Psyllid ID: psy11043

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MALSLGENISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLEVKTQT
cccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHccc
ccHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccEEEcccccEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHccHHHHcccc
malslgenisrlapvipcpmfalptlnfTVSQVATVCETLEESGDIERLARFLWslpvahpnigelnkNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKlrgrplgpvdkyrvrkkfplprtiwdgeqkthcFKERTRSLLREWylqdpypnptkkrelaqatgltptqvgnwfknrRQRDRAAAAKNRLEVKTQT
MALSLGENISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEklrgrplgpvdkyrvrkkfplprtiwdgeqkthcFKERTRSLLREWYLQDPYPNPTKKRELaqatgltptqvgnwfknrrQRDRAAAaknrlevktqt
MALSLGENISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLEVKTQT
********ISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPY********************GNW***********************
**********************LPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMW*************************************************SLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNR*******************
MALSLGENISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNR*******************
****************PCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQR*R**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSLGENISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLEVKTQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query217 2.2.26 [Sep-21-2011]
O93307246 Homeobox protein SIX6 OS= yes N/A 0.889 0.784 0.870 1e-91
O95343332 Homeobox protein SIX3 OS= yes N/A 0.921 0.602 0.83 2e-91
Q62233333 Homeobox protein SIX3 OS= yes N/A 0.921 0.600 0.83 3e-91
O42406314 Homeobox protein SIX3 OS= no N/A 0.921 0.636 0.83 3e-91
O95475246 Homeobox protein SIX6 OS= no N/A 0.889 0.784 0.860 1e-90
Q9QZ28246 Homeobox protein SIX6 OS= no N/A 0.889 0.784 0.860 5e-90
Q95RW8 487 Protein Optix OS=Drosophi yes N/A 0.912 0.406 0.797 3e-87
O73916272 Homeobox protein SIX3 OS= N/A N/A 0.884 0.705 0.796 7e-83
Q62232 296 Homeobox protein SIX2 OS= no N/A 0.852 0.625 0.661 1e-72
Q9NPC8291 Homeobox protein SIX2 OS= no N/A 0.852 0.635 0.661 1e-72
>sp|O93307|SIX6_CHICK Homeobox protein SIX6 OS=Gallus gallus GN=SIX6 PE=2 SV=1 Back     alignment and function desciption
 Score =  335 bits (859), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 179/193 (92%)

Query: 20  MFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIV 79
           MF LP LNF+  QVA VCETLEESGDIERL RFLWSLPVA      LNKNE+VLRARAIV
Sbjct: 1   MFQLPILNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIV 60

Query: 80  SFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP 139
           +FH+GNYRE+Y ILE++KFTK+SHGKLQA+WLEAHYQEAEKLRGRPLGPVDKYRVRKKFP
Sbjct: 61  AFHTGNYRELYHILENHKFTKESHGKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP 120

Query: 140 LPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRR 199
           LPRTIWDGEQKTHCFKERTR LLREWYLQDPYPNP+KKRELAQATGLTPTQVGNWFKNRR
Sbjct: 121 LPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 180

Query: 200 QRDRAAAAKNRLE 212
           QRDRAAAAKNRL+
Sbjct: 181 QRDRAAAAKNRLQ 193
May be involved in eye development.
Gallus gallus (taxid: 9031)
>sp|O95343|SIX3_HUMAN Homeobox protein SIX3 OS=Homo sapiens GN=SIX3 PE=1 SV=1 Back     alignment and function description
>sp|Q62233|SIX3_MOUSE Homeobox protein SIX3 OS=Mus musculus GN=Six3 PE=1 SV=2 Back     alignment and function description
>sp|O42406|SIX3_CHICK Homeobox protein SIX3 OS=Gallus gallus GN=SIX3 PE=2 SV=2 Back     alignment and function description
>sp|O95475|SIX6_HUMAN Homeobox protein SIX6 OS=Homo sapiens GN=SIX6 PE=1 SV=2 Back     alignment and function description
>sp|Q9QZ28|SIX6_MOUSE Homeobox protein SIX6 OS=Mus musculus GN=Six6 PE=2 SV=2 Back     alignment and function description
>sp|Q95RW8|OPTIX_DROME Protein Optix OS=Drosophila melanogaster GN=Optix PE=2 SV=1 Back     alignment and function description
>sp|O73916|SIX3_ORYLA Homeobox protein SIX3 OS=Oryzias latipes GN=six3 PE=2 SV=1 Back     alignment and function description
>sp|Q62232|SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus GN=Six2 PE=1 SV=2 Back     alignment and function description
>sp|Q9NPC8|SIX2_HUMAN Homeobox protein SIX2 OS=Homo sapiens GN=SIX2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
340710920 474 PREDICTED: hypothetical protein LOC10065 0.944 0.432 0.882 1e-101
350400783 474 PREDICTED: hypothetical protein LOC10074 0.944 0.432 0.882 1e-101
380010955 473 PREDICTED: uncharacterized protein LOC10 0.944 0.433 0.882 1e-100
110751050 475 PREDICTED: hypothetical protein LOC55136 0.944 0.431 0.882 1e-100
242014095214 Homeobox protein SIX6, putative [Pedicul 0.884 0.897 0.968 1e-100
383850546 474 PREDICTED: uncharacterized protein LOC10 0.944 0.432 0.882 1e-100
345482090 482 PREDICTED: hypothetical protein LOC10012 0.935 0.421 0.876 5e-99
193713747 328 PREDICTED: homeobox protein SIX6-like [A 0.880 0.582 0.942 6e-99
307206529262 Homeobox protein SIX3 [Harpegnathos salt 0.926 0.767 0.895 9e-99
332016378235 Homeobox protein SIX3 [Acromyrmex echina 0.930 0.859 0.900 9e-99
>gi|340710920|ref|XP_003394031.1| PREDICTED: hypothetical protein LOC100650676 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 196/205 (95%)

Query: 13  APVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAV 72
            P++P P+FALPTL+FTV QVATVCETLEESGDIERLARFLWSLPVAHPNI ELN++EAV
Sbjct: 18  GPIVPAPVFALPTLSFTVGQVATVCETLEESGDIERLARFLWSLPVAHPNIQELNQSEAV 77

Query: 73  LRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKY 132
           LRARAIV+FHSG+YRE+Y+ILE +KFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKY
Sbjct: 78  LRARAIVAFHSGHYRELYAILERHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKY 137

Query: 133 RVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVG 192
           RVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP KKRELA ATGLTPTQVG
Sbjct: 138 RVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPGKKRELAAATGLTPTQVG 197

Query: 193 NWFKNRRQRDRAAAAKNRLEVKTQT 217
           NWFKNRRQRDRAAAAKNR++ ++ T
Sbjct: 198 NWFKNRRQRDRAAAAKNRMQQQSGT 222

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350400783|ref|XP_003485959.1| PREDICTED: hypothetical protein LOC100748444 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380010955|ref|XP_003689581.1| PREDICTED: uncharacterized protein LOC100866364 [Apis florea] Back     alignment and taxonomy information
>gi|110751050|ref|XP_623764.2| PREDICTED: hypothetical protein LOC551364 [Apis mellifera] Back     alignment and taxonomy information
>gi|242014095|ref|XP_002427733.1| Homeobox protein SIX6, putative [Pediculus humanus corporis] gi|212512174|gb|EEB14995.1| Homeobox protein SIX6, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383850546|ref|XP_003700856.1| PREDICTED: uncharacterized protein LOC100878325 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345482090|ref|XP_001607088.2| PREDICTED: hypothetical protein LOC100123443 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|193713747|ref|XP_001944833.1| PREDICTED: homeobox protein SIX6-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307206529|gb|EFN84555.1| Homeobox protein SIX3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332016378|gb|EGI57291.1| Homeobox protein SIX3 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query217
UNIPROTKB|O42406314 SIX3 "Homeobox protein SIX3" [ 0.949 0.656 0.816 1.5e-90
ZFIN|ZDB-GENE-990415-127294 six3a "sine oculis homeobox ho 0.889 0.656 0.854 1.5e-90
UNIPROTKB|O93307246 SIX6 "Homeobox protein SIX6" [ 0.889 0.784 0.870 1.9e-90
UNIPROTKB|E1BMT1328 SIX3 "Uncharacterized protein" 0.921 0.609 0.83 1.9e-90
UNIPROTKB|E2R195338 SIX3 "Uncharacterized protein" 0.921 0.591 0.83 1.9e-90
UNIPROTKB|O95343332 SIX3 "Homeobox protein SIX3" [ 0.921 0.602 0.83 1.9e-90
MGI|MGI:102764333 Six3 "sine oculis-related home 0.921 0.600 0.83 1.9e-90
RGD|620909337 Six3 "SIX homeobox 3" [Rattus 0.921 0.593 0.83 1.9e-90
UNIPROTKB|E9PTM1336 Six3 "Protein Six3" [Rattus no 0.921 0.595 0.83 1.9e-90
ZFIN|ZDB-GENE-990415-128293 six3b "sine oculis homeobox ho 0.967 0.716 0.795 5.1e-90
UNIPROTKB|O42406 SIX3 "Homeobox protein SIX3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 903 (322.9 bits), Expect = 1.5e-90, P = 1.5e-90
 Identities = 169/207 (81%), Positives = 187/207 (90%)

Query:     6 GENISRLAPVIPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGE 65
             G   SR AP     MF LPTLNF+  QVA+VCETLEE+GDIERL RFLWSLPVA      
Sbjct:    48 GGGSSR-APHEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEA 106

Query:    66 LNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRP 125
             +NK+E++LRARA+V+FH+GN+R++Y ILE++KFTK+SHGKLQAMWLEAHYQEAEKLRGRP
Sbjct:   107 INKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRP 166

Query:   126 LGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATG 185
             LGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNP+KKRELAQATG
Sbjct:   167 LGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATG 226

Query:   186 LTPTQVGNWFKNRRQRDRAAAAKNRLE 212
             LTPTQVGNWFKNRRQRDRAAAAKNRL+
Sbjct:   227 LTPTQVGNWFKNRRQRDRAAAAKNRLQ 253
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0001654 "eye development" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0007420 "brain development" evidence=ISS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=ISS
GO:0030178 "negative regulation of Wnt receptor signaling pathway" evidence=ISS
ZFIN|ZDB-GENE-990415-127 six3a "sine oculis homeobox homolog 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O93307 SIX6 "Homeobox protein SIX6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMT1 SIX3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R195 SIX3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95343 SIX3 "Homeobox protein SIX3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:102764 Six3 "sine oculis-related homeobox 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620909 Six3 "SIX homeobox 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTM1 Six3 "Protein Six3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-128 six3b "sine oculis homeobox homolog 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95343SIX3_HUMANNo assigned EC number0.830.92160.6024yesN/A
O95475SIX6_HUMANNo assigned EC number0.86010.88940.7845noN/A
O73916SIX3_ORYLANo assigned EC number0.79680.88470.7058N/AN/A
Q95RW8OPTIX_DROMENo assigned EC number0.79790.91240.4065yesN/A
O42406SIX3_CHICKNo assigned EC number0.830.92160.6369noN/A
Q9QZ28SIX6_MOUSENo assigned EC number0.86010.88940.7845noN/A
Q62233SIX3_MOUSENo assigned EC number0.830.92160.6006yesN/A
O93307SIX6_CHICKNo assigned EC number0.87040.88940.7845yesN/A
Q23175HM32_CAEELNo assigned EC number0.62010.92160.4555yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-14
smart0038957 smart00389, HOX, Homeodomain 2e-12
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-10
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 2e-08
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-04
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information 
 Score = 65.0 bits (159), Expect = 2e-14
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 149 QKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDR 203
           +K   F       L + + ++PYP+  ++ ELA+  GLT  QV  WF+NRR + +
Sbjct: 2   RKRTRFTPEQLEELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLK 56

Length = 59
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 217
KOG0775|consensus304 100.0
KOG3802|consensus398 99.79
KOG0850|consensus245 99.54
KOG4577|consensus 383 99.53
KOG0843|consensus197 99.51
KOG0488|consensus309 99.5
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.49
KOG0848|consensus317 99.45
KOG0842|consensus307 99.43
KOG0492|consensus246 99.41
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.41
KOG0489|consensus261 99.4
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.39
KOG0487|consensus308 99.38
KOG2251|consensus 228 99.31
KOG0485|consensus268 99.3
KOG0494|consensus 332 99.29
KOG0484|consensus125 99.29
KOG0493|consensus342 99.24
KOG1168|consensus385 99.22
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.19
KOG0491|consensus194 99.16
KOG0483|consensus198 99.15
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.07
COG5576156 Homeodomain-containing transcription factor [Trans 99.04
KOG0774|consensus334 98.94
KOG0486|consensus 351 98.94
KOG0847|consensus288 98.88
KOG0844|consensus 408 98.85
KOG0490|consensus 235 98.53
KOG0849|consensus 354 98.41
KOG2252|consensus558 98.38
KOG0773|consensus342 98.27
KOG0490|consensus235 97.73
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.27
KOG1146|consensus 1406 95.51
KOG3623|consensus 1007 93.17
>KOG0775|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.6e-73  Score=481.57  Aligned_cols=191  Identities=73%  Similarity=1.219  Sum_probs=184.2

Q ss_pred             CCCCCCCCCCCCCChhhhhhHhhHHhhcCCHHHHHHHHHhCCCCCCCcccCCCcHHHHHHHHHHhHhhhcHHHHHHhhcc
Q psy11043         16 IPCPMFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEH   95 (217)
Q Consensus        16 ~~~~~~~~~~~~~~~~q~~~vc~~l~~~g~~~~l~~fl~slp~~~~~~~~~~~~e~vlrAr~~v~~h~~~~~~~~~lLe~   95 (217)
                      .-.+++.+|++.||++||+||||+|++.||+|||.+|||+||+    ++.+..||+||||||+|+||.|+|+|||+|||+
T Consensus        49 ~~~s~~~~pt~~fS~eQvacvCe~L~q~Gd~erL~rFlwsLp~----~~~~~~nEsvLkArA~vafH~gnf~eLY~iLE~  124 (304)
T KOG0775|consen   49 ASASMSALPTFGFSEEQVACVCESLQQGGDIERLGRFLWSLPV----CEELLKNESVLKARAVVAFHSGNFRELYHILEN  124 (304)
T ss_pred             cccccccCCCcCCCHHHHHHHHHHHHhccCHHHHHHHHHcCch----HHHHhhhHHHHHHHHHHHHhcccHHHHHHHHHh
Confidence            3345889999999999999999999999999999999999998    588999999999999999999999999999999


Q ss_pred             CCCCCcchhHHHHHHHHhhhHHHHHhcCCCCCCccccccccCCCCCCccCCCcccccccchHHHHHHHHHHhcCCCCCHH
Q psy11043         96 YKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPT  175 (217)
Q Consensus        96 ~~f~~~~~~~lq~lw~~a~y~~~e~~~g~~l~~~~k~r~rkk~p~prt~~~~~~~~~~f~~~~r~~L~~~f~~~~yPs~~  175 (217)
                      +.|++.+|.+||+||++|||.|+|+.|||+||+|+|||+|||+|.|||||||++++|||++++|.+|++||..|+||++.
T Consensus       125 h~Fs~~~h~~LQ~lWl~AhY~EAek~RGR~LgaV~KYRvRrKfPlPrTIWDGEet~yCFKekSR~~LrewY~~~~YPsp~  204 (304)
T KOG0775|consen  125 HKFSPHNHPKLQALWLKAHYKEAEKLRGRPLGAVDKYRVRRKFPLPRTIWDGEETVYCFKEKSRSLLREWYLQNPYPSPR  204 (304)
T ss_pred             ccCChhhhHHHHHHHHHHHHHHHHHhcCCcCCccccceeeccCCCCCccccCceeeeehhHhhHHHHHHHHhcCCCCChH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCccccccccccchhHHHHHHhhhh
Q psy11043        176 KKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNR  210 (217)
Q Consensus       176 ~k~~LA~~tgLt~~qV~~WFqNrR~R~kr~~~~~~  210 (217)
                      +|.+||++|||+.+||.|||+|||+|||....+..
T Consensus       205 eKReLA~aTgLt~tQVsNWFKNRRQRDRa~~ak~~  239 (304)
T KOG0775|consen  205 EKRELAEATGLTITQVSNWFKNRRQRDRAAAAKNS  239 (304)
T ss_pred             HHHHHHHHhCCchhhhhhhhhhhhhhhhhcccccc
Confidence            99999999999999999999999999997666544

>KOG3802|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 3e-73
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 5e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 9e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-05
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 1e-05
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 2e-05
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 8e-05
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 2e-04
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure 
Iteration: 1

 Score =  271 bits (692), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 124/191 (64%), Positives = 154/191 (80%), Gaps = 4/191 (2%)
Query: 20  MFALPTLNFTVSQVATVCETLEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIV 79
           M  LP+  FT  QVA VCE L++ G++ERL RFLWSLP        L+KNE+VL+A+A+V
Sbjct: 371 MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACD----HLHKNESVLKAKAVV 426
Query: 80  SFHSGNYREMYSILEHYKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFP 139
           +FH GN+RE+Y ILE ++F+  +H KLQ +WL+AHY EAEKLRGRPLG V KYRVR+KFP
Sbjct: 427 AFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFP 486
Query: 140 LPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRR 199
           LPRTIWDGE+ ++CFKE++R +LREWY  +PYP+P +KRELA+ATGLT TQV NWFKNRR
Sbjct: 487 LPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRR 546
Query: 200 QRDRAAAAKNR 210
           QRDRAA AK R
Sbjct: 547 QRDRAAEAKER 557
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query217
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 1e-14
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 1e-14
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 4e-14
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 6e-14
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-13
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-13
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 3e-13
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 5e-12
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 5e-12
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-11
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 2e-11
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 2e-11
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 4e-11
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 8e-11
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-10
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-09
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-09
3d1n_I151 POU domain, class 6, transcription factor 1; prote 4e-08
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-08
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 7e-08
2xsd_C164 POU domain, class 3, transcription factor 1; trans 7e-08
1e3o_C160 Octamer-binding transcription factor 1; transcript 7e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-06
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 4e-06
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 7e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 7e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-05
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-05
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 4e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-04
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-04
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 3e-04
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-04
2e19_A64 Transcription factor 8; homeobox domain, structura 4e-04
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 7e-04
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 8e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 9e-04
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
 Score = 65.0 bits (159), Expect = 1e-14
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 150 KTHCFKERTRSLLREWYLQ---DPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDR 203
           + H F +    +L  W+ +   +PY +      L + T L+  Q+ NW  NRR++++
Sbjct: 1   RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 57
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.83
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.76
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.73
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.71
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.71
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.66
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.65
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.65
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.64
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.64
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.64
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.63
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.63
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.63
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.63
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.63
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.63
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.62
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.62
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.62
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.62
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.62
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.62
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.61
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.61
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.61
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.61
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.61
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.61
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.61
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.61
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.61
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.61
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.6
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.6
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.6
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.6
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.6
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.6
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.6
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.59
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.59
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.59
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.59
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.59
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.58
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.58
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.57
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.57
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.57
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.57
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.56
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.56
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.56
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.55
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.55
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.55
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.54
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.54
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.53
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.52
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.52
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.51
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.5
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.49
2e19_A64 Transcription factor 8; homeobox domain, structura 99.49
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.49
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.49
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.48
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.47
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.47
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.44
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.4
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.33
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.19
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.14
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.08
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.35
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.67
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
Probab=99.83  E-value=6.4e-22  Score=160.12  Aligned_cols=142  Identities=21%  Similarity=0.299  Sum_probs=98.6

Q ss_pred             HhhcCCHHHHHHHHHhCCCCCCCcccCCCcHHHHHHHHHHhHhhhcHHHHHHhhccCCCCCcc----------hhHHHHH
Q psy11043         40 LEESGDIERLARFLWSLPVAHPNIGELNKNEAVLRARAIVSFHSGNYREMYSILEHYKFTKDS----------HGKLQAM  109 (217)
Q Consensus        40 l~~~g~~~~l~~fl~slp~~~~~~~~~~~~e~vlrAr~~v~~h~~~~~~~~~lLe~~~f~~~~----------~~~lq~l  109 (217)
                      ..++.+++.|..|...+...                |+.+.|+++++..++..|.+..|+...          +..+..+
T Consensus         6 ~~~~~~~~~l~~fa~~fk~~----------------ri~lg~tQ~~vg~alg~l~g~~~Sqtti~rFE~l~ls~kn~~kl   69 (164)
T 2xsd_C            6 DEDAPSSDDLEQFAKQFKQR----------------RIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKL   69 (164)
T ss_dssp             ---CCCHHHHHHHHHHHHHH----------------HHHTTCCHHHHHHHHHHHHSCCCCHHHHHHHHTTCSBHHHHHHH
T ss_pred             cccccchhHHHHHHHHHHHH----------------HhhcCCcccccccccccccCCCcCcchhhhhhccCCCHHHHHHc
Confidence            35678999999999887653                788999999999999999999988543          3334445


Q ss_pred             H--HHhhhHHHHHhcCCCCCCccccccccCCCCCCccCCCcccccccchHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCC
Q psy11043        110 W--LEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLT  187 (217)
Q Consensus       110 w--~~a~y~~~e~~~g~~l~~~~k~r~rkk~p~prt~~~~~~~~~~f~~~~r~~L~~~f~~~~yPs~~~k~~LA~~tgLt  187 (217)
                      |  ++.++.+++...+.+ +.+++....++.+++||.|+..+..         .|+.+|..++||+..++..||..+||+
T Consensus        70 kPlL~~wl~eae~~~~~~-~~~~~~~~~~~~rr~Rt~ft~~Ql~---------~LE~~F~~~~yp~~~~r~~LA~~l~L~  139 (164)
T 2xsd_C           70 KPLLNKWLEETDSSSGSP-TNLDKIAAQGRKRKKRTSIEVGVKG---------ALESHFLKCPKPSAHEITGLADSLQLE  139 (164)
T ss_dssp             HHHHHHHHHHHCC------------------------CCHHHHH---------HHHHHHHHCSSCCHHHHHHHHHHHTCC
T ss_pred             chhHHHHHhhhccccCCC-cccccccccccCCCCceeccHHHHH---------HHHHHHhcCCCCCHHHHHHHHHHHCCC
Confidence            4  566677777665554 3344444445556678887777766         999999999999999999999999999


Q ss_pred             ccccccccccchhHHHHHHh
Q psy11043        188 PTQVGNWFKNRRQRDRAAAA  207 (217)
Q Consensus       188 ~~qV~~WFqNrR~R~kr~~~  207 (217)
                      +.||++||||||+|+|+...
T Consensus       140 ~~qV~vWFqNRR~k~kr~~~  159 (164)
T 2xsd_C          140 KEVVRVWFCNRRQKEKRMTP  159 (164)
T ss_dssp             HHHHHHHHHHHHHHHTBSCC
T ss_pred             hhhhhhhhHHhhHHHhhccC
Confidence            99999999999999997543
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 217
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 9e-13
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 3e-10
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 3e-09
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-09
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 7e-09
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-08
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-08
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-08
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-08
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 5e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 5e-08
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 5e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 8e-08
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-07
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-07
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-07
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-07
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 8e-07
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-06
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-06
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-06
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 5e-06
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 7e-06
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-04
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.1 bits (146), Expect = 3e-13
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 147 GEQKTHCFKERTRSLLREWYLQD---PYPNPTKKRELAQATGLTPTQVGNWFKNRRQR 201
           G+ K     +   +++R W  Q    PYP   +K+++A  T LT  QV NWF N R+R
Sbjct: 2   GKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 59
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query217
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.71
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.7
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.7
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.7
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.7
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.69
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.68
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.68
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.67
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.66
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.65
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.64
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.64
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.63
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.63
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.63
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.63
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.62
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.61
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.61
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.6
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.59
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.59
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.57
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.56
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.54
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.52
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.51
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.44
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.44
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 87.67
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 81.99
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Msx-1 homeodomain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.71  E-value=1.3e-18  Score=116.02  Aligned_cols=55  Identities=33%  Similarity=0.520  Sum_probs=51.1

Q ss_pred             CCccCCCcccccccchHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCccccccccccchhHHHH
Q psy11043        141 PRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRA  204 (217)
Q Consensus       141 prt~~~~~~~~~~f~~~~r~~L~~~f~~~~yPs~~~k~~LA~~tgLt~~qV~~WFqNrR~R~kr  204 (217)
                      +|++|+..|..         +|+..|..|+||+..+++.||..+||+..||++||||+|+|+||
T Consensus         3 ~Rt~ft~~Ql~---------~Le~~F~~~~yP~~~~r~~LA~~l~l~~~~V~~WFqNrR~k~kr   57 (58)
T d1ig7a_           3 PRTPFTTAQLL---------ALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKR   57 (58)
T ss_dssp             CCCCCCHHHHH---------HHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHH---------HHHHHHHHCCCCCHHHHHHHHHHhCCChhheeecCcchHhHhcc
Confidence            57777777766         99999999999999999999999999999999999999999987
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure