Mutant Of Catalytic | 9e-13 | ||
| 1xjd_A | 345 | Crystal Structure Of Pkc-Theta Complexed With Staur | 2e-12 | ||
| 2jed_A | 352 | The Crystal Structure Of The Kinase Domain Of The P | 2e-12 | ||
| 1omw_A | 689 | Crystal Structure Of The Complex Between G Protein- | 2e-08 | ||
| 3psc_A | 695 | Bovine Grk2 In Complex With Gbetagamma Subunits Len | 2e-08 | ||
| 3cik_A | 689 | Human Grk2 In Complex With Gbetagamma Subunits Leng | 3e-08 | ||
| 3krw_A | 688 | Human Grk2 In Complex With Gbetgamma Subunits And B | 3e-08 | ||
| 3qc4_A | 314 | Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = | 6e-08 | ||
| 3nax_A | 311 | Pdk1 In Complex With Inhibitor Mp7 Length = 311 | 7e-08 | ||
| 3nay_A | 311 | Pdk1 In Complex With Inhibitor Mp6 Length = 311 | 7e-08 | ||
| 3orx_A | 316 | Pdk1 Mutant Bound To Allosteric Disulfide Fragment | 8e-08 | ||
| 2xck_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 8e-08 | ||
| 3pwy_A | 311 | Crystal Structure Of An Extender (Spd28345)-Modifie | 9e-08 | ||
| 3h9o_A | 311 | Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) | 9e-08 | ||
| 1uu3_A | 310 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 9e-08 | ||
| 3rwp_A | 311 | Discovery Of A Novel, Potent And Selective Inhibito | 9e-08 | ||
| 2biy_A | 310 | Structure Of Pdk1-S241a Mutant Kinase Domain Length | 9e-08 | ||
| 3nun_A | 292 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea | 9e-08 | ||
| 3sc1_A | 311 | Novel Isoquinolone Pdk1 Inhibitors Discovered Throu | 9e-08 | ||
| 3iop_A | 312 | Pdk-1 In Complex With The Inhibitor Compound-8i Len | 9e-08 | ||
| 2xch_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 9e-08 | ||
| 2r7b_A | 312 | Crystal Structure Of The Phosphoinositide-Dependent | 9e-08 | ||
| 1z5m_A | 286 | Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr | 1e-07 | ||
| 3nus_A | 286 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra | 1e-07 | ||
| 1uu9_A | 286 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 1e-07 | ||
| 1h1w_A | 289 | High Resolution Crystal Structure Of The Human Pdk1 | 1e-07 | ||
| 3tku_A | 433 | Mrck Beta In Complex With Fasudil Length = 433 | 1e-07 | ||
| 4aw2_A | 437 | Crystal Structure Of Cdc42 Binding Protein Kinase A | 1e-07 | ||
| 3qfv_A | 415 | Mrck Beta In Complex With Tpca-1 Length = 415 | 1e-07 | ||
| 3hrc_A | 311 | Crystal Structure Of A Mutant Of Human Pdk1 Kinase | 2e-07 | ||
| 4a07_A | 311 | Human Pdk1 Kinase Domain In Complex With Allosteric | 2e-07 | ||
| 3nyn_A | 576 | Crystal Structure Of G Protein-Coupled Receptor Kin | 1e-06 | ||
| 2acx_A | 576 | Crystal Structure Of G Protein Coupled Receptor Kin | 1e-06 | ||
| 3qc9_A | 543 | Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 | 3e-06 | ||
| 3c4x_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 3e-06 | ||
| 3t8o_A | 543 | Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu | 3e-06 | ||
| 3c4w_A | 543 | Crystal Structure Of G Protein Coupled Receptor Kin | 3e-06 | ||
| 2vd5_A | 412 | Structure Of Human Myotonic Dystrophy Protein Kinas | 1e-05 | ||
| 3cok_A | 278 | Crystal Structure Of Plk4 Kinase Length = 278 | 2e-04 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 3e-04 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 9e-04 |
| >pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 | Back alignment and structure |
|
| >pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 | Back alignment and structure |
| >pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 | Back alignment and structure |
| >pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 | Back alignment and structure |
| >pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 | Back alignment and structure |
| >pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 | Back alignment and structure |
| >pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 | Back alignment and structure |
| >pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 | Back alignment and structure |
| >pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 | Back alignment and structure |
| >pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 | Back alignment and structure |
| >pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 | Back alignment and structure |
| >pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 | Back alignment and structure |
| >pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 | Back alignment and structure |
| >pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 | Back alignment and structure |
| >pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 | Back alignment and structure |
| >pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 | Back alignment and structure |
| >pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 | Back alignment and structure |
| >pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 | Back alignment and structure |
| >pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 | Back alignment and structure |
| >pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 | Back alignment and structure |
| >pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 | Back alignment and structure |
| >pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 | Back alignment and structure |
| >pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 | Back alignment and structure |
| >pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 | Back alignment and structure |
| >pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 | Back alignment and structure |
| >pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 | Back alignment and structure |
| >pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 | Back alignment and structure |
| >pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 | Back alignment and structure |
| >pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 | Back alignment and structure |
| >pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 | Back alignment and structure |
| >pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 | Back alignment and structure |
| >pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 | Back alignment and structure |
| >pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 | Back alignment and structure |
| >pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 | Back alignment and structure |
| >pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 | Back alignment and structure |
| >pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 | Back alignment and structure |
| >pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 | Back alignment and structure |
| >pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 | Back alignment and structure |
| >pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 | Back alignment and structure |
| >pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 | Back alignment and structure |
| >pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 | Back alignment and structure |
| >pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 | Back alignment and structure |
| >pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 | Back alignment and structure |
| >pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 | Back alignment and structure |
| >pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 | Back alignment and structure |
| >pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 | Back alignment and structure |
| >pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 | Back alignment and structure |
| >pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 | Back alignment and structure |
| >pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 | Back alignment and structure |
| >pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 | Back alignment and structure |
| >pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 | Back alignment and structure |
| >pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 | Back alignment and structure |
| >pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 | Back alignment and structure |
| >pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 | Back alignment and structure |
| >pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 | Back alignment and structure |
| >pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 | Back alignment and structure |
| >pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 | Back alignment and structure |
| >pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 | Back alignment and structure |
| >pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 | Back alignment and structure |
| >pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 | Back alignment and structure |
| >pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 | Back alignment and structure |
| >pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 | Back alignment and structure |
| >pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 | Back alignment and structure |
| >pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 | Back alignment and structure |
| >pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 | Back alignment and structure |
| >pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 | Back alignment and structure |
| >pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 | Back alignment and structure |
| >pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 | Back alignment and structure |
| >pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 | Back alignment and structure |
| >pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 | Back alignment and structure |
| >pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 | Back alignment and structure |
| >pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 | Back alignment and structure |
| >pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 | Back alignment and structure |
| >pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 | Back alignment and structure |
| >pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 | Back alignment and structure |
| >pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 | Back alignment and structure |
| >pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 | Back alignment and structure |
| >pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 | Back alignment and structure |
| >pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 | Back alignment and structure |
| >pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 | Back alignment and structure |
| >pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 | Back alignment and structure |
| >pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 | Back alignment and structure |
| >pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 | Back alignment and structure |
| >pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 | Back alignment and structure |
| >pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 | Back alignment and structure |
| >pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 | Back alignment and structure |
| >pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 | Back alignment and structure |
| >pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 | Back alignment and structure |
| >pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 | Back alignment and structure |
| >pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 | Back alignment and structure |
| >pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 | Back alignment and structure |
| >pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 | Back alignment and structure |
| >pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 | Back alignment and structure |
| >pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 | Back alignment and structure |
| >pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 | Back alignment and structure |
| >pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 | Back alignment and structure |
| >pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 | Back alignment and structure |
| >pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 | Back alignment and structure |
| >pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 | Back alignment and structure |
| >pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 | Back alignment and structure |
| >pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 | Back alignment and structure |
| >pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 | Back alignment and structure |
| >pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 | Back alignment and structure |
| >pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 | Back alignment and structure |
| >pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 | Back alignment and structure |
| >pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 | Back alignment and structure |
| >pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 | Back alignment and structure |
| >pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 | Back alignment and structure |
| >pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 | Back alignment and structure |
| >pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 3e-59 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 2e-07 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 1e-56 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 6e-07 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 3e-55 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 1e-08 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 7e-54 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 4e-12 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 1e-53 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 1e-05 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 2e-53 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 1e-06 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 6e-53 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 8e-07 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 8e-52 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 7e-07 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 1e-51 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 2e-07 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 5e-49 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 2e-08 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 1e-48 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 9e-10 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 5e-47 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 1e-05 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 5e-46 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 3e-07 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 2e-44 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 2e-07 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 1e-43 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 3e-07 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 1e-43 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 7e-08 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 2e-43 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 1e-08 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 4e-40 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 1e-06 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 7e-39 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 2e-10 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 1e-37 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 5e-07 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 8e-31 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 1e-07 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 2e-28 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 1e-07 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 6e-16 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 1e-14 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 5e-11 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 1e-09 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 1e-09 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 1e-09 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 2e-09 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 2e-08 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 2e-08 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 3e-08 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 5e-08 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 5e-08 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 5e-08 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 6e-08 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-07 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 2e-07 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-07 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 2e-07 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 2e-07 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 3e-07 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 3e-07 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 5e-07 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 6e-07 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 7e-07 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 1e-06 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 2e-06 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 2e-06 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 2e-06 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 2e-06 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 2e-06 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 2e-06 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 2e-06 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 2e-06 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 5e-06 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 5e-06 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 5e-06 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 8e-06 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 8e-06 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 8e-06 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 9e-06 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 1e-05 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 1e-05 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 2e-05 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 2e-05 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 2e-05 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 3e-05 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 3e-05 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 5e-05 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 6e-05 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 6e-05 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 7e-05 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 8e-05 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 9e-05 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 1e-04 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 1e-04 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 2e-04 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 2e-04 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 2e-04 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 3e-04 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 3e-04 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 3e-04 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 4e-04 |
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
Score = 190 bits (485), Expect = 3e-59
Identities = 36/136 (26%), Positives = 69/136 (50%), Gaps = 2/136 (1%)
Query: 30 KPPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGSGPNDGEAVRVH 89
+ PF ++ + + I+ + P ++ +A + + L+ + +RLG GP ++ H
Sbjct: 218 QAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEH 277
Query: 90 PFFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSP-DESLLSESANLVF 148
FFR I+W + ++++PP+KP G + FD FTR PV +P D+ ++ F
Sbjct: 278 AFFRYIDWEKLERKEIQPPYKPKACGR-NAENFDRFFTRHPPVLTPPDQEVIRNIDQSEF 336
Query: 149 QGFTYVAPSVLEEMHH 164
+GF++V L+
Sbjct: 337 EGFSFVNSEFLKPEVK 352
|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.9 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.9 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.9 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.89 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.89 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.87 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.87 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.87 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.85 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.84 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.82 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.81 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.8 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.79 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.78 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.74 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.73 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.7 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.68 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.59 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.58 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.47 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.27 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.15 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.13 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.12 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.11 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.1 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.09 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.08 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.07 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 98.98 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 98.96 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 98.88 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 98.87 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 98.86 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 98.85 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 98.81 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 98.77 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 98.77 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 98.75 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 98.72 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 98.72 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 98.72 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 98.7 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 98.69 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 98.67 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 98.67 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 98.65 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 98.64 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 98.64 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 98.62 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 98.62 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 98.61 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.59 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 98.59 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 98.59 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 98.59 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 98.58 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 98.58 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 98.58 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 98.58 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 98.58 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 98.57 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 98.56 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 98.56 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 98.55 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 98.55 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 98.55 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 98.55 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 98.55 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 98.55 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 98.54 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 98.53 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 98.53 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 98.53 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 98.52 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 98.52 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.51 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 98.51 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 98.51 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 98.51 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 98.51 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.51 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 98.5 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 98.5 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 98.49 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 98.48 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 98.48 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 98.48 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 98.48 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 98.47 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 98.47 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 98.46 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 98.46 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 98.45 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.45 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 98.44 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 98.44 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 98.44 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 98.44 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 98.44 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 98.43 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 98.43 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 98.43 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 98.42 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 98.42 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 98.41 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 98.4 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 98.4 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 98.39 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 98.39 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 98.37 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 98.33 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 98.33 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 98.32 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 98.3 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 98.29 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 98.29 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 98.28 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 98.28 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 98.27 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 98.27 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 98.25 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 98.24 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 98.23 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 98.23 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 98.21 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 98.21 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 98.2 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 98.19 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 98.19 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 98.18 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 98.17 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 98.17 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.14 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 98.13 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 98.13 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 98.11 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 98.09 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 98.08 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 98.08 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 98.04 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 98.02 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 98.01 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 97.99 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 97.97 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.96 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 97.96 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 97.96 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 97.95 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 97.94 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 97.93 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 97.92 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 97.91 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 97.9 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 97.88 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 97.8 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 97.79 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 97.76 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 97.76 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 97.74 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 97.72 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 97.67 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 97.62 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 97.54 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 97.53 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 97.52 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 97.49 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 97.38 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 97.37 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 97.36 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 97.36 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 97.35 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 97.35 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 97.34 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 97.31 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 97.31 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 97.29 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 97.27 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 97.21 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.2 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 97.16 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 97.16 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 97.15 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 97.14 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 97.13 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 97.13 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 97.12 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 97.11 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 97.11 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 97.06 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 97.06 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 97.04 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 97.04 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 97.03 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 97.03 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 97.03 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 97.02 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 96.99 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 96.98 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 96.96 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 96.94 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 96.94 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 96.92 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 96.92 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 96.92 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 96.91 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 96.88 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 96.82 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 96.77 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 96.74 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 96.72 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 96.71 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 96.67 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 96.67 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 96.66 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 96.65 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 96.61 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.56 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 96.54 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 96.54 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 96.54 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 96.52 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 96.5 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 96.46 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 96.37 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 96.2 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 96.14 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 95.98 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 95.55 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 95.48 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 95.27 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 94.87 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 94.52 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 94.43 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 94.17 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 94.16 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 94.02 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 93.68 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 93.59 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 93.54 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 93.12 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 92.8 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 92.1 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 91.13 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 89.0 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 87.36 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 85.21 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 84.98 |
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.90 E-value=3.7e-24 Score=196.10 Aligned_cols=148 Identities=30% Similarity=0.610 Sum_probs=128.8
Q ss_pred ccccCCCCCCCCceehH--------hhhcCCCCCCCCCHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHhhcccccccCC-
Q psy1025 8 SIVRNQKDTAHTKAERN--------ILEAVKPPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGS- 78 (258)
Q Consensus 8 EIi~~~~~~gh~~~vD~--------~ml~G~pPF~~~~~~~l~~~Il~~~~~~P~~~S~ea~dLI~~LL~kdP~~RLg~- 78 (258)
|++.+ ..|+.++|| +|++|.+||.+.+...++.+|+...+.+|..++.++++||++||.+||.+|+++
T Consensus 194 E~~~~---~~~~~~~DiwslG~il~ell~G~~Pf~~~~~~~~~~~i~~~~~~~p~~~~~~~~~li~~lL~~dP~~R~~~~ 270 (353)
T 3txo_A 194 EILQE---MLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL 270 (353)
T ss_dssp HHHHH---HHCTTHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHCCCCCCTTSCHHHHHHHHHHTCSSGGGSTTSG
T ss_pred hhcCC---CCcCCccCCCcchHHHHHHHhCCCCCCCCCHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHhhhCHHHccCCc
Confidence 55553 458888885 889999999999999999999999999999999999999999999999999996
Q ss_pred CCCCchhhccCCccccCChhhhhcCCCCCCCcCcCCCCCCCCCCChhcccCCCCCCCCccc-cccccCCCccCeeeeCch
Q psy1025 79 GPNDGEAVRVHPFFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSPDESL-LSESANLVFQGFTYVAPS 157 (258)
Q Consensus 79 ~~~g~~eIk~HpfF~~idW~~l~~r~~~pPf~P~~~~~~D~s~Fd~~f~~~~~~~s~~~~~-~~~~~~~~F~gFsy~~~~ 157 (258)
...|+++|++||||+++||+.+..++++|||+|.+.+..|+++||.+|+.+.+..++.+.. .....+..|.||+|+++.
T Consensus 271 ~~~~~~~il~hp~f~~~~w~~l~~~~~~~p~~p~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~f~~f~~~~~~ 350 (353)
T 3txo_A 271 TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFEYVSPE 350 (353)
T ss_dssp GGTCTHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCCSTTCCTTSCHHHHTSCCCCCCCCTTSGGGSCGGGGTTCCEECC-
T ss_pred ccCCHHHHhhCCcccCCCHHHHhcCcCCCCccCCCCCcccccccCcccccCCCcCCCccccccCcccccccCCceeeCcc
Confidence 3456799999999999999999999999999999999999999999999998888876542 223345689999999986
Q ss_pred H
Q psy1025 158 V 158 (258)
Q Consensus 158 ~ 158 (258)
+
T Consensus 351 ~ 351 (353)
T 3txo_A 351 L 351 (353)
T ss_dssp -
T ss_pred c
Confidence 5
|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 258 | ||||
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 3e-38 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 1e-33 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 2e-29 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 2e-28 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 3e-27 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 2e-23 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 9e-17 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 6e-12 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 3e-10 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 5e-10 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 3e-09 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 8e-09 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 1e-07 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 2e-07 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 2e-07 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 4e-07 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 8e-07 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 2e-06 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 6e-06 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 6e-06 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 2e-05 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 3e-05 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 3e-05 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 4e-05 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 4e-05 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 1e-04 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 1e-04 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 1e-04 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 2e-04 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 2e-04 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 2e-04 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-04 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 3e-04 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 3e-04 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 3e-04 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 4e-04 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 5e-04 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 7e-04 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 0.001 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 0.002 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 0.002 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 0.002 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 0.002 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 0.002 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 0.004 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 0.004 |
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Pkb kinase (Akt-2) species: Human (Homo sapiens) [TaxId: 9606]
Score = 134 bits (338), Expect = 3e-38
Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 8/134 (5%)
Query: 30 KPPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGSGPNDGEAVRVH 89
+ PF + ++ E IL ++ P L+P+A+ L+ LLK+ QRLG GP+D + V H
Sbjct: 202 RLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEH 261
Query: 90 PFFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSPDES--------LLS 141
FF SINW DV+ +KL PPFKP +T E D FD +FT Q+ +P + L
Sbjct: 262 RFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQ 321
Query: 142 ESANLVFQGFTYVA 155
+F+ F Y+A
Sbjct: 322 REEQEMFEDFDYIA 335
|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.9 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.86 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.79 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.79 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.72 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.61 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.6 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.3 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.22 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.07 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.07 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.07 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 98.98 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 98.93 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 98.92 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 98.92 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 98.9 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 98.9 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 98.83 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 98.82 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 98.8 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 98.79 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 98.77 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 98.77 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 98.77 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 98.75 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 98.75 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 98.74 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 98.74 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 98.72 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 98.7 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 98.67 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 98.67 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 98.58 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 98.54 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 98.28 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 98.2 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 98.16 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 98.08 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 98.04 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 98.03 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 97.96 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.93 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 97.9 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 97.89 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 97.89 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 97.88 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 97.78 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 97.77 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 97.76 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.74 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 97.73 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.69 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 97.67 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 97.62 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 97.46 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 97.42 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 97.28 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.13 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 95.62 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 80.86 |
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Pkb kinase (Akt-2) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=5.1e-24 Score=192.70 Aligned_cols=147 Identities=35% Similarity=0.610 Sum_probs=123.9
Q ss_pred cccccCCCCCCCCceehH--------hhhcCCCCCCCCCHHHHHHHHHcCCCCCCCCCCHHHHHHHHHHhhcccccccCC
Q psy1025 7 ASIVRNQKDTAHTKAERN--------ILEAVKPPFTADNRKKTIEKILRGKLILPPYLTPDARELIRKLLKRQVAQRLGS 78 (258)
Q Consensus 7 ~EIi~~~~~~gh~~~vD~--------~ml~G~pPF~~~~~~~l~~~Il~~~~~~P~~~S~ea~dLI~~LL~kdP~~RLg~ 78 (258)
-||+.+ .+|+.++|| +|++|++||.+.+...++..|....+.+|..+|+++++||++||++||.+|+++
T Consensus 174 PE~~~~---~~y~~~~DiwSlGvilyeml~G~~pf~~~~~~~~~~~i~~~~~~~p~~~s~~~~dli~~~L~~dP~~R~~~ 250 (337)
T d1o6la_ 174 PEVLED---NDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGG 250 (337)
T ss_dssp GGGGSS---SCBCTTHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHCCCCCCTTSCHHHHHHHHHHTCSSTTTSTTC
T ss_pred hhhccC---CCCChhhcccchhhHHHHHHHCCCCCCCcCHHHHHHHHhcCCCCCCccCCHHHHHHHHhhccCCchhhccc
Confidence 378885 578999995 899999999999999999999999999999999999999999999999999987
Q ss_pred CCCCchhhccCCccccCChhhhhcCCCCCCCcCcCCCCCCCCCCChhcccCCCCCCCCccc--------cccccCCCccC
Q psy1025 79 GPNDGEAVRVHPFFRSINWSDVLSRKLEPPFKPSLTGEDDVSQFDTKFTRQTPVDSPDESL--------LSESANLVFQG 150 (258)
Q Consensus 79 ~~~g~~eIk~HpfF~~idW~~l~~r~~~pPf~P~~~~~~D~s~Fd~~f~~~~~~~s~~~~~--------~~~~~~~~F~g 150 (258)
...++++|++||||.+++|+.+..+++.|||+|.+....|+++|+.+++.+....++.+.. .....+..|.+
T Consensus 251 ~~~~~~eil~Hp~f~~i~~~~l~~~~~~~p~~P~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~ 330 (337)
T d1o6la_ 251 GPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQREEQEMFED 330 (337)
T ss_dssp STTTHHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCSSTTCCTTSCHHHHTSCCC--------------------CCTTTT
T ss_pred ccccHHHHHcCcccccCCHHHHHhCCCCCCCCCCCCChhhhhhcCchhhhccCCCCCCccccccccccccchhhhhccCC
Confidence 6567899999999999999999999999999999999999999999998877665554321 11234568999
Q ss_pred eeeeCc
Q psy1025 151 FTYVAP 156 (258)
Q Consensus 151 Fsy~~~ 156 (258)
|+|++.
T Consensus 331 f~~v~d 336 (337)
T d1o6la_ 331 FDYIAD 336 (337)
T ss_dssp CCEECC
T ss_pred CEeeCC
Confidence 999863
|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|