Psyllid ID: psy11173
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 280 | ||||||
| 328720998 | 1112 | PREDICTED: alpha-mannosidase 2-like [Acy | 0.442 | 0.111 | 0.632 | 1e-40 | |
| 307176273 | 1134 | Alpha-mannosidase 2 [Camponotus floridan | 0.439 | 0.108 | 0.580 | 2e-34 | |
| 307192910 | 1130 | Alpha-mannosidase 2 [Harpegnathos saltat | 0.439 | 0.108 | 0.572 | 9e-34 | |
| 242019146 | 1057 | alpha-mannosidase, putative [Pediculus h | 0.460 | 0.122 | 0.549 | 9e-34 | |
| 332029722 | 1013 | Alpha-mannosidase 2 [Acromyrmex echinati | 0.439 | 0.121 | 0.564 | 1e-33 | |
| 390335547 | 432 | PREDICTED: alpha-mannosidase 2-like, par | 0.457 | 0.296 | 0.557 | 1e-33 | |
| 241998292 | 1029 | alpha-mannosidase II, putative [Ixodes s | 0.510 | 0.138 | 0.470 | 2e-33 | |
| 320168525 | 1249 | mannosidase 2 [Capsaspora owczarzaki ATC | 0.446 | 0.100 | 0.543 | 2e-33 | |
| 383854239 | 1134 | PREDICTED: alpha-mannosidase 2-like [Meg | 0.439 | 0.108 | 0.556 | 2e-33 | |
| 357622223 | 1116 | putative mannosidase alpha class 2a [Dan | 0.542 | 0.136 | 0.490 | 3e-33 |
| >gi|328720998|ref|XP_001946979.2| PREDICTED: alpha-mannosidase 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 172 bits (437), Expect = 1e-40, Method: Compositional matrix adjust.
Identities = 79/125 (63%), Positives = 96/125 (76%), Gaps = 1/125 (0%)
Query: 40 DEIEFANINGGKWTQGWNIGLDLAHETDPENLLRVFVVPHSHNDPGWKQTFESYFVHSTK 99
D+++F NI+GG W QGW++ + + N LRVFVVPHSHNDPGWK+TFE Y+ TK
Sbjct: 108 DKLQFDNIDGGAWKQGWDVKIT-KRRWNANNKLRVFVVPHSHNDPGWKRTFEEYYRSDTK 166
Query: 100 SILDTMVTKLLENEKRKFIWAEMSYLSLWWKTISEDTKDKVRLLVKSGQLEIVTGGWVMT 159
+ILD MV KL E+ +RKFIWAEMSYLSLWW I TK KV+ L+ +GQLEIVTGGWVMT
Sbjct: 167 NILDNMVIKLSEDRRRKFIWAEMSYLSLWWNDIDHSTKTKVKKLIDNGQLEIVTGGWVMT 226
Query: 160 DEANS 164
DEAN+
Sbjct: 227 DEANT 231
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307176273|gb|EFN65904.1| Alpha-mannosidase 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307192910|gb|EFN75938.1| Alpha-mannosidase 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242019146|ref|XP_002430026.1| alpha-mannosidase, putative [Pediculus humanus corporis] gi|212515088|gb|EEB17288.1| alpha-mannosidase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332029722|gb|EGI69601.1| Alpha-mannosidase 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|390335547|ref|XP_794076.3| PREDICTED: alpha-mannosidase 2-like, partial [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|241998292|ref|XP_002433789.1| alpha-mannosidase II, putative [Ixodes scapularis] gi|215495548|gb|EEC05189.1| alpha-mannosidase II, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|320168525|gb|EFW45424.1| mannosidase 2 [Capsaspora owczarzaki ATCC 30864] | Back alignment and taxonomy information |
|---|
| >gi|383854239|ref|XP_003702629.1| PREDICTED: alpha-mannosidase 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|357622223|gb|EHJ73787.1| putative mannosidase alpha class 2a [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 280 | ||||||
| UNIPROTKB|F6V049 | 1150 | MAN2A2 "Uncharacterized protei | 0.439 | 0.106 | 0.544 | 4.2e-37 | |
| UNIPROTKB|E2QT95 | 1153 | MAN2A2 "Uncharacterized protei | 0.439 | 0.106 | 0.544 | 4.2e-37 | |
| UNIPROTKB|H0YNG5 | 938 | MAN2A2 "Mannosidase, alpha, cl | 0.439 | 0.131 | 0.536 | 5e-37 | |
| RGD|3038 | 489 | Man2a1 "mannosidase, alpha, cl | 0.446 | 0.255 | 0.554 | 6.4e-37 | |
| UNIPROTKB|E1BGJ4 | 1150 | MAN2A2 "Uncharacterized protei | 0.439 | 0.106 | 0.544 | 1.1e-36 | |
| UNIPROTKB|P49641 | 1150 | MAN2A2 "Alpha-mannosidase 2x" | 0.439 | 0.106 | 0.536 | 1.1e-36 | |
| UNIPROTKB|F1RMI9 | 1150 | MAN2A2 "Uncharacterized protei | 0.439 | 0.106 | 0.52 | 1e-35 | |
| FB|FBgn0011740 | 1108 | alpha-Man-II "alpha Mannosidas | 0.460 | 0.116 | 0.519 | 2.4e-35 | |
| MGI|MGI:2150656 | 1152 | Man2a2 "mannosidase 2, alpha 2 | 0.439 | 0.106 | 0.52 | 2.7e-35 | |
| RGD|1310238 | 1164 | Man2a2 "mannosidase, alpha, cl | 0.439 | 0.105 | 0.52 | 2.8e-35 |
| UNIPROTKB|F6V049 MAN2A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 377 (137.8 bits), Expect = 4.2e-37, Sum P(2) = 4.2e-37
Identities = 68/125 (54%), Positives = 94/125 (75%)
Query: 40 DEIEFANINGGKWTQGWNIGLDLAHETDPENLLRVFVVPHSHNDPGWKQTFESYFVHSTK 99
+E+ F N++GG W QG++I H+ D E+L +VFVVPHSHNDPGW +TF+ Y+ T+
Sbjct: 136 EELPFDNVDGGVWKQGFDISYS-PHDWDAEDL-QVFVVPHSHNDPGWIKTFDKYYTEQTQ 193
Query: 100 SILDTMVTKLLENEKRKFIWAEMSYLSLWWKTISEDTKDKVRLLVKSGQLEIVTGGWVMT 159
IL++MV+KL E+ +R+F+WAE+S+ + WW+ I+ K VR LV +GQLEIVTGGWVM
Sbjct: 194 HILNSMVSKLQEDPRRRFLWAEVSFFAKWWENINAQKKAAVRRLVGNGQLEIVTGGWVMP 253
Query: 160 DEANS 164
DEANS
Sbjct: 254 DEANS 258
|
|
| UNIPROTKB|E2QT95 MAN2A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YNG5 MAN2A2 "Mannosidase, alpha, class 2A, member 2, isoform CRA_d" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|3038 Man2a1 "mannosidase, alpha, class 2A, member 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BGJ4 MAN2A2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49641 MAN2A2 "Alpha-mannosidase 2x" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RMI9 MAN2A2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0011740 alpha-Man-II "alpha Mannosidase II" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2150656 Man2a2 "mannosidase 2, alpha 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1310238 Man2a2 "mannosidase, alpha, class 2A, member 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 280 | |||
| cd10809 | 340 | cd10809, GH38N_AMII_GMII_SfManIII_like, N-terminal | 3e-56 | |
| PLN02701 | 1050 | PLN02701, PLN02701, alpha-mannosidase | 2e-47 | |
| cd00451 | 258 | cd00451, GH38N_AMII_euk, N-terminal catalytic doma | 3e-43 | |
| cd11666 | 344 | cd11666, GH38N_Man2A1, N-terminal catalytic domain | 2e-39 | |
| cd11667 | 344 | cd11667, GH38N_Man2A2, N-terminal catalytic domain | 7e-39 | |
| cd10810 | 278 | cd10810, GH38N_AMII_LAM_like, N-terminal catalytic | 6e-36 | |
| pfam01074 | 269 | pfam01074, Glyco_hydro_38, Glycosyl hydrolases fam | 4e-30 | |
| cd10786 | 251 | cd10786, GH38N_AMII_like, N-terminal catalytic dom | 3e-25 | |
| cd10811 | 326 | cd10811, GH38N_AMII_Epman_like, N-terminal catalyt | 2e-19 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 8e-15 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-14 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-14 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-14 | |
| cd10785 | 203 | cd10785, GH38-57_N_LamB_YdjC_SF, Catalytic domain | 3e-13 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-13 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-12 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 8e-12 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 8e-12 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-11 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-11 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-11 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-11 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-11 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-11 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-11 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 5e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-11 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 6e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 8e-11 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-10 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-10 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 5e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-10 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-10 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 6e-10 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-10 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 9e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 1e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-09 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-09 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 2e-09 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 2e-09 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-09 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 5e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 5e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-09 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 7e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 8e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 9e-09 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 9e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-08 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-08 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-08 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-08 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-08 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-08 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 2e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-08 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-08 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 3e-08 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-08 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-08 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-08 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-08 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 4e-08 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 4e-08 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 4e-08 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 4e-08 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-08 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 5e-08 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 5e-08 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 5e-08 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-08 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 5e-08 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 5e-08 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 6e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-08 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 7e-08 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-08 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-07 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 1e-07 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 1e-07 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 1e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-07 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 1e-07 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 1e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-07 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-07 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-07 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 2e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-07 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 2e-07 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 2e-07 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 2e-07 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 2e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-07 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-07 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 2e-07 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-07 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 2e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 3e-07 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-07 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 3e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-07 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 3e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-07 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 3e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 4e-07 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 4e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 4e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 4e-07 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 4e-07 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 4e-07 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 4e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-07 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 5e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 5e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 5e-07 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 5e-07 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 5e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 5e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 5e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 5e-07 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 5e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 6e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 6e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-07 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-07 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 6e-07 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 6e-07 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 6e-07 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 7e-07 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 7e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 7e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 7e-07 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 7e-07 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 7e-07 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 8e-07 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 8e-07 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 8e-07 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 8e-07 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 8e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-07 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 9e-07 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 9e-07 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 9e-07 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 9e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-06 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-06 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-06 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-06 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-06 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 1e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 1e-06 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 1e-06 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 1e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 1e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-06 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 1e-06 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 1e-06 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 1e-06 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-06 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-06 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-06 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 2e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 2e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 2e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 2e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 2e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-06 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 2e-06 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 2e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 2e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-06 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 3e-06 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 3e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-06 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 3e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 3e-06 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 3e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 3e-06 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 3e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-06 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 3e-06 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 4e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 4e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 4e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-06 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 4e-06 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 4e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 4e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 4e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 5e-06 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 5e-06 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 5e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 5e-06 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 5e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 5e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 5e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 5e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 5e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 5e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 6e-06 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 6e-06 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 6e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 6e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 6e-06 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 6e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 6e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 6e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 6e-06 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 6e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 6e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 6e-06 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 6e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 7e-06 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-06 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 7e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 8e-06 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 8e-06 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 8e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 8e-06 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 8e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-06 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 9e-06 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 9e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 1e-05 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 1e-05 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 1e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 1e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-05 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 1e-05 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 1e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 1e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 1e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 1e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 1e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 1e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 1e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 1e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 1e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 1e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 2e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-05 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 2e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 2e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 2e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 2e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 2e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 3e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 3e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 3e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 3e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 3e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 3e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-05 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 3e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 4e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 4e-05 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 4e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 4e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 4e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 4e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 4e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 4e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 4e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 4e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 4e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 4e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 4e-05 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 4e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 4e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 4e-05 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 4e-05 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 4e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 5e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-05 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 5e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 5e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 5e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 5e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 5e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 5e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 5e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 5e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 5e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 5e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 5e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 5e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 5e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 5e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 5e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 5e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 5e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 5e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 5e-05 | |
| pfam11719 | 397 | pfam11719, Drc1-Sld2, DNA replication and checkpoi | 5e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 5e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 6e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 6e-05 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 6e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 6e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 6e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 6e-05 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 6e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 6e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 6e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 6e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 6e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 6e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-05 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 6e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 6e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 6e-05 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 6e-05 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-05 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 6e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 7e-05 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 7e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 7e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-05 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 7e-05 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 7e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 7e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 7e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 7e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 7e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-05 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 7e-05 | |
| PRK09202 | 470 | PRK09202, nusA, transcription elongation factor Nu | 8e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 8e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 8e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 8e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 8e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 8e-05 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 8e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 8e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 8e-05 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 8e-05 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 8e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 8e-05 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 8e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 9e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 9e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 9e-05 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 9e-05 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 9e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 9e-05 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 9e-05 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 9e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 9e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 9e-05 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 9e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 9e-05 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 9e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 9e-05 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 1e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 1e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 1e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 1e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 1e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 1e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 1e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 1e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 1e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 1e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 1e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 1e-04 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 1e-04 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 1e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 1e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 1e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 1e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 1e-04 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 1e-04 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 1e-04 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 1e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 1e-04 | |
| COG5593 | 821 | COG5593, COG5593, Nucleic-acid-binding protein pos | 1e-04 | |
| COG5163 | 591 | COG5163, NOP7, Protein required for biogenesis of | 1e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 1e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 1e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 2e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 2e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 2e-04 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 2e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 2e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 2e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 2e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 2e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 2e-04 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 2e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 2e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 2e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 2e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 2e-04 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 2e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 2e-04 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 2e-04 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 2e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 2e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 2e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 2e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 2e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 3e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 3e-04 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 3e-04 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 3e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 3e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-04 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 3e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 3e-04 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 3e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 3e-04 | |
| pfam14153 | 185 | pfam14153, Spore_coat_CotO, Spore coat protein Cot | 3e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 3e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 3e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 3e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 3e-04 | |
| COG5593 | 821 | COG5593, COG5593, Nucleic-acid-binding protein pos | 3e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 3e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 3e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 3e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 3e-04 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 3e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 3e-04 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 3e-04 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 3e-04 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 3e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 4e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 4e-04 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 4e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 4e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 4e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-04 | |
| COG5593 | 821 | COG5593, COG5593, Nucleic-acid-binding protein pos | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 4e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 4e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 4e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 4e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 4e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 4e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 4e-04 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 4e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 4e-04 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 5e-04 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 5e-04 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 5e-04 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 5e-04 | |
| COG5177 | 769 | COG5177, COG5177, Uncharacterized conserved protei | 5e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 5e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 5e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 5e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 5e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 5e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 5e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 5e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 5e-04 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 5e-04 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 5e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 5e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 5e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 5e-04 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 5e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 5e-04 | |
| PTZ00254 | 249 | PTZ00254, PTZ00254, 40S ribosomal protein SA; Prov | 5e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 6e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 6e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 6e-04 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 6e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 6e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 6e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 6e-04 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 6e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 6e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 6e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 6e-04 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 6e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 6e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 6e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-04 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 7e-04 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-04 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 7e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 7e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 7e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 7e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 7e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 7e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-04 | |
| COG5593 | 821 | COG5593, COG5593, Nucleic-acid-binding protein pos | 7e-04 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 7e-04 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 7e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 7e-04 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 7e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 7e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 7e-04 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 7e-04 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 7e-04 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 7e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 7e-04 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 8e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| PRK06007 | 542 | PRK06007, fliF, flagellar MS-ring protein; Reviewe | 8e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 8e-04 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 8e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 8e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 8e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-04 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 8e-04 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 8e-04 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 8e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 8e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 8e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 8e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 8e-04 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 8e-04 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 8e-04 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 8e-04 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 8e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 9e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 9e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 9e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 9e-04 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 9e-04 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 9e-04 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 9e-04 | |
| PRK12903 | 925 | PRK12903, secA, preprotein translocase subunit Sec | 9e-04 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 9e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.001 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.001 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.001 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.001 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.001 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.001 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.001 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.001 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 0.001 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 0.001 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 0.001 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 0.001 | |
| TIGR03779 | 410 | TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative | 0.001 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 0.001 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 0.001 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| COG5593 | 821 | COG5593, COG5593, Nucleic-acid-binding protein pos | 0.001 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.001 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.001 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.001 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.001 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 0.001 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 0.001 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 0.001 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.001 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.001 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.001 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.001 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.001 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.001 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.001 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.001 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.001 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.001 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.001 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| COG5414 | 392 | COG5414, COG5414, TATA-binding protein-associated | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.001 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.001 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.001 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.001 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.001 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 0.001 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.001 | |
| PRK05687 | 246 | PRK05687, fliH, flagellar assembly protein H; Vali | 0.001 | |
| cd10809 | 340 | cd10809, GH38N_AMII_GMII_SfManIII_like, N-terminal | 0.002 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.002 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.002 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.002 | |
| pfam06512 | 230 | pfam06512, Na_trans_assoc, Sodium ion transport-as | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.002 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.002 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.002 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.002 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.002 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 0.002 | |
| PRK14160 | 211 | PRK14160, PRK14160, heat shock protein GrpE; Provi | 0.002 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.002 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.002 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.002 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.002 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.002 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.002 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.002 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.002 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 0.002 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 0.002 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.002 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.002 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.002 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.002 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.002 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.002 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.002 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.002 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.002 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.002 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.002 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.002 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.002 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.002 | |
| COG1269 | 660 | COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su | 0.002 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 0.002 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.002 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.002 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.002 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 0.002 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 0.002 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.002 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.002 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.002 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.002 | |
| cd11486 | 635 | cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporte | 0.002 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.002 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.002 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.002 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.002 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.002 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| pfam07222 | 243 | pfam07222, PBP_sp32, Proacrosin binding protein sp | 0.002 | |
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 0.002 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 0.002 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.002 | |
| PLN02847 | 633 | PLN02847, PLN02847, triacylglycerol lipase | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| cd10791 | 254 | cd10791, GH38N_AMII_like_1, N-terminal catalytic d | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.003 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.003 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.003 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.003 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.003 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.003 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.003 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.003 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.003 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.003 | |
| PRK04335 | 313 | PRK04335, PRK04335, cell division protein ZipA; Pr | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.003 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.003 | |
| pfam09731 | 493 | pfam09731, Mitofilin, Mitochondrial inner membrane | 0.003 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.003 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.003 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.003 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.003 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 0.003 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.003 | |
| COG5192 | 1077 | COG5192, BMS1, GTP-binding protein required for 40 | 0.003 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.003 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.003 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.003 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.003 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| PRK06669 | 281 | PRK06669, fliH, flagellar assembly protein H; Vali | 0.003 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.003 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 0.003 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.003 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.003 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.003 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 0.003 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.003 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.003 | |
| COG5238 | 388 | COG5238, RNA1, Ran GTPase-activating protein (RanG | 0.003 | |
| COG5019 | 373 | COG5019, CDC3, Septin family protein [Cell divisio | 0.003 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.004 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.004 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.004 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.004 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 0.004 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.004 | |
| COG5593 | 821 | COG5593, COG5593, Nucleic-acid-binding protein pos | 0.004 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.004 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 0.004 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.004 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.004 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 0.004 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.004 | |
| COG3064 | 387 | COG3064, TolA, Membrane protein involved in colici | 0.004 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.004 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 0.004 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 0.004 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.004 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.004 | |
| PLN02372 | 455 | PLN02372, PLN02372, violaxanthin de-epoxidase | 0.004 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.004 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.004 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.004 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.004 | |
| COG5137 | 279 | COG5137, COG5137, Histone chaperone involved in ge | 0.004 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 0.004 | |
| pfam04050 | 171 | pfam04050, Upf2, Up-frameshift suppressor 2 | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| pfam04006 | 613 | pfam04006, Mpp10, Mpp10 protein | 0.004 | |
| PLN02847 | 633 | PLN02847, PLN02847, triacylglycerol lipase | 0.004 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.004 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.004 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.004 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.004 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.004 | |
| COG0576 | 193 | COG0576, GrpE, Molecular chaperone GrpE (heat shoc | 0.004 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 0.004 | |
| PRK14906 | 1460 | PRK14906, PRK14906, DNA-directed RNA polymerase su | 0.004 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 0.004 |
| >gnl|CDD|212120 cd10809, GH38N_AMII_GMII_SfManIII_like, N-terminal catalytic domain of Golgi alpha-mannosidase II, Spodoptera frugiperda Sf9 alpha-mannosidase III, and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
Score = 183 bits (467), Expect = 3e-56
Identities = 64/93 (68%), Positives = 73/93 (78%)
Query: 72 LRVFVVPHSHNDPGWKQTFESYFVHSTKSILDTMVTKLLENEKRKFIWAEMSYLSLWWKT 131
L+VFVVPHSHNDPGW +TFE Y+ TK ILD MV KL +N K KFIWAE+S+L WW
Sbjct: 2 LKVFVVPHSHNDPGWIKTFEEYYQDQTKHILDNMVDKLSKNPKMKFIWAEISFLERWWDD 61
Query: 132 ISEDTKDKVRLLVKSGQLEIVTGGWVMTDEANS 164
S D K+ V+ LVK+GQLEIVTGGWVMTDEANS
Sbjct: 62 ASPDKKEAVKKLVKNGQLEIVTGGWVMTDEANS 94
|
This subfamily is represented by Golgi alpha-mannosidase II (GMII, also known as mannosyl-oligosaccharide 1,3- 1,6-alpha mannosidase, EC 3.2.1.114, Man2A1), a monomeric, membrane-anchored class II alpha-mannosidase existing in the Golgi apparatus of eukaryotes. GMII plays a key role in the N-glycosylation pathway. It catalyzes the hydrolysis of the terminal both alpha-1,3-linked and alpha-1,6-linked mannoses from the high-mannose oligosaccharide GlcNAc(Man)5(GlcNAc)2 to yield GlcNAc(Man)3(GlcNAc)2(GlcNAc, N-acetylglucosmine), which is the committed step of complex N-glycan synthesis. GMII is activated by zinc or cobalt ions and is strongly inhibited by swainsonine. Inhibition of GMII provides a route to block cancer-induced changes in cell surface oligosaccharide structures. GMII has a pH optimum of 5.5-6.0, which is intermediate between those of acidic (lysosomal alpha-mannosidase) and neutral (ER/cytosolic alpha-mannosidase) enzymes. GMII is a retaining glycosyl hydrolase of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl enzyme complex; two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst. This subfamily also includes human alpha-mannosidase 2x (MX, also known as mannosyl-oligosaccharide 1,3- 1,6-alpha mannosidase, EC 3.2.1.114, Man2A2). MX is enzymatically and functionally very similar to GMII, and is thought to also function in the N-glycosylation pathway. Also found in this subfamily is class II alpha-mannosidase encoded by Spodoptera frugiperda Sf9 cell. This alpha-mannosidase is an integral membrane glycoprotein localized in the Golgi apparatus. It shows high sequence homology with mammalian Golgi alpha-mannosidase II(GMII). It can hydrolyze p-nitrophenyl alpha-D-mannopyranoside (pNP-alpha-Man), and it is inhibited by swainsonine. However, the Sf9 enzyme is stimulated by cobalt and can hydrolyze (Man)5(GlcNAc)2 to (Man)3(GlcNAc)2, but it cannot hydrolyze GlcNAc(Man)5(GlcNAc)2, which is distinct from that of GMII. Thus, this enzyme has been designated as Sf9 alpha-mannosidase III (SfManIII). It probably functions in an alternate N-glycan processing pathway in Sf9 cells. Length = 340 |
| >gnl|CDD|178304 PLN02701, PLN02701, alpha-mannosidase | Back alignment and domain information |
|---|
| >gnl|CDD|212095 cd00451, GH38N_AMII_euk, N-terminal catalytic domain of eukaryotic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|212131 cd11666, GH38N_Man2A1, N-terminal catalytic domain of Golgi alpha-mannosidase II and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|212132 cd11667, GH38N_Man2A2, N-terminal catalytic domain of Golgi alpha-mannosidase IIx, and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|212121 cd10810, GH38N_AMII_LAM_like, N-terminal catalytic domain of lysosomal alpha-mannosidase and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|216284 pfam01074, Glyco_hydro_38, Glycosyl hydrolases family 38 N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|212098 cd10786, GH38N_AMII_like, N-terminal catalytic domain of class II alpha-mannosidases and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|212122 cd10811, GH38N_AMII_Epman_like, N-terminal catalytic domain of mammalian core-specific lysosomal alpha 1,6-mannosidase and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|212097 cd10785, GH38-57_N_LamB_YdjC_SF, Catalytic domain of glycoside hydrolase (GH) families 38 and 57, lactam utilization protein LamB/YcsF family proteins, YdjC-family proteins, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|221185 pfam11719, Drc1-Sld2, DNA replication and checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|236410 PRK09202, nusA, transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227880 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|222571 pfam14153, Spore_coat_CotO, Spore coat protein CotO | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|227880 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|227880 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227504 COG5177, COG5177, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240331 PTZ00254, PTZ00254, 40S ribosomal protein SA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|227880 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235668 PRK06007, fliF, flagellar MS-ring protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237258 PRK12903, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|227880 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|227701 COG5414, COG5414, TATA-binding protein-associated factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|235562 PRK05687, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|212120 cd10809, GH38N_AMII_GMII_SfManIII_like, N-terminal catalytic domain of Golgi alpha-mannosidase II, Spodoptera frugiperda Sf9 alpha-mannosidase III, and similar proteins; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|219069 pfam06512, Na_trans_assoc, Sodium ion transport-associated | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237629 PRK14160, PRK14160, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|212055 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporter SGLT1;solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 | Back alignment and domain information |
|---|
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|178439 PLN02847, PLN02847, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|212103 cd10791, GH38N_AMII_like_1, N-terminal catalytic domain of mainly uncharacterized eukaryotic proteins similar to alpha-mannosidases; glycoside hydrolase family 38 (GH38) | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235285 PRK04335, PRK04335, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235850 PRK06669, fliH, flagellar assembly protein H; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|227352 COG5019, CDC3, Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|227880 COG5593, COG5593, Nucleic-acid-binding protein possibly involved in ribosomal biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|215212 PLN02372, PLN02372, violaxanthin de-epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein | Back alignment and domain information |
|---|
| >gnl|CDD|178439 PLN02847, PLN02847, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184899 PRK14906, PRK14906, DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| PLN02701 | 1050 | alpha-mannosidase | 100.0 | |
| KOG1958|consensus | 1129 | 100.0 | ||
| KOG1959|consensus | 996 | 100.0 | ||
| PF01074 | 275 | Glyco_hydro_38: Glycosyl hydrolases family 38 N-te | 99.96 | |
| PRK09819 | 875 | alpha-mannosidase; Provisional | 99.91 | |
| KOG4342|consensus | 1078 | 99.36 | ||
| COG0383 | 943 | AMS1 Alpha-mannosidase [Carbohydrate transport and | 98.6 | |
| COG0383 | 943 | AMS1 Alpha-mannosidase [Carbohydrate transport and | 98.24 | |
| PF03065 | 360 | Glyco_hydro_57: Glycosyl hydrolase family 57; Inte | 93.84 | |
| PF12395 | 111 | DUF3658: Protein of unknown function ; InterPro: I | 81.62 |
| >PLN02701 alpha-mannosidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-49 Score=416.98 Aligned_cols=154 Identities=46% Similarity=0.817 Sum_probs=146.5
Q ss_pred ccchhhhhHHHHHHHhcCCCcccccceeeecCCCCCCCCCceEEEEecCccCCcchhccHHHHHHHHHHHHHHHHHHHHH
Q psy11173 31 KESMGKVYEDEIEFANINGGKWTQGWNIGLDLAHETDPENLLRVFVVPHSHNDPGWKQTFESYFVHSTKSILDTMVTKLL 110 (280)
Q Consensus 31 ~~~ml~~y~~~l~f~~~dgg~wkqG~~i~y~~~~~w~~~~~l~VHVVPHSH~D~GWLkT~eEYy~~~v~~ILdsVl~~L~ 110 (280)
+|||+++| +.|+|+|+|||||||||+|+|+. ++|+ ..+++||||||||||+|||||+++||...+++||++||..|.
T Consensus 2 ~~~~~~~y-~~~~f~~~~gg~w~qg~~~~y~~-~~~~-~~~l~VhlVpHSH~D~gWl~T~~eyy~~~~~~ild~vv~~L~ 78 (1050)
T PLN02701 2 DITTKDLY-DRIEFLDKDGGAWKQGWRVKYRG-DEWD-REKLKVFVVPHSHNDPGWILTVEEYYQEQSRHILDTIVESLS 78 (1050)
T ss_pred ccchhhhh-hcCcccCCCCCeeccccceeecc-cccC-CcceEEEEeCCCCCCHHHcCcHHHHHHHHHHHHHHHHHHHHH
Confidence 79999999 99999999999999999999999 9999 889999999999999999999999999999999999999999
Q ss_pred hCCCCcEEeechHHHHHHHhccChHHHHHHHHHHHcCCceeeccccccccccccccccCC--------------CCCchh
Q psy11173 111 ENEKRKFIWAEMSYLSLWWKTISEDTKDKVRLLVKSGQLEIVTGGWVMTDEANSCNVSDN--------------SGSTDV 176 (280)
Q Consensus 111 ~dp~rkFi~aEisff~~Ww~eq~pe~ke~VKkLVknGRLEfVgGGWVM~DEA~thYeS~~--------------~~Sid~ 176 (280)
+||+|||+|++++||.+||++++|++|++||+||++|||+||||||||||+|++||.|++ +.-+++
T Consensus 79 ~dp~rkFi~~E~~fl~~Ww~~~~pe~~~~vk~LV~~GrLE~vgGgwvm~DEa~~~~esiI~Ql~~G~~~l~~~fG~~P~~ 158 (1050)
T PLN02701 79 KDPRRKFIWEEMSYLERWWRDASPSKKEAFTKLVKNGQLEIVGGGWVMNDEANSHYFAIIEQITEGNMWLNDTIGVAPKN 158 (1050)
T ss_pred hCcCcceeeccHHHHHHHHHhcCHHHHHHHHHHHHcCCEEEECCceecccccccCHHHHHHHHHhhhHHHHhhcCCCCCc
Confidence 999999999999999999999999999999999999999999999999999999999972 222667
Q ss_pred hhcccccCcch
Q psy11173 177 LTHMMPFYKEE 187 (280)
Q Consensus 177 ~~~~~~f~kee 187 (280)
+|+++||||..
T Consensus 159 ~W~iDpFGhs~ 169 (1050)
T PLN02701 159 SWAIDPFGYSS 169 (1050)
T ss_pred CccCCCCCCCH
Confidence 88889999875
|
|
| >KOG1958|consensus | Back alignment and domain information |
|---|
| >KOG1959|consensus | Back alignment and domain information |
|---|
| >PF01074 Glyco_hydro_38: Glycosyl hydrolases family 38 N-terminal domain; InterPro: IPR000602 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK09819 alpha-mannosidase; Provisional | Back alignment and domain information |
|---|
| >KOG4342|consensus | Back alignment and domain information |
|---|
| >COG0383 AMS1 Alpha-mannosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0383 AMS1 Alpha-mannosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF03065 Glyco_hydro_57: Glycosyl hydrolase family 57; InterPro: IPR004300 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF12395 DUF3658: Protein of unknown function ; InterPro: IPR022123 This domain family is found in bacteria, and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 280 | ||||
| 1ps3_A | 1045 | Golgi Alpha-mannosidase Ii In Complex With Kifunens | 2e-34 | ||
| 3dx3_A | 1045 | Golgi Alpha-Mannosidase Ii In Complex With Mannosta | 2e-34 | ||
| 3cv5_A | 1045 | Golgi Mannosidase Ii D204a Catalytic Nucleophile Mu | 2e-34 | ||
| 1qwn_A | 1045 | Golgi Alpha-Mannosidase Ii Covalent Intermediate Co | 2e-34 | ||
| 1qwu_A | 1045 | Golgi Alpha-Mannosidase Ii D341n Mutant Complex Wit | 2e-34 | ||
| 1hxk_A | 1015 | Golgi Alpha-Mannosidase Ii In Complex With Deoxyman | 2e-33 | ||
| 1hty_A | 1015 | Golgi Alpha-Mannosidase Ii Length = 1015 | 4e-33 | ||
| 1o7d_A | 298 | The Structure Of The Bovine Lysosomal A-Mannosidase | 8e-19 |
| >pdb|1PS3|A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine Length = 1045 | Back alignment and structure |
|
| >pdb|3DX3|A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Mannostatin Analog (1r,2r, 3s,4r,5r)-5-Aminocyclopentane-1,2,3,4-Tetraol Length = 1045 | Back alignment and structure |
| >pdb|3CV5|A Chain A, Golgi Mannosidase Ii D204a Catalytic Nucleophile Mutant Complex With 3alpha,6alpha-Mannopentaose Length = 1045 | Back alignment and structure |
| >pdb|1QWN|A Chain A, Golgi Alpha-Mannosidase Ii Covalent Intermediate Complex With 5- Fluoro-Gulosyl-Fluoride Length = 1045 | Back alignment and structure |
| >pdb|1QWU|A Chain A, Golgi Alpha-Mannosidase Ii D341n Mutant Complex With 5-F-Guloside Length = 1045 | Back alignment and structure |
| >pdb|1HXK|A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin Length = 1015 | Back alignment and structure |
| >pdb|1HTY|A Chain A, Golgi Alpha-Mannosidase Ii Length = 1015 | Back alignment and structure |
| >pdb|1O7D|A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation Length = 298 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| 3bvx_A | 1045 | Alpha-mannosidase 2; family 38 glycoysl hydrolase, | 100.0 | |
| 1o7d_A | 298 | Lysosomal alpha-mannosidase; hydrolase, glycosyl h | 100.0 | |
| 2wyh_A | 923 | Alpha-mannosidase; hydrolase, glycosidase, glycosi | 99.95 | |
| 3lvt_A | 899 | Glycosyl hydrolase, family 38; PSI, MCSG, structur | 99.94 | |
| 1k1x_A | 659 | 4-alpha-glucanotransferase; 2.40A {Thermococcus li | 98.83 | |
| 2b5d_X | 528 | Alpha-amylase; (beta/alpha)7 barrel, hydrolase; 2. | 84.3 |
| >3bvx_A Alpha-mannosidase 2; family 38 glycoysl hydrolase, glycosidase, golgi apparatus, membrane, signal-anchor, transmembrane; HET: WZ5; 1.10A {Drosophila melanogaster} SCOP: a.8.3.1 b.30.5.6 c.6.2.1 PDB: 3bud_A 3buq_A* 3bvt_A* 3bui_A* 3bvv_A* 3bvw_A* 3bvu_A* 3cv5_A* 3czn_A* 3czs_A* 2ow6_A* 1r33_A* 1r34_A* 1tqs_A* 1tqt_A* 1tqu_A* 1tqv_A* 1tqw_A* 2alw_A* 2f18_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-40 Score=347.09 Aligned_cols=156 Identities=45% Similarity=0.796 Sum_probs=144.1
Q ss_pred cccchhhhhHHHHHHHhcCCCcccccceeeecCCCCCCCCCceEEEEecCccCCcchhccHHHHHHHHHHHHHHHHHHHH
Q psy11173 30 GKESMGKVYEDEIEFANINGGKWTQGWNIGLDLAHETDPENLLRVFVVPHSHNDPGWKQTFESYFVHSTKSILDTMVTKL 109 (280)
Q Consensus 30 ~~~~ml~~y~~~l~f~~~dgg~wkqG~~i~y~~~~~w~~~~~l~VHVVPHSH~D~GWLkT~eEYy~~~v~~ILdsVl~~L 109 (280)
.++||+++| +.|+|+|++||+|+|||+|.|.. +.|+...+++||||||||+|+|||||+++||...+++||++||..|
T Consensus 41 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~V~lV~HsH~D~gWl~t~~e~~~~~~~~~~~~vl~~L 118 (1045)
T 3bvx_A 41 VDVQMLELY-DRMSFKDIDGGVWKQGWNIKYDP-LKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALRHL 118 (1045)
T ss_dssp CSEEHHHHH-HHCCCCCCCCSSSTTSCCCCCCG-GGSBTTBCEEEEEEEEEECCSSSSSCHHHHHHHTHHHHHHHHHHHH
T ss_pred CCeeHHHHH-hcCCccCCCCccccccchhhhhc-cccCCCCceEEEEEecCCCCccccchHHHhhhHHHHHHHHHHHHHH
Confidence 589999999 99999999999999999999998 8899666999999999999999999999999878999999999999
Q ss_pred HhCCCCcEEeechHHHHHHHhccChHHHHHHHHHHHcCCceeeccccccccccccccccCC--------------CCCch
Q psy11173 110 LENEKRKFIWAEMSYLSLWWKTISEDTKDKVRLLVKSGQLEIVTGGWVMTDEANSCNVSDN--------------SGSTD 175 (280)
Q Consensus 110 ~~dp~rkFi~aEisff~~Ww~eq~pe~ke~VKkLVknGRLEfVgGGWVM~DEA~thYeS~~--------------~~Sid 175 (280)
.++|+|||+|++++||.+||+.++|+++++||+||++|||+||||||||||+|++||+|++ +..++
T Consensus 119 ~~~p~~~F~~~e~~~l~~w~~e~~Pe~~~~vk~lV~~Grle~~gG~Wv~~De~~~~~EslirQl~~G~~~~~~~FG~~~~ 198 (1045)
T 3bvx_A 119 HDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPT 198 (1045)
T ss_dssp HHCTTCCEEECCHHHHHHHHHHSCHHHHHHHHHHHHTTSEEESSCCSSCBCSSSCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_pred HHCCCcEEEEecHHHHHHHHHHCCHHHHHHHHHHHhCCCEEEECCccccccccCCCHHHHHHHHHHHHHHHHHHhCCCCc
Confidence 9999999999999999999999999999999999999999999999999999999999972 33355
Q ss_pred hhhcccccCcch
Q psy11173 176 VLTHMMPFYKEE 187 (280)
Q Consensus 176 ~~~~~~~f~kee 187 (280)
++|+++||++.-
T Consensus 199 ~~W~pD~FG~s~ 210 (1045)
T 3bvx_A 199 ASWAIAPFGHSP 210 (1045)
T ss_dssp EEEECCSSSBCT
T ss_pred eEEcCCCCCccH
Confidence 666677777653
|
| >1o7d_A Lysosomal alpha-mannosidase; hydrolase, glycosyl hydrolase family 38; HET: NAG BMA MAN NDG; 2.70A {Bos taurus} SCOP: c.6.2.1 | Back alignment and structure |
|---|
| >2wyh_A Alpha-mannosidase; hydrolase, glycosidase, glycoside hydrolase; 1.90A {Streptococcus pyogenes} PDB: 2wyi_A* | Back alignment and structure |
|---|
| >3lvt_A Glycosyl hydrolase, family 38; PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.55A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1k1x_A 4-alpha-glucanotransferase; 2.40A {Thermococcus litoralis} SCOP: a.8.3.2 b.30.5.8 c.6.2.2 PDB: 1k1w_A 1k1y_A* | Back alignment and structure |
|---|
| >2b5d_X Alpha-amylase; (beta/alpha)7 barrel, hydrolase; 2.20A {Thermotoga maritima} SCOP: a.8.3.3 c.6.2.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 280 | ||||
| d3bvua3 | 381 | c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fru | 3e-40 | |
| g1o7d.3 | 330 | c.6.2.1 (A:51-342,B:347-384) Lysosomal alpha-manno | 6e-29 | |
| d1k1xa3 | 310 | c.6.2.2 (A:1-310) 4-alpha-glucanotransferase, N-te | 3e-11 | |
| d2es4d1 | 280 | a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) | 0.002 | |
| d1qvra2 | 387 | c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus | 0.003 |
| >d3bvua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 381 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: 7-stranded beta/alpha barrel superfamily: Glycoside hydrolase/deacetylase family: alpha-mannosidase domain: Golgi alpha-mannosidase II species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 141 bits (356), Expect = 3e-40
Identities = 68/133 (51%), Positives = 92/133 (69%), Gaps = 2/133 (1%)
Query: 33 SMGKVYEDEIEFANINGGKWTQGWNIGLDLAHETDPENLLRVFVVPHSHNDPGWKQTFES 92
M ++Y D + F +I+GG W QGWNI D + + + L+VFVVPHSHNDPGW QTFE
Sbjct: 14 QMLELY-DRMSFKDIDGGVWKQGWNIKYD-PLKYNAHHKLKVFVVPHSHNDPGWIQTFEE 71
Query: 93 YFVHSTKSILDTMVTKLLENEKRKFIWAEMSYLSLWWKTISEDTKDKVRLLVKSGQLEIV 152
Y+ H TK IL + L +N + KFIWAE+SY + ++ + E+ K +++ +VK+GQLE V
Sbjct: 72 YYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFV 131
Query: 153 TGGWVMTDEANSC 165
TGGWVM DEANS
Sbjct: 132 TGGWVMPDEANSH 144
|
| >d1k1xa3 c.6.2.2 (A:1-310) 4-alpha-glucanotransferase, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 310 | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| d3bvua3 | 381 | Golgi alpha-mannosidase II {Fruit fly (Drosophila | 100.0 | |
| g1o7d.3 | 330 | Lysosomal alpha-mannosidase {Cow (Bos taurus) [Tax | 100.0 | |
| d1k1xa3 | 310 | 4-alpha-glucanotransferase, N-terminal domain {Arc | 99.62 | |
| d2b5dx2 | 404 | Alpha-amylase AmyC {Thermotoga maritima [TaxId: 23 | 93.7 | |
| d1ufaa2 | 412 | Hypothetical protein TT1467, N-terminal domain {Th | 92.23 |
| >d3bvua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: 7-stranded beta/alpha barrel superfamily: Glycoside hydrolase/deacetylase family: alpha-mannosidase domain: Golgi alpha-mannosidase II species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=100.00 E-value=6.8e-49 Score=371.22 Aligned_cols=158 Identities=44% Similarity=0.774 Sum_probs=149.0
Q ss_pred cccccchhhhhHHHHHHHhcCCCcccccceeeecCCCCCCCCCceEEEEecCccCCcchhccHHHHHHHHHHHHHHHHHH
Q psy11173 28 CIGKESMGKVYEDEIEFANINGGKWTQGWNIGLDLAHETDPENLLRVFVVPHSHNDPGWKQTFESYFVHSTKSILDTMVT 107 (280)
Q Consensus 28 ~~~~~~ml~~y~~~l~f~~~dgg~wkqG~~i~y~~~~~w~~~~~l~VHVVPHSH~D~GWLkT~eEYy~~~v~~ILdsVl~ 107 (280)
+..+|||++|| +.++|+|+|||+|||||+|+|.+ ++|+.+++|+||||||||+|+|||+|+++||...+++||++||.
T Consensus 9 ~~~~~~~~~~~-~~~~f~~~~~~~~~q~~~~~~~~-~~~~~~~kl~VhlV~HsH~D~gWl~t~~e~~~~~~~~il~~~l~ 86 (381)
T d3bvua3 9 PNVDVQMLELY-DRMSFKDIDGGVWKQGWNIKYDP-LKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALR 86 (381)
T ss_dssp CCCSEEHHHHH-HHCCCCCCCCSSSTTSCCCCCCG-GGCBTTBCEEEEEEEEEECCSSSSSCHHHHHHHTHHHHHHHHHH
T ss_pred CccceehHHHH-hhccccCCCCCcccCCcceeech-hhcCcCCCcEEEEeCCCCCChhhcCcHHHHHHHHHHHHHHHHHH
Confidence 45689999999 99999999999999999999999 88997899999999999999999999999998889999999999
Q ss_pred HHHhCCCCcEEeechHHHHHHHhccChHHHHHHHHHHHcCCceeeccccccccccccccccCC--------------CCC
Q psy11173 108 KLLENEKRKFIWAEMSYLSLWWKTISEDTKDKVRLLVKSGQLEIVTGGWVMTDEANSCNVSDN--------------SGS 173 (280)
Q Consensus 108 ~L~~dp~rkFi~aEisff~~Ww~eq~pe~ke~VKkLVknGRLEfVgGGWVM~DEA~thYeS~~--------------~~S 173 (280)
+|.++|.+||+|++++||.+||..++|+++.+||+||++|||+||||||||||+|++||.|++ +..
T Consensus 87 ~l~~~p~~~F~~~~~~~~~~w~~~~~pe~~~~vk~lV~~GrlEivgg~wv~~De~~~~~es~Irql~~G~~~l~~~fG~~ 166 (381)
T d3bvua3 87 HLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVT 166 (381)
T ss_dssp HHHHCTTCCEEECCHHHHHHHHTTSCHHHHHHHHHHHHTTSEEESSCCSSCBCSSSCCHHHHHHHHHHHHHHHHHHHCCC
T ss_pred HHHHCCCCEEEEechHHHHHHHHHcCHHHHHHHHHHHHCCCEEEeCCeeecccccCCCHHHHHHHHHHHHHHHHHHcCCC
Confidence 999999999999999999999999999999999999999999999999999999999999972 445
Q ss_pred chhhhcccccCcch
Q psy11173 174 TDVLTHMMPFYKEE 187 (280)
Q Consensus 174 id~~~~~~~f~kee 187 (280)
++++|+++||+|.-
T Consensus 167 p~~~w~~D~FGhs~ 180 (381)
T d3bvua3 167 PTASWAIAPFGHSP 180 (381)
T ss_dssp CCEEEECSSSSBCT
T ss_pred CceEEeeCCCCccH
Confidence 77888888888863
|
| >d1k1xa3 c.6.2.2 (A:1-310) 4-alpha-glucanotransferase, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|