Psyllid ID: psy10805


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---
MSSDHQTSTNSSFDLDSEGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKKD
ccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEccEEEcccHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHcccccc
cccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHHHHHccccEEEEEccccccccccccEEEEEEccEEEccHHHHHHHHHHcccEEEEcccccHHccHHHHcccccccHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHcccc
mssdhqtstnssfdldsegviiGTKKIYMHLLHVVFIffpareiwpddvklyqpyeveqillpdnAHCLAVQAYLKMLGLKYTVdfrknaeymspsnrvpfikvGQFLVAELDPivkftqnknyitwcdpttyrevtkvrhgavapwplniyLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLeknnfffkdkptELDALLFGHIYAvlttplpnnrfastirayPNLVEHCTRIEQTYFKKD
mssdhqtstnssfdldseGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKftqnknyitwcdPTTYREVTKVrhgavapwplnIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKKD
MSSDHQTSTNSSFDLDSEGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKKD
*****************EGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYF***
*********************IGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKK*
*************DLDSEGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKKD
************FDLDSEGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDHQTSTNSSFDLDSEGVIIGTKKIYMHLLHVVFIFFPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKNYITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTYFKKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query253 2.2.26 [Sep-21-2011]
Q2L969267 Metaxin-2 OS=Sus scrofa G yes N/A 0.881 0.835 0.443 6e-58
O75431263 Metaxin-2 OS=Homo sapiens yes N/A 0.881 0.847 0.443 6e-58
O88441263 Metaxin-2 OS=Mus musculus yes N/A 0.881 0.847 0.439 6e-57
P34599230 Metaxin-2 homolog OS=Caen no N/A 0.707 0.778 0.327 9e-28
P47802317 Metaxin-1 OS=Mus musculus no N/A 0.501 0.400 0.323 5e-14
Q4VBW0313 Metaxin-3 OS=Danio rerio no N/A 0.490 0.396 0.307 4e-13
Q27HK4317 Metaxin-1 OS=Sus scrofa G no N/A 0.490 0.391 0.307 3e-12
A8XWD1312 Metaxin-1 homolog OS=Caen N/A N/A 0.466 0.378 0.344 3e-12
Q4R3I0317 Metaxin-1 OS=Macaca fasci N/A N/A 0.501 0.400 0.315 7e-12
O45503312 Metaxin-1 homolog OS=Caen no N/A 0.466 0.378 0.336 9e-12
>sp|Q2L969|MTX2_PIG Metaxin-2 OS=Sus scrofa GN=MTX2 PE=2 SV=1 Back     alignment and function desciption
 Score =  224 bits (570), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 151/255 (59%), Gaps = 32/255 (12%)

Query: 29  MHLLHVVFIF-FPAREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFR 87
           M L+   F+    A E WP++  LYQ  + EQILL DNA  LAVQA+L+M  L   V  R
Sbjct: 1   MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCR 60

Query: 88  KNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQNKN------------------------ 123
            NAEYMSPS +VPFI VG  +V+EL PIV+F + K                         
Sbjct: 61  ANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLDEVQKAEMKAYMELVNN 120

Query: 124 -------YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLD 176
                  Y+ WCD  T  E+T  R+G+  PWPLN  L Y+K+  V+ ++K + W  K+LD
Sbjct: 121 MLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLD 180

Query: 177 QVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYP 236
           QV +DVD+CCQ+LS+RL    +FF  +PTELDAL+FGH+Y +LTT L N+  +  ++ Y 
Sbjct: 181 QVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYS 240

Query: 237 NLVEHCTRIEQTYFK 251
           NL+  C RIEQ YF+
Sbjct: 241 NLLAFCRRIEQHYFE 255




Involved in transport of proteins into the mitochondrion.
Sus scrofa (taxid: 9823)
>sp|O75431|MTX2_HUMAN Metaxin-2 OS=Homo sapiens GN=MTX2 PE=1 SV=1 Back     alignment and function description
>sp|O88441|MTX2_MOUSE Metaxin-2 OS=Mus musculus GN=Mtx2 PE=1 SV=1 Back     alignment and function description
>sp|P34599|MTX2_CAEEL Metaxin-2 homolog OS=Caenorhabditis elegans GN=mtx-2 PE=2 SV=3 Back     alignment and function description
>sp|P47802|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1 Back     alignment and function description
>sp|Q4VBW0|MTX3_DANRE Metaxin-3 OS=Danio rerio GN=mtx3 PE=2 SV=2 Back     alignment and function description
>sp|Q27HK4|MTX1_PIG Metaxin-1 OS=Sus scrofa GN=MTX1 PE=2 SV=1 Back     alignment and function description
>sp|A8XWD1|MTX1_CAEBR Metaxin-1 homolog OS=Caenorhabditis briggsae GN=mtx-1 PE=3 SV=1 Back     alignment and function description
>sp|Q4R3I0|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1 Back     alignment and function description
>sp|O45503|MTX1_CAEEL Metaxin-1 homolog OS=Caenorhabditis elegans GN=mtx-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
321468529272 hypothetical protein DAPPUDRAFT_304425 [ 0.837 0.779 0.514 3e-68
91085775259 PREDICTED: similar to metaxin 2 [Triboli 0.889 0.868 0.492 1e-67
270009997312 hypothetical protein TcasGA2_TC009327 [T 0.964 0.782 0.458 8e-67
340724770265 PREDICTED: metaxin-2-like [Bombus terres 0.833 0.796 0.497 2e-63
307194092314 Metaxin-2 [Harpegnathos saltator] 0.920 0.742 0.467 4e-63
350422096251 PREDICTED: metaxin-2-like, partial [Bomb 0.830 0.836 0.5 6e-63
328786562265 PREDICTED: metaxin-2-like isoform 1 [Api 0.833 0.796 0.493 8e-63
307165881275 Metaxin-2 [Camponotus floridanus] 0.830 0.763 0.510 3e-61
328786564305 PREDICTED: metaxin-2-like isoform 2 [Api 0.837 0.695 0.479 2e-60
380028249 356 PREDICTED: metaxin-2-like [Apis florea] 0.837 0.595 0.475 3e-60
>gi|321468529|gb|EFX79513.1| hypothetical protein DAPPUDRAFT_304425 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 163/243 (67%), Gaps = 31/243 (12%)

Query: 41  AREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVP 100
           A E WP DVKLYQPYEVEQILL D A+ LAVQ +L+M GL++ V+ R NAE+MSPS ++P
Sbjct: 16  ALEPWPSDVKLYQPYEVEQILLQDQANSLAVQVFLRMCGLEFQVEMRSNAEHMSPSGKLP 75

Query: 101 FIKVGQFLVAELDPIVKFTQNKN-------------------------------YITWCD 129
           FIK G F+VA+LDP+V F  NK                                YI+WCD
Sbjct: 76  FIKCGAFVVADLDPVVSFVSNKGINLTDHLDAAQKADMRAYMSLANNILGNAELYISWCD 135

Query: 130 PTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSL 189
            T   EVT  R+G+V  WPLN  LT++K+  V  +L  L W+ K+LD+VY+DVD CC +L
Sbjct: 136 ETVLNEVTGPRYGSVYSWPLNTLLTWRKQKQVAKKLTALGWITKTLDEVYEDVDHCCNAL 195

Query: 190 SERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTY 249
           SERL  + +FF D+ TELDA++FGH++ +LTTPLP+NR AS +R+YPNLVE C  +E+TY
Sbjct: 196 SERLGNHLYFFNDRCTELDAVVFGHVFTLLTTPLPDNRLASIVRSYPNLVEACQFLEKTY 255

Query: 250 FKK 252
           F+K
Sbjct: 256 FQK 258




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91085775|ref|XP_974308.1| PREDICTED: similar to metaxin 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270009997|gb|EFA06445.1| hypothetical protein TcasGA2_TC009327 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340724770|ref|XP_003400754.1| PREDICTED: metaxin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307194092|gb|EFN76553.1| Metaxin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350422096|ref|XP_003493055.1| PREDICTED: metaxin-2-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|328786562|ref|XP_001122107.2| PREDICTED: metaxin-2-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307165881|gb|EFN60236.1| Metaxin-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328786564|ref|XP_003250813.1| PREDICTED: metaxin-2-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380028249|ref|XP_003697819.1| PREDICTED: metaxin-2-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query253
UNIPROTKB|O75431263 MTX2 "Metaxin-2" [Homo sapiens 0.505 0.486 0.492 1.3e-55
UNIPROTKB|Q2L969267 MTX2 "Metaxin-2" [Sus scrofa ( 0.505 0.479 0.492 1.6e-55
RGD|1306473263 Mtx2 "metaxin 2" [Rattus norve 0.505 0.486 0.492 2e-55
UNIPROTKB|Q8IZ68253 MTX2 "Metaxin-2" [Homo sapiens 0.505 0.505 0.492 2e-55
UNIPROTKB|A6QLL2264 MTX2 "MTX2 protein" [Bos tauru 0.509 0.488 0.488 2.6e-55
UNIPROTKB|E2RML8267 MTX2 "Uncharacterized protein" 0.505 0.479 0.492 2.6e-55
MGI|MGI:1859652263 Mtx2 "metaxin 2" [Mus musculus 0.505 0.486 0.484 1.1e-54
UNIPROTKB|E1BVN1268 MTX2 "Uncharacterized protein" 0.505 0.477 0.468 9.9e-54
FB|FBgn0036920269 CG8004 [Drosophila melanogaste 0.529 0.498 0.394 1.3e-49
UNIPROTKB|C9JAZ1229 MTX2 "Metaxin-2" [Homo sapiens 0.853 0.943 0.445 5.2e-42
UNIPROTKB|O75431 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 1.3e-55, Sum P(2) = 1.3e-55
 Identities = 63/128 (49%), Positives = 90/128 (70%)

Query:   124 YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 183
             Y+ WCD  T  E+T  R+G+  PWPLN  L Y+K+  V+ ++K + W +K+LDQV +DVD
Sbjct:   128 YLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLDQVLEDVD 187

Query:   184 KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 243
             +CCQ+LS+RL    +FF  +PTELDAL+FGH+Y +LTT L N+  +  ++ Y NL+  C 
Sbjct:   188 QCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCR 247

Query:   244 RIEQTYFK 251
             RIEQ YF+
Sbjct:   248 RIEQHYFE 255


GO:0005741 "mitochondrial outer membrane" evidence=IEA
GO:0006839 "mitochondrial transport" evidence=TAS
GO:0006626 "protein targeting to mitochondrion" evidence=TAS
GO:0044267 "cellular protein metabolic process" evidence=TAS
UNIPROTKB|Q2L969 MTX2 "Metaxin-2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1306473 Mtx2 "metaxin 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IZ68 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLL2 MTX2 "MTX2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RML8 MTX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1859652 Mtx2 "metaxin 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVN1 MTX2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0036920 CG8004 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|C9JAZ1 MTX2 "Metaxin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2L969MTX2_PIGNo assigned EC number0.44310.88140.8352yesN/A
O75431MTX2_HUMANNo assigned EC number0.44310.88140.8479yesN/A
O88441MTX2_MOUSENo assigned EC number0.43920.88140.8479yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
cd03211126 cd03211, GST_C_Metaxin2, C-terminal, alpha helical 2e-63
cd0307974 cd03079, GST_N_Metaxin2, GST_N family, Metaxin sub 2e-33
cd03212137 cd03212, GST_C_Metaxin1_3, C-terminal, alpha helic 2e-28
cd0319388 cd03193, GST_C_Metaxin, C-terminal, alpha helical 1e-19
cd0305472 cd03054, GST_N_Metaxin, GST_N family, Metaxin subf 3e-14
pfam11801155 pfam11801, Tom37_C, Tom37 C-terminal domain 4e-06
cd0307873 cd03078, GST_N_Metaxin1_like, GST_N family, Metaxi 5e-05
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 1e-04
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 3e-04
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 6e-04
>gnl|CDD|198320 cd03211, GST_C_Metaxin2, C-terminal, alpha helical domain of Metaxin 2 Back     alignment and domain information
 Score =  194 bits (494), Expect = 2e-63
 Identities = 74/123 (60%), Positives = 96/123 (78%)

Query: 124 YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVD 183
           YI+WCD  TY EVTK R+G+V PWPLN  L Y+K+  V  +LK L W +KSLDQV+ +V+
Sbjct: 4   YISWCDEETYNEVTKPRYGSVYPWPLNHILAYRKQREVLRKLKALGWSDKSLDQVFDEVE 63

Query: 184 KCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCT 243
           KCCQ+LSE+L  N +FF D+PTELDAL+FGH++ +LTTPLPN+  A+ ++ YPNLVE C 
Sbjct: 64  KCCQALSEKLGTNQYFFGDQPTELDALVFGHLFTILTTPLPNDELAAIVKKYPNLVEFCR 123

Query: 244 RIE 246
           RIE
Sbjct: 124 RIE 126


Glutathione S-transferase (GST) C-terminal domain family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait. Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury. Length = 126

>gnl|CDD|239377 cd03079, GST_N_Metaxin2, GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>gnl|CDD|198321 cd03212, GST_C_Metaxin1_3, C-terminal, alpha helical domain of Metaxin 1, Metaxin 3, and similar proteins Back     alignment and domain information
>gnl|CDD|198302 cd03193, GST_C_Metaxin, C-terminal, alpha helical domain of Metaxin and related proteins Back     alignment and domain information
>gnl|CDD|239352 cd03054, GST_N_Metaxin, GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>gnl|CDD|221231 pfam11801, Tom37_C, Tom37 C-terminal domain Back     alignment and domain information
>gnl|CDD|239376 cd03078, GST_N_Metaxin1_like, GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 253
KOG3027|consensus257 100.0
KOG4244|consensus281 99.97
PLN02473214 glutathione S-transferase 99.94
PRK09481211 sspA stringent starvation protein A; Provisional 99.94
PRK10387210 glutaredoxin 2; Provisional 99.93
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.93
KOG3028|consensus313 99.93
KOG0406|consensus231 99.92
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.92
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.92
PLN02378213 glutathione S-transferase DHAR1 99.92
PLN02395215 glutathione S-transferase 99.92
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.91
PRK11752264 putative S-transferase; Provisional 99.91
PRK10357202 putative glutathione S-transferase; Provisional 99.91
PRK15113214 glutathione S-transferase; Provisional 99.91
PRK10542201 glutathionine S-transferase; Provisional 99.91
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.91
PTZ00057205 glutathione s-transferase; Provisional 99.9
PLN02817265 glutathione dehydrogenase (ascorbate) 99.9
KOG0868|consensus217 99.87
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 99.87
KOG0867|consensus226 99.86
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 99.85
KOG4420|consensus325 99.83
KOG1695|consensus206 99.76
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.74
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 99.74
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.72
KOG3029|consensus370 99.69
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.68
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.67
PLN02907 722 glutamate-tRNA ligase 99.67
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.67
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.66
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.64
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.64
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.63
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.63
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.62
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.62
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 99.62
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.61
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.6
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.6
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.58
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.58
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.57
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.56
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.56
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.56
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.55
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.55
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.53
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.53
KOG1422|consensus221 99.52
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.52
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.52
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.52
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.5
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.49
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.48
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.44
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.37
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.35
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 99.34
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 99.26
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.25
PF1056872 Tom37: Outer mitochondrial membrane transport comp 99.24
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.19
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.1
KOG2903|consensus319 99.08
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 99.07
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.05
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.05
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.05
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.04
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.02
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.02
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.02
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.01
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.0
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.0
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.98
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 98.96
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.95
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.93
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 98.93
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.92
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.91
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.9
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.9
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.89
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 98.88
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 98.88
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 98.87
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 98.87
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 98.86
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 98.85
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 98.85
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 98.84
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.77
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 98.68
PRK1063883 glutaredoxin 3; Provisional 98.66
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 98.64
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.61
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 98.6
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 98.57
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.53
PRK1032981 glutaredoxin-like protein; Provisional 98.39
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.37
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.28
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.26
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.18
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.11
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.11
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.01
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 97.97
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.92
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 97.91
PRK1120085 grxA glutaredoxin 1; Provisional 97.89
PHA03050108 glutaredoxin; Provisional 97.84
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.8
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.73
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 97.73
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 97.5
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 97.38
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 97.35
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 96.94
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 96.81
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 96.55
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 96.54
KOG1752|consensus104 96.48
PRK10824115 glutaredoxin-4; Provisional 96.38
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 96.08
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 96.0
PRK01655131 spxA transcriptional regulator Spx; Reviewed 95.36
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 95.34
PTZ00062204 glutaredoxin; Provisional 95.3
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 95.26
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 95.2
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 95.13
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 95.05
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 94.51
PRK12559131 transcriptional regulator Spx; Provisional 94.4
PRK13344132 spxA transcriptional regulator Spx; Reviewed 94.13
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 91.99
PRK10026141 arsenate reductase; Provisional 91.86
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 91.68
PRK10853118 putative reductase; Provisional 91.54
COG1393117 ArsC Arsenate reductase and related proteins, glut 91.52
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 91.37
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 90.01
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 89.64
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 88.54
COG454585 Glutaredoxin-related protein [Posttranslational mo 88.47
PF11287112 DUF3088: Protein of unknown function (DUF3088); In 86.43
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 86.09
KOG1147|consensus 712 83.42
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 81.27
>KOG3027|consensus Back     alignment and domain information
Probab=100.00  E-value=3.5e-34  Score=221.81  Aligned_cols=212  Identities=52%  Similarity=0.986  Sum_probs=198.3

Q ss_pred             CCCCCCCCceeeccccccccCCCCCchHHHHHHHHHhcCCCeEEEecCCCCCCCCCCCcceEEeCCEEecChhhHHHHHh
Q psy10805         41 AREIWPDDVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKNAEYMSPSNRVPFIKVGQFLVAELDPIVKFTQ  120 (253)
Q Consensus        41 ~~~~~~~~~~l~~~~~~~~~~~~~sp~~~kv~~~L~~~gipye~~~~~~~~~~~P~gkvP~L~~~g~~l~eS~aI~~YL~  120 (253)
                      ..++||+|++||+|+.+...+++....|+.|+++|+..++||.++...+.+++||.|+||.|..|.+.+.|-.+|..+..
T Consensus        10 aae~WPedatL~qp~e~eQiLl~d~ascLAVqtfLrMcnLPf~v~~~~NaefmSP~G~vPllr~g~~~~aef~pIV~fVe   89 (257)
T KOG3027|consen   10 AAEPWPEDATLYQPYEAEQILLPDNASCLAVQTFLRMCNLPFNVRQRANAEFMSPGGKVPLLRIGKTLFAEFEPIVDFVE   89 (257)
T ss_pred             ccCCCCccchhcCcccccccccccchhHHHHHHHHHHcCCCceeeecCCccccCCCCCCceeeecchhhhhhhHHHHHHH
Confidence            36889999999999999999999999999999999999999999988888899999999999999999999999999998


Q ss_pred             hcC-------------------------------eeeeccCcchHHHhhhhhcCCCCchhHHHhhHHHHHHHHHHhhhcC
Q psy10805        121 NKN-------------------------------YITWCDPTTYREVTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLK  169 (253)
Q Consensus       121 ~~~-------------------------------~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  169 (253)
                      .+.                               +-.|.++.+|.+++..+++..+|||++.++++..++.+.+.++..+
T Consensus        90 ak~~~l~s~lsE~qkadmra~vslVen~~t~aEl~~s~~de~ty~~vT~~R~gs~ypWPLs~i~~f~Krr~~~r~lk~~~  169 (257)
T KOG3027|consen   90 AKGVTLTSWLSEDQKADMRAYVSLVENLLTTAELYVSWNDEETYDEVTALRYGSVYPWPLSHILPFVKRRKALRELKVYD  169 (257)
T ss_pred             HhccchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHHhhhccCCCCCCcHHHHHHHHHHHHHHHHHhhcC
Confidence            875                               6678888888888888899999999999999988888888888888


Q ss_pred             cCCCCHHHHHHHHHHHHHHHHhhhCCCCcccCCCCChhhHHHHHHHHHHhcCCCCChhHHHHHhcChhHHHHHHHHHhcc
Q psy10805        170 WLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQTY  249 (253)
Q Consensus       170 ~~~~~~~~~~~~~~~~l~~Le~~L~~~~fl~Gd~~t~aD~~~~~~l~~~~~~~~~~~~l~~~l~~~p~L~~~~~ri~~r~  249 (253)
                      ++..+.+++.+++.++.++|+.+|+.++||.|++||-+|+.+||++..++...+|+..+...++.|+||.++++||.+.|
T Consensus       170 W~~~~~DqVie~vdkc~~aLsa~L~~q~yf~g~~P~elDAlvFGHlytilTt~Lpn~ela~~lkkys~LlefcrrIeq~y  249 (257)
T KOG3027|consen  170 WDDKTMDQVIEQVDKCCRALSAQLGSQPYFTGDQPTELDALVFGHLYTILTTRLPNMELANILKKYSNLLEFCRRIEQQY  249 (257)
T ss_pred             cccccHHHHHHHHHHHHHHHHHHhcCCCccCCCCccHHHHHHHhhhHHhhhhcCCcHHHHHHHHHhHHHHHHHHHHHHHH
Confidence            88889999999999999999999999999999999999999999999999888888888889999999999999999999


Q ss_pred             CCC
Q psy10805        250 FKK  252 (253)
Q Consensus       250 ~~~  252 (253)
                      |.+
T Consensus       250 F~~  252 (257)
T KOG3027|consen  250 FKQ  252 (257)
T ss_pred             HHh
Confidence            864



>KOG4244|consensus Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query253
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 2e-04
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 3e-04
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 5e-04
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
 Score = 40.6 bits (95), Expect = 2e-04
 Identities = 26/172 (15%), Positives = 44/172 (25%), Gaps = 39/172 (22%)

Query: 95  PSNRVPFIKVGQFLVAELDPIVKFTQNK--------NYITWCDPTTYREVTKVRHGAVAP 146
               +P+   G   + +   I+++  +K                             V+ 
Sbjct: 51  EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEIS--MLEGAVLDIRYGVSR 108

Query: 147 WPLNIYLTYKKKLTVQHRLKTLKWLEKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTE 206
              +      K   +    + LK  E                   RL    +   D  T 
Sbjct: 109 IAYSKDFETLKVDFLSKLPEMLKMFED------------------RLCHKTYLNGDHVTH 150

Query: 207 LDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIE-----QTYFKKD 253
            D +L+  +  VL            + A+P LV    RIE       Y K  
Sbjct: 151 PDFMLYDALDVVLYM------DPMCLDAFPKLVCFKKRIEAIPQIDKYLKSS 196


>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
4glt_A225 Glutathione S-transferase-like protein; structural 99.97
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.96
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.96
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.96
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.95
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.95
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.95
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.95
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.95
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.94
3lxz_A229 Glutathione S-transferase family protein; structur 99.94
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.94
3lyp_A215 Stringent starvation protein A; structural genomic 99.94
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.94
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.94
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.94
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.94
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.94
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.94
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.94
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.94
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.94
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.94
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.94
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.94
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.94
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.94
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.94
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.94
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.94
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.94
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.94
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.94
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.94
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.94
3n5o_A235 Glutathione transferase; seattle structural genomi 99.94
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.94
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.94
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.94
3lyk_A216 Stringent starvation protein A homolog; structural 99.94
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.94
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.93
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.93
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.93
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.93
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.93
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.93
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.93
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.93
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.93
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.93
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.93
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.93
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.93
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.93
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.93
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.93
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.93
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.93
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.93
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.93
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.93
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.93
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.93
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.93
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.93
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.93
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.93
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.93
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.93
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.93
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.93
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.93
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.93
4dej_A231 Glutathione S-transferase related protein; transfe 99.93
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.93
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.92
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.92
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.92
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.92
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.92
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.92
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.92
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.92
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.92
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.92
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.92
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.92
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.92
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.92
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.92
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.92
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.92
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.92
4exj_A238 Uncharacterized protein; transferase-like protein, 99.91
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.91
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.91
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.91
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.9
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.9
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.9
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.89
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.89
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.89
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.88
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.86
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.86
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.85
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.83
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.81
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.81
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.78
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.66
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.61
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.85
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 98.8
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.67
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.63
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.52
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.42
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.33
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 98.32
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.27
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.17
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.17
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.07
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.07
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.97
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 97.83
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 97.72
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 97.68
1kte_A105 Thioltransferase; redox-active center, electron tr 97.67
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 97.65
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.65
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 97.58
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.53
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 97.52
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 97.47
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 97.46
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 97.43
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 97.41
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 97.4
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 97.33
1z3e_A132 Regulatory protein SPX; bacterial transcription re 97.32
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 97.31
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.3
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 97.13
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 97.13
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 96.29
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 96.13
3l78_A120 Regulatory protein SPX; transcription, transcripti 95.98
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 95.97
3rdw_A121 Putative arsenate reductase; structural genomics, 95.92
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 95.84
3gkx_A120 Putative ARSC family related protein; ARSC family 95.79
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 95.75
3fz4_A120 Putative arsenate reductase; APC61768, structural 95.67
1ttz_A87 Conserved hypothetical protein; structural genomic 95.6
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 95.54
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 95.38
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 95.2
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 95.15
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 94.28
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 94.03
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 83.34
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
Probab=99.97  E-value=1.4e-30  Score=213.57  Aligned_cols=181  Identities=10%  Similarity=0.090  Sum_probs=123.5

Q ss_pred             CceeeccccccccCCCCCchHHHHHHHHHhcCCCeEEEecCC------CCCCCCCCCcceEEe-CCEEecChhhHHHHHh
Q psy10805         48 DVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKN------AEYMSPSNRVPFIKV-GQFLVAELDPIVKFTQ  120 (253)
Q Consensus        48 ~~~l~~~~~~~~~~~~~sp~~~kv~~~L~~~gipye~~~~~~------~~~~~P~gkvP~L~~-~g~~l~eS~aI~~YL~  120 (253)
                      .++||..        +.||||+||+++|+++||+||.+.++.      +...||.|+||+|++ ||.+|+||.+|++||+
T Consensus        22 ~MKLy~~--------~~SP~~~rVr~~L~e~gi~~e~~~v~~~~~~~~~~~~nP~gkVPvL~~~dG~~l~ES~aI~~YL~   93 (225)
T 4glt_A           22 SMKLLYS--------NTSPYARKVRVVAAEKRIDVDMVLVVLADPECPVADHNPLGKIPVLILPDGESLYDSRVIVEYLD   93 (225)
T ss_dssp             CCEEEEC--------SSCHHHHHHHHHHHHHTCCCEEEECCTTCSSSCGGGTCTTCCSCEEECTTSCEECSHHHHHHHHH
T ss_pred             CceEecC--------CCCHHHHHHHHHHHHhCCCCEEEEeCCCCCCHHHHHhCCCCCCCEEEeCCCCEEeehHHHHHHHH
Confidence            6799998        899999999999999999999999973      224699999999997 6789999999999999


Q ss_pred             hcCee-eeccCcchHH-HhhhhhcCCCCchhHHHhhHHHHHHHHHHhhhcCcCCCC---HHHHHHHHHHHHHHHHhhhCC
Q psy10805        121 NKNYI-TWCDPTTYRE-VTKVRHGAVAPWPLNIYLTYKKKLTVQHRLKTLKWLEKS---LDQVYKDVDKCCQSLSERLEK  195 (253)
Q Consensus       121 ~~~~~-~w~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~l~~Le~~L~~  195 (253)
                      +++.. .+........ ..+.+.    .+ ....+..... .........  +...   .++..+.+.+.|+.||++|++
T Consensus        94 ~~~~~~~l~p~~~~~ra~~~~~~----~~-~~~~~~~~~~-~~~~~~~~~--~~~~~~~~~~~~~~~~~~l~~le~~L~~  165 (225)
T 4glt_A           94 HRTPVAHLIPQDHTAKIAVRRWE----AL-ADGVTDAAVA-AVMEGRRPE--GMQDSAVIEKQLNKVERGLRRMDQDLEK  165 (225)
T ss_dssp             TTCSSCCSSCSSHHHHHHHHHHH----HH-HHHHHHHHHH-HHHHHTSCS--SSCCHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HhCCccccCCchhHHHHHHHHHH----HH-HhcccchHHH-HHHHhhccc--cchhHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            99711 1111111111 111111    00 0000100000 111111111  1122   345567788999999999999


Q ss_pred             CCcccCCCCChhhHHHHHHHHHHhcCCCCChhHHHHHhcChhHHHHHHHHHhc
Q psy10805        196 NNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFASTIRAYPNLVEHCTRIEQT  248 (253)
Q Consensus       196 ~~fl~Gd~~t~aD~~~~~~l~~~~~~~~~~~~l~~~l~~~p~L~~~~~ri~~r  248 (253)
                      ++||+|+++|+||+++++.+..+..... .   .+..+++|+|.+|++||.+|
T Consensus       166 ~~~l~Gd~~t~ADi~l~~~l~~~~~~~~-~---~~~~~~~P~l~~w~~r~~~r  214 (225)
T 4glt_A          166 RKWCVNESFSLADIAVGCMLGYLELRYQ-H---LDWKQQYPNLARHYAAMMKR  214 (225)
T ss_dssp             CSSSSTTSCCHHHHHHHHHHHHHHHHCT-T---CCHHHHCHHHHHHHHHHHTC
T ss_pred             CCcccCCcccHhHHHHHHHHHHHHHhcC-C---CCccccCHHHHHHHHHHHCC
Confidence            9999999999999999998876533211 1   12357899999999999987



>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 253
d2gsta1133 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv 0.002
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class mu GST
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 35.3 bits (81), Expect = 0.002
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 6/76 (7%)

Query: 172 EKSLDQVYKDVDKCCQSLSERLEKNNFFFKDKPTELDALLFGHIYAVLTTPLPNNRFAST 231
           EK   +  K + +  +  SE L K  +F  DK T +D L +  +                
Sbjct: 36  EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIF------EPKC 89

Query: 232 IRAYPNLVEHCTRIEQ 247
           + A+PNL +   R E 
Sbjct: 90  LDAFPNLKDFLARFEG 105


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query253
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.79
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.79
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.79
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.78
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.76
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.76
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.76
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.76
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.76
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.75
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.74
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.73
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.73
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.72
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.7
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.69
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.68
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.67
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.67
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.65
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.65
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.64
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.63
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.63
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.61
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.59
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.58
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.57
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.5
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.5
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.48
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.41
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.36
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 99.34
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.32
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.31
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.3
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.26
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.26
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.25
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.21
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.19
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.18
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.17
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.16
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.12
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.1
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.08
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.07
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.06
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.05
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.05
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.03
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.03
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.01
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 98.95
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.93
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 98.91
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.91
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.88
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.87
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.85
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 98.81
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.75
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.73
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 98.71
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 98.63
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.56
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 98.53
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.52
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.29
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.1
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.02
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 97.41
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 97.26
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.2
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 97.16
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 96.9
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 95.61
d1wjka_100 Thioredoxin-like structure containing protein C330 93.9
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 93.79
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 93.19
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 92.11
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 92.11
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 91.58
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 88.84
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class phi GST
species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.79  E-value=6.7e-20  Score=125.00  Aligned_cols=68  Identities=16%  Similarity=0.229  Sum_probs=62.0

Q ss_pred             CceeeccccccccCCCCCchHHHHHHHHHhcCCCeEEEecCC---------CCCCCCCCCcceEEeCCEEecChhhHHHH
Q psy10805         48 DVKLYQPYEVEQILLPDNAHCLAVQAYLKMLGLKYTVDFRKN---------AEYMSPSNRVPFIKVGQFLVAELDPIVKF  118 (253)
Q Consensus        48 ~~~l~~~~~~~~~~~~~sp~~~kv~~~L~~~gipye~~~~~~---------~~~~~P~gkvP~L~~~g~~l~eS~aI~~Y  118 (253)
                      +++||+.        +.||+|+||+++|+++|++|+.+.++.         +...||.|+||+|++||.+|+||.+|++|
T Consensus         1 g~kLY~~--------~~s~~~~~v~~~l~e~gl~~e~~~v~~~~~~~~~~~~~~~nP~g~vP~L~~~~~~l~ES~aI~~Y   72 (84)
T d1gnwa2           1 GIKVFGH--------PASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY   72 (84)
T ss_dssp             CEEEEEC--------TTCHHHHHHHHHHHHTTCCCEEEECCGGGTGGGSTTGGGTCTTCCSCEEEETTEEEECHHHHHHH
T ss_pred             CeEEEeC--------CCChHHHHHHHHHHHcCCCcEeecccCCcccccHHHHHHHhhcCcceEEEECCcEEecHHHHHHH
Confidence            4789999        899999999999999999999998862         12479999999999999999999999999


Q ss_pred             HhhcC
Q psy10805        119 TQNKN  123 (253)
Q Consensus       119 L~~~~  123 (253)
                      |+++|
T Consensus        73 L~~~~   77 (84)
T d1gnwa2          73 IAHRY   77 (84)
T ss_dssp             HHHHT
T ss_pred             HHHHC
Confidence            99986



>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure