Psyllid ID: psy10399


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--
MKRRKEWDSLSARQKRTDGASGNSVVEGDFAVGTSPNVSPPNNLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLRDSTKDDDQFHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLKWNREVLVLAGSHANGTNKKLSSLVC
cccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEEEccccccccHHHHHccccHHHHHHHHcccccccccccEEEEEEcccccHHHHHHccccccccccccccccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccHHHHHHHHccHHHHHHHccccccHHHHHHHccc
ccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHcccHHHHHHHHHHcccccccccEEEEEEEEEccccHHHHHHcccccccccEEcccEEEcccEEEEEEEEEEcEEEcccccccccccccccEEEcccHHccccccccHHcccccccHHcccccccEccccHHHHHHHHHHHHHHHHHHHHccccccEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccccccEEEEEEEEcccccHcHHHHHcccccccccccEEEEEEEEcccccccEEEEEcccHHHHHHHcccccccccHHHHccc
mkrrkewdslsarqkrtdgasgnsvvegdfavgtspnvsppnnlkaELTKWTLESRISKNHVSSLLRslrpyhpqlpqdyrtllgtptlvdsieemnpvsavcsryprikhficdtpakgyllnikgHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAklrdstkdddqfhrgptplqhlfgfniiknvpldYMHLVCLGIMKKLLVLwqrpkmnhllpafkIDAMSDRLLEMKkftnndkmqlnqHTWLDLVACgkeisfmwcpshcgisgneavdvaaknpspsfpplklcsasdykpLIKKIVQRNWqsswnsvpngnklksikpniekwpssnrktrLEEVVLTRMRightrlthsylfsrspqptcrcpefivqkidtteltsetqISLKWNREVLVLAGshangtnkklsslvc
mkrrkewdslsarqkrtdgasgnsvVEGDFAvgtspnvsppnnLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLRDSTKDDDQFHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRnwqsswnsvpngnklksikpniekwpssnrktrleeVVLTRmrightrlthsylfsrspqptcRCPEFIVQKIDtteltsetqislKWNREVLVLagshangtnkklsslvc
MKRRKEWDSLSARQKRTDGASGNSVVEGDFAVGTSPNVSPPNNLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLRDSTKDDDQFHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLKWNREVLVLAGSHANGTNKKLSSLVC
*************************************************KWTLE*******VSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLR***********GPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVA**********LKLCSASDYKPLIKKIVQRNWQSSWNS*************************LEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLKWNREVLVLAG***************
***********AR***********VVEGDFAVGTSPNVSPPNNLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLRDSTKDDDQFHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLK**********SHANGTNKKLSSLVC
**********************NSVVEGDFAVGTSPNVSPPNNLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLR********FHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLKWNREVLVLAGSHANGTNKKLSSLVC
***********************************P**SPPNNLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLRDSTKDDDQFHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLKWNREVLVLAGSHA****K*L****C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRRKEWDSLSARQKRTDGASGNSVVEGDFAVGTSPNVSPPNNLKAELTKWTLESRISKNHVSSLLRSLRPYHPQLPQDYRTLLGTPTLVDSIEEMNPVSAVCSRYPRIKHFICDTPAKGYLLNIKGHTGFSFIVAHAAKLRDSTVKMQEHFIFQILQLQGYLLNIKGHTGFNFIVAHAAKLRDSTKDDDQFHRGPTPLQHLFGFNIIKNVPLDYMHLVCLGIMKKLLVLWQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYLFSRSPQPTCRCPEFIVQKIDTTELTSETQISLKWNREVLVLAGSHANGTNKKLSSLVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query442
443694523364 hypothetical protein CAPTEDRAFT_227708 [ 0.244 0.296 0.425 1e-19
443721618471 hypothetical protein CAPTEDRAFT_200496, 0.278 0.261 0.457 6e-19
443733872400 hypothetical protein CAPTEDRAFT_197082 [ 0.257 0.285 0.427 8e-19
328706409 1275 PREDICTED: hypothetical protein LOC10057 0.466 0.161 0.291 9e-19
443682433 619 hypothetical protein CAPTEDRAFT_222606 [ 0.257 0.184 0.426 1e-18
443694031 574 hypothetical protein CAPTEDRAFT_227918 [ 0.246 0.189 0.446 2e-18
443693558502 hypothetical protein CAPTEDRAFT_189741, 0.269 0.237 0.442 1e-17
443695973261 hypothetical protein CAPTEDRAFT_23017, p 0.269 0.455 0.442 2e-17
443712830397 hypothetical protein CAPTEDRAFT_202466 [ 0.269 0.299 0.426 2e-16
443730613233 hypothetical protein CAPTEDRAFT_206814 [ 0.264 0.502 0.406 2e-16
>gi|443694523|gb|ELT95634.1| hypothetical protein CAPTEDRAFT_227708 [Capitella teleta] Back     alignment and taxonomy information
 Score =  103 bits (258), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 69/127 (54%), Gaps = 19/127 (14%)

Query: 274 LVACGKEISFMWCPSHCGISGNEAVDVAAKN---------PSPSFPPLKLCSASDYKPLI 324
           L    K I F+WCPSH GI GNE  D  AK          P P          +D+KP+ 
Sbjct: 59  LAGRDKRIIFIWCPSHVGIPGNETADTLAKQALGMNILNCPIPH---------TDFKPIT 109

Query: 325 KKIVQRNWQSSWNSVPNGNKLKSIKPNIEKWPSSNRKTRLEEVVLTRMRIGHTRLTHSYL 384
           +  V+  WQS W+    GNKL  I+P+I  WP   R+ R EE+V+ R+RIGHT LTHS+L
Sbjct: 110 RSFVKTQWQSEWDQ-ETGNKLHDIQPDIGSWPPCQREKRREEIVIARVRIGHTFLTHSHL 168

Query: 385 FSRSPQP 391
            S +  P
Sbjct: 169 LSGNDAP 175




Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota

>gi|443721618|gb|ELU10867.1| hypothetical protein CAPTEDRAFT_200496, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|443733872|gb|ELU18078.1| hypothetical protein CAPTEDRAFT_197082 [Capitella teleta] Back     alignment and taxonomy information
>gi|328706409|ref|XP_003243087.1| PREDICTED: hypothetical protein LOC100575512 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|443682433|gb|ELT87030.1| hypothetical protein CAPTEDRAFT_222606 [Capitella teleta] Back     alignment and taxonomy information
>gi|443694031|gb|ELT95266.1| hypothetical protein CAPTEDRAFT_227918 [Capitella teleta] Back     alignment and taxonomy information
>gi|443693558|gb|ELT94903.1| hypothetical protein CAPTEDRAFT_189741, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|443695973|gb|ELT96755.1| hypothetical protein CAPTEDRAFT_23017, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|443712830|gb|ELU05953.1| hypothetical protein CAPTEDRAFT_202466 [Capitella teleta] Back     alignment and taxonomy information
>gi|443730613|gb|ELU16038.1| hypothetical protein CAPTEDRAFT_206814 [Capitella teleta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query442
cd09276128 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom 1e-08
pfam00075126 pfam00075, RNase_H, RNase H 3e-05
>gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases Back     alignment and domain information
 Score = 53.0 bits (128), Expect = 1e-08
 Identities = 13/35 (37%), Positives = 16/35 (45%)

Query: 269 HTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAK 303
               +L   G ++   W P H GI GNE  D  AK
Sbjct: 90  KAIRELANHGVKVRLHWVPGHSGIEGNERADRLAK 124


Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128

>gnl|CDD|215695 pfam00075, RNase_H, RNase H Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 442
PF00075132 RNase_H: RNase H; InterPro: IPR002156 The RNase H 98.2
PRK08719147 ribonuclease H; Reviewed 98.16
PRK00203150 rnhA ribonuclease H; Reviewed 97.99
PRK06548161 ribonuclease H; Provisional 97.87
COG0328154 RnhA Ribonuclease HI [DNA replication, recombinati 97.59
cd06222130 RnaseH RNase H (RNase HI) is an endonuclease that 97.39
KOG3752|consensus371 96.86
PF02992226 Transposase_21: Transposase family tnp2; InterPro: 94.16
PF1396686 zf-RVT: zinc-binding in reverse transcriptase 88.69
PRK13907128 rnhA ribonuclease H; Provisional 82.92
>PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site Back     alignment and domain information
Probab=98.20  E-value=3.1e-07  Score=79.93  Aligned_cols=31  Identities=39%  Similarity=0.795  Sum_probs=28.5

Q ss_pred             hccceeEEEeccCCCCC-CCChHHHHHhcCCC
Q psy10399        276 ACGKEISFMWCPSHCGI-SGNEAVDVAAKNPS  306 (442)
Q Consensus       276 ~~~~~I~l~WIPgH~gI-~GNE~AD~lAK~A~  306 (442)
                      ..+..|.|.|||||+|+ .|||.||++||+|+
T Consensus       100 ~~~~~v~~~~V~~H~~~~~~N~~aD~lAk~a~  131 (132)
T PF00075_consen  100 SRGIKVRFRWVPGHSGVPQGNERADRLAKEAA  131 (132)
T ss_dssp             HHSSEEEEEESSSSSSSHHHHHHHHHHHHHHH
T ss_pred             ccceEEeeeeccCcCCCchhHHHHHHHHHHhc
Confidence            66899999999999999 69999999999764



This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids. The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D ....

>PRK08719 ribonuclease H; Reviewed Back     alignment and domain information
>PRK00203 rnhA ribonuclease H; Reviewed Back     alignment and domain information
>PRK06548 ribonuclease H; Provisional Back     alignment and domain information
>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner Back     alignment and domain information
>KOG3752|consensus Back     alignment and domain information
>PF02992 Transposase_21: Transposase family tnp2; InterPro: IPR004242 This family includes a En/Spm-like transposable element, Tdc1 from carrot [] Back     alignment and domain information
>PF13966 zf-RVT: zinc-binding in reverse transcriptase Back     alignment and domain information
>PRK13907 rnhA ribonuclease H; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query442
3qio_A150 GAG-POL polyprotein; RNAse H, inhibitor, nuclease, 98.38
2kq2_A147 Ribonuclease H-related protein; PSI, NESG, protein 98.32
3h08_A146 RNH (ribonuclease H); RNAse H, 3D-structure, endon 98.17
3p1g_A165 Xenotropic murine leukemia virus-related virus (X 98.1
2qkb_A154 Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy 98.08
1jl1_A155 Ribonuclease HI; RNAse HI, protein stability, ther 98.03
2e4l_A158 Ribonuclease HI, RNAse HI; hydrolase, endoribonucl 98.02
1ril_A166 Ribonuclease H; hydrolase(endoribonuclease); 2.80A 97.82
1mu2_A555 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym 97.74
2lsn_A165 Reverse transcriptase; RNAse H, viral protein; NMR 97.69
2zd1_A557 Reverse transcriptase/ribonuclease H; P51/P66, het 97.56
3hst_B141 Protein RV2228C/MT2287; ribonuclease H1, RV2228C N 95.95
3u3g_D140 Ribonuclease H, RNAse H1; hydrolase, cleave the RN 95.65
2ehg_A149 Ribonuclease HI; RNAse HI, hyperthermophilic archa 94.87
>3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A Back     alignment and structure
Probab=98.38  E-value=1.2e-07  Score=84.71  Aligned_cols=33  Identities=30%  Similarity=0.526  Sum_probs=29.7

Q ss_pred             hccceeEEEeccCCCCCCCChHHHHHhcCCCCC
Q psy10399        276 ACGKEISFMWCPSHCGISGNEAVDVAAKNPSPS  308 (442)
Q Consensus       276 ~~~~~I~l~WIPgH~gI~GNE~AD~lAK~A~~~  308 (442)
                      .+...|+|.|||||+|++|||.||++|++|+..
T Consensus       115 ~~~~~v~~~wV~gH~g~~~Ne~AD~LA~~a~~~  147 (150)
T 3qio_A          115 IKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK  147 (150)
T ss_dssp             TTCSEEEEEECCTTSCCHHHHHHHHHHHTTTSC
T ss_pred             hhcCceEEEEccCcCCChhHHHHHHHHHHHHHH
Confidence            356789999999999999999999999999754



>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Back     alignment and structure
>3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} Back     alignment and structure
>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A Back     alignment and structure
>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Back     alignment and structure
>1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... Back     alignment and structure
>2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A Back     alignment and structure
>1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A Back     alignment and structure
>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Back     alignment and structure
>2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} Back     alignment and structure
>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... Back     alignment and structure
>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} Back     alignment and structure
>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query442
d1jl1a_152 RNase H (RNase HI) {Escherichia coli [TaxId: 562]} 98.59
d1mu2a1126 HIV RNase H (Domain of reverse transcriptase) {Hum 98.54
d1rila_147 RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 98.47
>d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Ribonuclease H
domain: RNase H (RNase HI)
species: Escherichia coli [TaxId: 562]
Probab=98.59  E-value=2.7e-09  Score=91.99  Aligned_cols=32  Identities=25%  Similarity=0.446  Sum_probs=28.7

Q ss_pred             ccceeEEEeccCCCCCCCChHHHHHhcCCCCC
Q psy10399        277 CGKEISFMWCPSHCGISGNEAVDVAAKNPSPS  308 (442)
Q Consensus       277 ~~~~I~l~WIPgH~gI~GNE~AD~lAK~A~~~  308 (442)
                      ....|+|+|||||+|++|||.||+|||+|+..
T Consensus       110 ~~~~V~~~wV~gH~g~~gNe~AD~LAk~aa~~  141 (152)
T d1jl1a_         110 GQHQIKWEWVKGHAGHPENERADELARAAAMN  141 (152)
T ss_dssp             TTCEEEEEECCSSTTCHHHHHHHHHHHHHHHS
T ss_pred             hcceeEEEEecccCCCccHHHHHHHHHHHHhC
Confidence            34579999999999999999999999999753



>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure