Psyllid ID: psy11859


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-
MHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSAANQSVDYVGDVKRGSCECADMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTPTFKHRAEKTSTPGPSMCKRHLAKHLKVHERQKYKMMMKSMRKMKNKK
cccccccccccEEEEcHHHHHHHHcccHHHHcccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccccccccccccccccccEEEEEccccccEEEcccccccEEEEEHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHccHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccccHHHHHHHHHHccHHHHHHHccHHHccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccEEEEEEcccEEEEEEEcccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccEEEEcHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEHHcccccccccHHHHHHccccccccccccccccccccEEEEccHHHHHHHHHccccccEEEcccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccEEEEEEccccEcccHHHHHHHHHccHHHHHEEccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccEEEEcccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHcccccccccccccccccccccccccccHHHHHcccEEEEEccccHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHccHHHHHHHHHccHHHcEEEEEccccccccccccHHHHHHHHHHcEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccEEEEEcccccccHHHHHHHHHHccHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHcccccEEEEEccEEEccccccccccEcccccccEEEEEEcccEEEEEEccccccccEEEEEcccccccccHHHHHHHHHHHHcccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccHHHHHHccccHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHccccEEccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mhlleyfttrnwdfKNKRLLALHdnisekdkqtfYIANIDVNIDDYLKTIILGARQYclkeplttlpkARRQIKLYRKTCEELALLgvtesnvylididgngrfpparvkcefqedsTKTIvehnlpdqtdvrgihetDFKFTIKYREFTQEMLSELISHSLYCRQRIKyechqapldlhsatwftsaanqsvdyvgdvkrgscecadmgdvarWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRakrgltpkarlaefsklpvfeRLRKECPAQLSRLHIIEGDilqanlgikdsdllMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFstafchpdqkvleeklypspvsphdIMRAMEWMddetikqltpkilgphpnsytfTKRLTETLVDEyktklpvvivrpsivlpsfqepvpgwvdslngpvGVLVASGKGVVRSMILNDLSTETQVFnissneveaiTWGEIISRGKQLIYQypleaglwypngqirsnrFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHdnisekdkqtfYIANIDVNIDDYLKTIILGARQYclkeplttlpkaRRQIKFLYVLDRIGHALILFLLGsvpklisttglwypngqirsnrFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRhsgersfkcdwqdckwqfsrsdelsrhrrshfgikpypctlcvKKSLLAIlncpheaectptfkhraektstpgpsmckRHLAKHLKVHERQKYKMMMKSMRKMKNKK
mhlleyfttrnwdfknKRLLALHDnisekdkqtfYIANIDVNIDDYLKTIILGARQyclkeplttlpkarrQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDStktivehnlpdqtdvrgiHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSAANQSVDYVGDVKRGSCECADMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRakrgltpkarlaefsklpvferLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKEnvaantrgTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLtpkilgphpnsyTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDnisekdkqtfYIANIDVNIDDYLKTIILGARQYCLkeplttlpkarRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRHSgersfkcdwqdcKWQFSrsdelsrhrrshfgikpypCTLCVKKSLLAILNCPHEAECTPTFkhraektstpgpsmckrhlakhlkvherqkYKMMMKsmrkmknkk
MHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSAANQSVDYVGDVKRGSCECADMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTPTFKHRAEKTSTPGPSMCKRHLAKHLKVHERQkykmmmksmrkmknkk
**LLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSAANQSVDYVGDVKRGSCECADMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPD****************************TIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTP***********************************************
MHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATW*****************************RWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQIL***********************FQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTPTFKHRAEKTSTPG*S***RHL**************************
MHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSAANQSVDYVGDVKRGSCECADMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKA**********FKCDWQDCKWQFS********RRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTPTFKH**********SMCKRHLAKHLKVHERQKYKMM***********
MHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSA******Y************DMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTPTFKH**E*TSTPGPSMCKRHLAKHLKVHERQKYKMM*K*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKLYRKTCEELALLGVTESNVYLIDIDGNGRFPPARVKCEFQEDSTKTIVEHNLPDQTDVRGIHETDFKFTIKYREFTQEMLSELISHSLYCRQRIKYECHQAPLDLHSATWFTSAANQSVDYVGDVKRGSCECADMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGPVGVLVASGKGVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLLGSVPKLISTTGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFENLVRTFQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGIKPYPCTLCVKKSLLAILNCPHEAECTPTFKHRAEKTSTPGPSMCKRHLAKHLKVHERQKYKMMMKSMRKMKNKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query851 2.2.26 [Sep-21-2011]
A1ZAI5625 Putative fatty acyl-CoA r no N/A 0.526 0.716 0.394 1e-98
Q7ZXF5515 Fatty acyl-CoA reductase N/A N/A 0.529 0.875 0.347 2e-83
Q5ZM72515 Fatty acyl-CoA reductase no N/A 0.529 0.875 0.330 1e-82
Q922J9515 Fatty acyl-CoA reductase yes N/A 0.529 0.875 0.332 1e-81
Q5R834515 Fatty acyl-CoA reductase yes N/A 0.529 0.875 0.334 1e-81
Q0P5J1515 Fatty acyl-CoA reductase no N/A 0.513 0.848 0.341 2e-81
Q8WVX9515 Fatty acyl-CoA reductase yes N/A 0.529 0.875 0.332 2e-81
Q960W6516 Putative fatty acyl-CoA r no N/A 0.509 0.841 0.349 3e-81
Q7TNT2515 Fatty acyl-CoA reductase no N/A 0.508 0.840 0.344 5e-80
Q66H50515 Fatty acyl-CoA reductase no N/A 0.529 0.875 0.334 3e-77
>sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 Back     alignment and function desciption
 Score =  361 bits (927), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 187/474 (39%), Positives = 280/474 (59%), Gaps = 26/474 (5%)

Query: 212 VARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLP 271
           +A++YAGRSV +TGGTGFMGKVL+EKLLRSCP+I  +Y+L R KRG    ARL E    P
Sbjct: 119 IAQFYAGRSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARLTELLNAP 178

Query: 272 VFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKE 331
           +FE LR+E P +LS++  I GDI    LGI + D  +L   VSVVF+ AA++K + +LK 
Sbjct: 179 LFESLRQEKPKELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKL 238

Query: 332 NVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEW 391
           +V  N  GT+RL+++  +M  L A IH STA+C+ D+  + E +Y  P +P DI+  + W
Sbjct: 239 SVTINMLGTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPPYNPDDIISLINW 298

Query: 392 MDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGW 451
           + ++ + QLTP+++G  PN+YTFTK L E ++ +    LPV IVRPSIV  S  EP  GW
Sbjct: 299 LPEDILDQLTPRLIGKRPNTYTFTKALAEHMLLKEAGNLPVAIVRPSIVTASLNEPFAGW 358

Query: 452 VDSLNGPVGVLVASGKGVVRSMI-----LNDL---------------------STETQVF 485
           VD+ NGP G++ A  KG+ R+M+     + D+                     S    ++
Sbjct: 359 VDNFNGPTGLVSALAKGMFRTMMCEKNYVADMVPVDIVINLMIAAAWRTATRKSNNLLIY 418

Query: 486 NISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYL 545
           N  + +   I W E +      + ++PLE  LWYP G +R NR  +    I    LPAY+
Sbjct: 419 NCCTGQRNPIIWSEFVKHAMTSVRKHPLEGCLWYPTGDLRMNRPMNTLNCIAKHFLPAYI 478

Query: 546 VDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQTFYI 605
           +D +  ++ +K F+V VQN+I   +  LEYF TR W FK+  + AL   +S KD++ F  
Sbjct: 479 LDGVARIMGKKPFVVNVQNKIAKAVECLEYFATRQWRFKDDNVHALLHTLSPKDREIFVF 538

Query: 606 ANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFL 659
               +N D Y++  +LG R++  K+   +LP +R+++  LY L ++   + + L
Sbjct: 539 DVRHINWDKYVERYVLGFREFLFKQRPESLPASRKRMLRLYYLHQLTKLVAVLL 592




Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: nEC: 2
>sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZM72|FACR1_CHICK Fatty acyl-CoA reductase 1 OS=Gallus gallus GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVX9|FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens GN=FAR1 PE=1 SV=1 Back     alignment and function description
>sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 Back     alignment and function description
>sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query851
193636566517 PREDICTED: putative fatty acyl-CoA reduc 0.527 0.868 0.5 1e-143
157104440502 hypothetical protein AaeL_AAEL014302 [Ae 0.551 0.934 0.476 1e-132
332021395522 Putative fatty acyl-CoA reductase [Acrom 0.541 0.883 0.469 1e-132
383855698519 PREDICTED: putative fatty acyl-CoA reduc 0.531 0.870 0.463 1e-132
322800414523 hypothetical protein SINV_08200 [Solenop 0.518 0.843 0.475 1e-131
300116407466 uncharacterized protein LOC412986 [Apis 0.511 0.933 0.474 1e-131
340729197519 PREDICTED: putative fatty acyl-CoA reduc 0.532 0.872 0.464 1e-130
380017038519 PREDICTED: putative fatty acyl-CoA reduc 0.532 0.872 0.468 1e-129
307168071522 Fatty acyl-CoA reductase 1 [Camponotus f 0.513 0.837 0.510 1e-128
350416860519 PREDICTED: putative fatty acyl-CoA reduc 0.532 0.872 0.458 1e-127
>gi|193636566|ref|XP_001948821.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like isoform 1 [Acyrthosiphon pisum] gi|328724644|ref|XP_003248209.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  516 bits (1329), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 239/478 (50%), Positives = 336/478 (70%), Gaps = 29/478 (6%)

Query: 212 VARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLP 271
           V  WY GRSV +TGGTG+MGKVL+EKLLR C  I  +Y+LCR K+G +P AR+ +  KL 
Sbjct: 6   VCEWYTGRSVFITGGTGYMGKVLIEKLLRDCGGIKTIYVLCRPKKGFSPTARIEQIRKLA 65

Query: 272 VFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKE 331
           VFER+R E P +L ++  +EGD+    LG+   +  +L +EVS+VFNGAASL+LE+ LK+
Sbjct: 66  VFERVRTEFPDRLKKIKAMEGDLGLPGLGLSSENKSILVDEVSIVFNGAASLRLESGLKD 125

Query: 332 NVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEW 391
            +  NT GT+ +LD+A++MK L +F+H STAFCH +   LEE +YPSP +P D+MRA+EW
Sbjct: 126 AIRQNTTGTKHVLDLAVEMKNLASFVHLSTAFCHCEYDTLEETIYPSPANPEDVMRAVEW 185

Query: 392 MDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGW 451
           MDD T++ +TP++LGPHPN YT++KRL E+LV EY  ++P+ + RPSIV PSF++PVPGW
Sbjct: 186 MDDHTLETITPRLLGPHPNCYTYSKRLAESLVSEYANRIPISVARPSIVTPSFKDPVPGW 245

Query: 452 VDSLNGPVGVLVASGKGVVRSM-----------------------------ILNDLSTET 482
           VDSLNGPVGV+VA GKGV+RSM                             I N +    
Sbjct: 246 VDSLNGPVGVIVAGGKGVIRSMLCSPDFEAEVVPVDIAINALVLIAWKRTTIDNTIDDMV 305

Query: 483 QVFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILP 542
             +NIS  ++  +TWGE++++GK+  Y+YP +AGLWYPNG IR+N+F HYF V   Q++P
Sbjct: 306 PCYNISKGDIVRLTWGEVLAKGKRYAYEYPFDAGLWYPNGSIRTNKFVHYFIVFMLQVIP 365

Query: 543 AYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRNWDFKNKRLLALHDNISEKDKQT 602
           AYL+D IM+L RQKTF+VRVQ RI +GM +L+YFT R W+FK +   AL +N++E+D++ 
Sbjct: 366 AYLIDGIMILARQKTFMVRVQKRIAVGMDVLQYFTMRGWNFKIENTKALINNLNEEDRKK 425

Query: 603 FYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKFLYVLDRIGHALILFLL 660
           F+I N +++++ Y+  ++LGARQYC+KEPL  L +AR  +K  Y L+ +   +   LL
Sbjct: 426 FFIQNTEIDVEKYMIQVLLGARQYCMKEPLANLDRARFHLKLQYWLNLVTQLVFGVLL 483




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157104440|ref|XP_001648409.1| hypothetical protein AaeL_AAEL014302 [Aedes aegypti] gi|108869199|gb|EAT33424.1| AAEL014302-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332021395|gb|EGI61763.1| Putative fatty acyl-CoA reductase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383855698|ref|XP_003703347.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322800414|gb|EFZ21418.1| hypothetical protein SINV_08200 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|300116407|ref|NP_001177850.1| uncharacterized protein LOC412986 [Apis mellifera] gi|298569763|gb|ADI87410.1| putative fatty acyl-CoA reductase [Apis mellifera] Back     alignment and taxonomy information
>gi|340729197|ref|XP_003402893.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380017038|ref|XP_003692473.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Apis florea] Back     alignment and taxonomy information
>gi|307168071|gb|EFN61377.1| Fatty acyl-CoA reductase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350416860|ref|XP_003491139.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query851
FB|FBgn0043792506 CG30427 [Drosophila melanogast 0.357 0.600 0.462 4.7e-116
FB|FBgn0039131531 CG12268 [Drosophila melanogast 0.326 0.523 0.412 9.6e-101
FB|FBgn0033464517 CG1441 [Drosophila melanogaste 0.351 0.578 0.403 8.9e-94
FB|FBgn0034145625 CG5065 [Drosophila melanogaste 0.349 0.475 0.449 1.4e-93
ZFIN|ZDB-GENE-060503-367515 si:dkey-97m3.1 "si:dkey-97m3.1 0.353 0.584 0.419 1e-86
UNIPROTKB|Q5ZM72515 FAR1 "Fatty acyl-CoA reductase 0.352 0.582 0.395 3.6e-80
UNIPROTKB|G8ENM4515 FAR1 "Uncharacterized protein" 0.352 0.582 0.385 5.8e-80
UNIPROTKB|A5PJQ0515 FAR1 "Uncharacterized protein" 0.352 0.582 0.388 5.8e-80
RGD|1565966515 Far2 "fatty acyl CoA reductase 0.368 0.609 0.394 1.5e-79
UNIPROTKB|D4A2S1503 Far2 "Protein Far2" [Rattus no 0.368 0.624 0.394 1.5e-79
FB|FBgn0043792 CG30427 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 742 (266.3 bits), Expect = 4.7e-116, Sum P(2) = 4.7e-116
 Identities = 142/307 (46%), Positives = 207/307 (67%)

Query:   208 DMGDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEF 267
             D+  V  +Y  +++ +TG +GFMGKVLLEKLL SC  + +V I+CR KRG  P+ RL E 
Sbjct:     4 DLSPVQEYYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRLEEM 63

Query:   268 SKLPVFERLRKECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEA 327
              KLP+F+R++ E P  L R+ I +GD+    LG+    L  + E  ++VF+ AA+LKLE 
Sbjct:    64 FKLPIFQRIKDERPEMLKRVTIYQGDVTFDQLGLSGESLKHVTENTNIVFHMAATLKLEG 123

Query:   328 ELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMR 387
              L++ +  N  GT+R L++A +MK+L AFIH STAFC+ DQ V+ EK+Y  P  P D+MR
Sbjct:   124 NLRDAIDMNLLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQDVMYEKVYEFPHKPEDLMR 183

Query:   388 AMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEP 447
               EWMD +T+  +TP +L PHPN+YT++KRL E LV ++   +PV+I RPSIV P+  EP
Sbjct:   184 LAEWMDVKTLDAITPDLLKPHPNTYTYSKRLAELLVRDHYESMPVIIARPSIVTPAVAEP 243

Query:   448 VPGWVDSLNGPVGVLVASGKGVVRSMILN-DLSTETQVFNISSNEVEAITWGEIISRGKQ 506
             +PGWVD++NGP GVL+ +GKGV+RSMI N +L +E    +I+ N +  + +   ++  + 
Sbjct:   244 LPGWVDNMNGPTGVLIGAGKGVIRSMICNGELKSEVIPVDIAINGLILLPYHNSLAEKRP 303

Query:   507 LIYQYPL 513
             L  Q P+
Sbjct:   304 L--QIPV 308


GO:0080019 "fatty-acyl-CoA reductase (alcohol-forming) activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
FB|FBgn0039131 CG12268 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033464 CG1441 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034145 CG5065 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-367 si:dkey-97m3.1 "si:dkey-97m3.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM72 FAR1 "Fatty acyl-CoA reductase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G8ENM4 FAR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJQ0 FAR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1565966 Far2 "fatty acyl CoA reductase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2S1 Far2 "Protein Far2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1.103LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query851
cd05236320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 1e-108
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 3e-69
PLN02996491 PLN02996, PLN02996, fatty acyl-CoA reductase 2e-35
PLN02503605 PLN02503, PLN02503, fatty acyl-CoA reductase 2 3e-32
cd0907192 cd09071, FAR_C, C-terminal domain of fatty acyl Co 1e-28
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 2e-24
pfam0301594 pfam03015, Sterile, Male sterility protein 3e-22
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 8e-21
TIGR01746367 TIGR01746, Thioester-redct, thioester reductase do 5e-17
cd0907192 cd09071, FAR_C, C-terminal domain of fatty acyl Co 1e-15
COG3320382 COG3320, COG3320, Putative dehydrogenase domain of 9e-14
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 2e-13
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 8e-12
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 2e-11
pfam0301594 pfam03015, Sterile, Male sterility protein 4e-10
TIGR034431389 TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh 7e-09
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 1e-07
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 3e-07
cd08946200 cd08946, SDR_e, extended (e) SDRs 2e-06
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 2e-06
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 3e-06
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 2e-05
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 3e-05
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 4e-05
cd05265250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 4e-05
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 5e-05
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynt 5e-05
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 6e-05
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 1e-04
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 4e-04
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate 5e-04
PLN02260668 PLN02260, PLN02260, probable rhamnose biosynthetic 8e-04
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 0.001
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 0.003
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 0.004
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
 Score =  335 bits (861), Expect = e-108
 Identities = 138/320 (43%), Positives = 199/320 (62%), Gaps = 26/320 (8%)

Query: 219 RSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRK 278
           +SVL+TG TGF+GKVLLEKLLRSCPDIGK+Y+L R K G + + RL E  K  +F+R R 
Sbjct: 1   KSVLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLRELLKDKLFDRGRN 60

Query: 279 ECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTR 338
             P   S++  IEGD+ + NLG+ D DL  L EEV+++ + AA++  +  L E ++ N  
Sbjct: 61  LNPLFESKIVPIEGDLSEPNLGLSDEDLQTLIEEVNIIIHCAATVTFDERLDEALSINVL 120

Query: 339 GTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETIK 398
           GT RLL++A + KKL AF+H STA+ + D++++EEK+YP P  P  ++  +E MDD  ++
Sbjct: 121 GTLRLLELAKRCKKLKAFVHVSTAYVNGDRQLIEEKVYPPPADPEKLIDILELMDDLELE 180

Query: 399 QLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEPVPGWVDSLNGP 458
           + TPK+LG HPN+YTFTK L E LV + +  LP+VIVRPSIV  + +EP PGW+D+ NGP
Sbjct: 181 RATPKLLGGHPNTYTFTKALAERLVLKERGNLPLVIVRPSIVGATLKEPFPGWIDNFNGP 240

Query: 459 VGVLVASGKGVVRSM--------------------------ILNDLSTETQVFNISSNEV 492
            G+ +A GKG++R+M                                 E +V++  S++V
Sbjct: 241 DGLFLAYGKGILRTMNADPNAVADIIPVDVVANALLAAAAYSGVRKPRELEVYHCGSSDV 300

Query: 493 EAITWGEIISRGKQLIYQYP 512
              TWGE      Q + + P
Sbjct: 301 NPFTWGEAEELINQYLKKNP 320


SDRs are Rossmann-fold NAD(P)H-binding proteins, many of which may function as fatty acyl CoA reductases (FAR), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as biosynthesis of insect pheromones, plant cuticular wax production, and mammalian wax biosynthesis. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols. This N-terminal domain shares the catalytic triad (but not the upstream Asn) and characteristic NADP-binding motif of the extended SDR family. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 320

>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information
>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2 Back     alignment and domain information
>gnl|CDD|176924 cd09071, FAR_C, C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|111859 pfam03015, Sterile, Male sterility protein Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain Back     alignment and domain information
>gnl|CDD|176924 cd09071, FAR_C, C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|111859 pfam03015, Sterile, Male sterility protein Back     alignment and domain information
>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215146 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 851
KOG1221|consensus467 100.0
PLN02996491 fatty acyl-CoA reductase 100.0
PLN02503605 fatty acyl-CoA reductase 2 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 100.0
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.97
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.97
COG3320382 Putative dehydrogenase domain of multifunctional n 99.97
KOG0747|consensus331 99.96
KOG1502|consensus327 99.96
PLN02166436 dTDP-glucose 4,6-dehydratase 99.96
KOG1430|consensus361 99.95
PLN02260668 probable rhamnose biosynthetic enzyme 99.95
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.95
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.95
PRK07201657 short chain dehydrogenase; Provisional 99.95
PLN02572442 UDP-sulfoquinovose synthase 99.95
PLN02427386 UDP-apiose/xylose synthase 99.95
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.95
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.95
PLN02206442 UDP-glucuronate decarboxylase 99.95
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.95
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.95
PLN02214342 cinnamoyl-CoA reductase 99.94
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.94
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.94
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.94
KOG1371|consensus343 99.94
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.94
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.94
PLN00198338 anthocyanidin reductase; Provisional 99.94
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.94
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.94
PLN02896353 cinnamyl-alcohol dehydrogenase 99.94
PLN02650351 dihydroflavonol-4-reductase 99.93
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.93
PLN02653340 GDP-mannose 4,6-dehydratase 99.93
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.93
PLN02240352 UDP-glucose 4-epimerase 99.93
PF0301594 Sterile: Male sterility protein; InterPro: IPR0042 99.93
PLN02686367 cinnamoyl-CoA reductase 99.92
KOG1429|consensus350 99.92
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.92
PLN02583297 cinnamoyl-CoA reductase 99.92
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.92
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.92
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.92
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.91
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.91
PLN02778298 3,5-epimerase/4-reductase 99.91
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.91
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.91
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.9
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.9
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.89
KOG2462|consensus279 99.89
CHL00194317 ycf39 Ycf39; Provisional 99.88
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.87
cd0907192 FAR_C C-terminal domain of fatty acyl CoA reductas 99.87
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.87
PLN02260668 probable rhamnose biosynthetic enzyme 99.84
KOG2462|consensus279 99.84
PLN00016378 RNA-binding protein; Provisional 99.82
PRK12320 699 hypothetical protein; Provisional 99.82
PRK05865 854 hypothetical protein; Provisional 99.81
PRK06482276 short chain dehydrogenase; Provisional 99.78
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.77
PRK09135249 pteridine reductase; Provisional 99.74
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.72
PF0301594 Sterile: Male sterility protein; InterPro: IPR0042 99.71
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.69
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.69
KOG1431|consensus315 99.68
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.68
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.68
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.67
PLN03209576 translocon at the inner envelope of chloroplast su 99.67
KOG1221|consensus467 99.67
PRK07774250 short chain dehydrogenase; Provisional 99.66
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.66
PRK05875276 short chain dehydrogenase; Provisional 99.64
PRK06180277 short chain dehydrogenase; Provisional 99.64
PRK12827249 short chain dehydrogenase; Provisional 99.64
PRK08263275 short chain dehydrogenase; Provisional 99.64
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.63
KOG1074|consensus 958 99.63
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.62
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.62
KOG2865|consensus391 99.62
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.61
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.61
cd0907192 FAR_C C-terminal domain of fatty acyl CoA reductas 99.61
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.61
PRK12746254 short chain dehydrogenase; Provisional 99.61
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.6
PRK06123248 short chain dehydrogenase; Provisional 99.6
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.59
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.59
PRK09186256 flagellin modification protein A; Provisional 99.59
PRK12829264 short chain dehydrogenase; Provisional 99.58
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.58
PRK07890258 short chain dehydrogenase; Provisional 99.58
PRK06179270 short chain dehydrogenase; Provisional 99.58
PRK05717255 oxidoreductase; Validated 99.58
PRK06196315 oxidoreductase; Provisional 99.58
PRK07806248 short chain dehydrogenase; Provisional 99.58
PRK06914280 short chain dehydrogenase; Provisional 99.58
PRK06128300 oxidoreductase; Provisional 99.58
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.58
PRK06194287 hypothetical protein; Provisional 99.58
PRK06138252 short chain dehydrogenase; Provisional 99.58
PRK09134258 short chain dehydrogenase; Provisional 99.57
PRK07074257 short chain dehydrogenase; Provisional 99.57
PRK12937245 short chain dehydrogenase; Provisional 99.57
PRK07067257 sorbitol dehydrogenase; Provisional 99.57
PRK05993277 short chain dehydrogenase; Provisional 99.56
PRK06182273 short chain dehydrogenase; Validated 99.56
PRK06500249 short chain dehydrogenase; Provisional 99.56
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.56
PRK07775274 short chain dehydrogenase; Provisional 99.56
PRK08628258 short chain dehydrogenase; Provisional 99.56
PRK05876275 short chain dehydrogenase; Provisional 99.55
PRK12828239 short chain dehydrogenase; Provisional 99.55
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.55
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PRK09291257 short chain dehydrogenase; Provisional 99.55
PRK08264238 short chain dehydrogenase; Validated 99.55
PRK06197306 short chain dehydrogenase; Provisional 99.55
PRK07024257 short chain dehydrogenase; Provisional 99.55
PRK06701290 short chain dehydrogenase; Provisional 99.54
PRK07814263 short chain dehydrogenase; Provisional 99.53
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.53
PRK07326237 short chain dehydrogenase; Provisional 99.53
PRK08643256 acetoin reductase; Validated 99.53
PRK10538248 malonic semialdehyde reductase; Provisional 99.53
PRK07060245 short chain dehydrogenase; Provisional 99.53
PRK06949258 short chain dehydrogenase; Provisional 99.53
PRK06523260 short chain dehydrogenase; Provisional 99.52
PRK06181263 short chain dehydrogenase; Provisional 99.52
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.52
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.52
PRK06398258 aldose dehydrogenase; Validated 99.52
PLN02253280 xanthoxin dehydrogenase 99.52
PRK08251248 short chain dehydrogenase; Provisional 99.52
PRK07454241 short chain dehydrogenase; Provisional 99.52
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.52
PRK07985294 oxidoreductase; Provisional 99.52
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.51
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK07577234 short chain dehydrogenase; Provisional 99.51
PRK06101240 short chain dehydrogenase; Provisional 99.51
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.5
KOG3576|consensus267 99.5
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.5
PRK12939250 short chain dehydrogenase; Provisional 99.5
PRK07102243 short chain dehydrogenase; Provisional 99.5
PRK08226263 short chain dehydrogenase; Provisional 99.49
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.49
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.48
PRK12747252 short chain dehydrogenase; Provisional 99.48
PRK08267260 short chain dehydrogenase; Provisional 99.48
PRK12743256 oxidoreductase; Provisional 99.48
PRK07063260 short chain dehydrogenase; Provisional 99.48
PRK07856252 short chain dehydrogenase; Provisional 99.48
PRK08219227 short chain dehydrogenase; Provisional 99.48
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.48
PRK06841255 short chain dehydrogenase; Provisional 99.48
PRK05866293 short chain dehydrogenase; Provisional 99.48
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.48
PRK12742237 oxidoreductase; Provisional 99.47
PRK05693274 short chain dehydrogenase; Provisional 99.47
PRK07478254 short chain dehydrogenase; Provisional 99.47
PRK05867253 short chain dehydrogenase; Provisional 99.47
PRK08277278 D-mannonate oxidoreductase; Provisional 99.47
PRK07035252 short chain dehydrogenase; Provisional 99.47
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PRK06114254 short chain dehydrogenase; Provisional 99.47
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.46
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.46
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.46
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.46
PRK09242257 tropinone reductase; Provisional 99.46
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.46
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.45
PRK08278273 short chain dehydrogenase; Provisional 99.45
PRK12744257 short chain dehydrogenase; Provisional 99.45
PRK08017256 oxidoreductase; Provisional 99.45
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.45
PRK06947248 glucose-1-dehydrogenase; Provisional 99.44
PRK06057255 short chain dehydrogenase; Provisional 99.44
PRK05650270 short chain dehydrogenase; Provisional 99.44
PRK06172253 short chain dehydrogenase; Provisional 99.44
PRK07576264 short chain dehydrogenase; Provisional 99.44
PRK08703239 short chain dehydrogenase; Provisional 99.43
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.43
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.43
KOG1074|consensus 958 99.43
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.43
PRK06198260 short chain dehydrogenase; Provisional 99.42
PRK07677252 short chain dehydrogenase; Provisional 99.42
PRK07904253 short chain dehydrogenase; Provisional 99.42
PRK09072263 short chain dehydrogenase; Provisional 99.42
PRK08589272 short chain dehydrogenase; Validated 99.42
PRK07825273 short chain dehydrogenase; Provisional 99.42
PRK08265261 short chain dehydrogenase; Provisional 99.42
KOG3608|consensus 467 99.41
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.41
PRK07023243 short chain dehydrogenase; Provisional 99.41
PRK08936261 glucose-1-dehydrogenase; Provisional 99.41
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.41
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.41
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.4
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.4
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.39
PRK05854313 short chain dehydrogenase; Provisional 99.39
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.39
PRK07109334 short chain dehydrogenase; Provisional 99.39
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.38
PRK06953222 short chain dehydrogenase; Provisional 99.37
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.37
PRK05872296 short chain dehydrogenase; Provisional 99.37
PRK07201657 short chain dehydrogenase; Provisional 99.37
PRK07069251 short chain dehydrogenase; Validated 99.37
PRK08177225 short chain dehydrogenase; Provisional 99.37
PRK07831262 short chain dehydrogenase; Provisional 99.36
PRK07832272 short chain dehydrogenase; Provisional 99.36
PRK08324681 short chain dehydrogenase; Validated 99.36
PRK05855582 short chain dehydrogenase; Validated 99.35
PRK06139330 short chain dehydrogenase; Provisional 99.34
PRK07041230 short chain dehydrogenase; Provisional 99.34
PRK06924251 short chain dehydrogenase; Provisional 99.34
PRK07062265 short chain dehydrogenase; Provisional 99.33
PRK08339263 short chain dehydrogenase; Provisional 99.32
PRK06483236 dihydromonapterin reductase; Provisional 99.32
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.32
PRK06940275 short chain dehydrogenase; Provisional 99.32
KOG1372|consensus376 99.31
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.3
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.29
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.29
PLN02503605 fatty acyl-CoA reductase 2 99.29
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.29
PRK06484520 short chain dehydrogenase; Validated 99.28
KOG3623|consensus1007 99.28
PLN02780320 ketoreductase/ oxidoreductase 99.26
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.26
PRK12367245 short chain dehydrogenase; Provisional 99.26
PRK05884223 short chain dehydrogenase; Provisional 99.25
PRK07578199 short chain dehydrogenase; Provisional 99.25
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.24
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.24
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.23
PRK09009235 C factor cell-cell signaling protein; Provisional 99.22
PRK07791286 short chain dehydrogenase; Provisional 99.21
PRK08340259 glucose-1-dehydrogenase; Provisional 99.2
PRK06125259 short chain dehydrogenase; Provisional 99.2
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.19
KOG3623|consensus1007 99.19
KOG3576|consensus267 99.19
PLN02996491 fatty acyl-CoA reductase 99.19
PRK06484520 short chain dehydrogenase; Validated 99.18
KOG1205|consensus282 99.18
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.17
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.17
COG0300265 DltE Short-chain dehydrogenases of various substra 99.17
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.14
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.13
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.13
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.12
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.12
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.12
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.11
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.11
KOG2774|consensus366 99.1
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.08
KOG3608|consensus467 99.08
KOG4039|consensus238 99.06
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.05
PRK08303305 short chain dehydrogenase; Provisional 99.03
PRK08862227 short chain dehydrogenase; Provisional 99.01
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 98.99
PLN00015308 protochlorophyllide reductase 98.98
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.98
PRK05599246 hypothetical protein; Provisional 98.95
KOG1201|consensus300 98.89
KOG1203|consensus411 98.85
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.78
KOG1208|consensus314 98.78
PLN03086567 PRLI-interacting factor K; Provisional 98.76
COG1028251 FabG Dehydrogenases with different specificities ( 98.76
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.75
KOG4288|consensus283 98.73
KOG0725|consensus270 98.72
PLN03086567 PRLI-interacting factor K; Provisional 98.7
PLN02730303 enoyl-[acyl-carrier-protein] reductase 98.65
PTZ00325321 malate dehydrogenase; Provisional 98.62
KOG4169|consensus261 98.62
PLN00106323 malate dehydrogenase 98.57
COG2910211 Putative NADH-flavin reductase [General function p 98.57
KOG1610|consensus322 98.57
PHA00733128 hypothetical protein 98.52
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.52
PRK14982340 acyl-ACP reductase; Provisional 98.47
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.45
PHA00733128 hypothetical protein 98.41
KOG1611|consensus249 98.36
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.35
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 98.34
KOG1200|consensus256 98.34
PRK08309177 short chain dehydrogenase; Provisional 98.33
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 98.33
PRK09620229 hypothetical protein; Provisional 98.32
KOG1207|consensus245 98.32
PHA0276855 hypothetical protein; Provisional 98.3
KOG1210|consensus331 98.3
PHA0276855 hypothetical protein; Provisional 98.26
PRK06720169 hypothetical protein; Provisional 98.21
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.16
KOG1209|consensus289 98.15
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 98.13
KOG3019|consensus315 97.94
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.88
PRK05086312 malate dehydrogenase; Provisional 97.87
KOG1204|consensus253 97.86
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.62
PHA0061644 hypothetical protein 97.61
KOG1014|consensus312 97.55
PHA0061644 hypothetical protein 97.51
KOG1478|consensus341 97.48
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.48
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.48
KOG1199|consensus260 97.44
KOG3993|consensus500 97.42
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 97.31
PHA0073279 hypothetical protein 97.28
PRK10124463 putative UDP-glucose lipid carrier transferase; Pr 97.27
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.23
PHA0073279 hypothetical protein 97.18
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polypr 97.17
KOG3993|consensus500 97.17
TIGR03023451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp 97.14
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.09
KOG2733|consensus423 97.09
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 97.01
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.93
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 96.82
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.79
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.75
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.66
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.59
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.58
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.54
TIGR03022456 WbaP_sugtrans Undecaprenyl-phosphate galactose pho 96.5
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 96.49
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.48
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 96.38
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 96.24
COG5189423 SFP1 Putative transcriptional repressor regulating 96.17
PRK05442326 malate dehydrogenase; Provisional 96.13
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 96.13
PRK08223287 hypothetical protein; Validated 96.05
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 96.04
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.0
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.97
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.86
KOG3516|consensus1306 95.83
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.78
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.72
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.69
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.69
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 95.45
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.44
PRK00048257 dihydrodipicolinate reductase; Provisional 95.43
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 95.41
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.36
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 95.33
COG0623259 FabI Enoyl-[acyl-carrier-protein] 95.28
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 95.24
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.22
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.12
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.11
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.07
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.02
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.96
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.96
COG5048467 FOG: Zn-finger [General function prediction only] 94.93
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 94.86
PRK15204476 undecaprenyl-phosphate galactose phosphotransferas 94.79
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.78
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 94.69
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 94.68
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 94.62
KOG1202|consensus2376 94.58
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 94.58
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 94.57
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 94.57
COG3268382 Uncharacterized conserved protein [Function unknow 94.55
PLN00112444 malate dehydrogenase (NADP); Provisional 94.52
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 94.44
PRK08328231 hypothetical protein; Provisional 94.43
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.4
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.35
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.31
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 94.15
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 94.12
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 93.91
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 93.77
PRK07877722 hypothetical protein; Provisional 93.76
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.74
PRK04860160 hypothetical protein; Provisional 93.69
PRK07411390 hypothetical protein; Validated 93.69
COG4982866 3-oxoacyl-[acyl-carrier protein] 93.67
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.49
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.41
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 93.4
PRK06153393 hypothetical protein; Provisional 93.36
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 93.32
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.26
TIGR03013442 EpsB_2 sugar transferase, PEP-CTERM system associa 93.19
COG5189423 SFP1 Putative transcriptional repressor regulating 93.13
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 92.96
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.78
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 92.67
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 92.63
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 92.47
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 92.46
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 92.32
PLN02383344 aspartate semialdehyde dehydrogenase 92.31
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.17
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 92.14
PRK09496453 trkA potassium transporter peripheral membrane com 92.06
smart0035526 ZnF_C2H2 zinc finger. 92.01
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.97
KOG4022|consensus236 91.81
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 91.77
PTZ00117319 malate dehydrogenase; Provisional 91.64
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.58
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 91.47
PRK04860160 hypothetical protein; Provisional 91.05
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 91.03
PRK08040336 putative semialdehyde dehydrogenase; Provisional 91.02
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 90.97
PLN02602350 lactate dehydrogenase 90.58
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 90.56
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 90.44
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 90.19
PRK06223307 malate dehydrogenase; Reviewed 90.14
COG5048467 FOG: Zn-finger [General function prediction only] 90.12
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 89.98
PRK14851679 hypothetical protein; Provisional 89.95
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 89.89
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 89.84
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.83
PF12683275 DUF3798: Protein of unknown function (DUF3798); In 89.75
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 89.66
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.63
smart0035526 ZnF_C2H2 zinc finger. 89.42
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 89.19
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 89.17
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 89.08
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 88.95
KOG2013|consensus603 88.42
KOG1494|consensus345 88.4
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 88.38
PTZ00082321 L-lactate dehydrogenase; Provisional 87.84
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 87.82
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 87.75
TIGR00036266 dapB dihydrodipicolinate reductase. 87.39
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 87.36
PRK14852989 hypothetical protein; Provisional 87.2
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 87.1
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 86.77
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 86.57
PRK04148134 hypothetical protein; Provisional 86.2
KOG0023|consensus360 85.39
PRK06718202 precorrin-2 dehydrogenase; Reviewed 85.21
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 85.0
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 84.89
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 84.71
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 84.56
KOG1178|consensus1032 84.38
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 84.36
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 84.18
KOG1496|consensus332 84.1
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 83.72
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 83.45
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 83.28
PRK12549284 shikimate 5-dehydrogenase; Reviewed 83.25
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 82.98
KOG2018|consensus430 82.74
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.67
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 82.37
PRK13940414 glutamyl-tRNA reductase; Provisional 82.32
KOG2231|consensus 669 82.27
PRK13304265 L-aspartate dehydrogenase; Reviewed 82.15
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 81.75
>KOG1221|consensus Back     alignment and domain information
Probab=100.00  E-value=7.2e-90  Score=756.71  Aligned_cols=435  Identities=39%  Similarity=0.724  Sum_probs=424.1

Q ss_pred             cchhhhcCCCEEEEecCccHHHHHHHHHHHHhCCCccEEEEEecCCCCCCHHHHHHHHhcChhhHHHhhhCcccCCCeEE
Q psy11859        210 GDVARWYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHI  289 (851)
Q Consensus       210 ~~i~~~~~~k~VlVTGatGFIG~~Lv~~Ll~~g~~v~~V~~l~R~~~~~~~~~rl~~~~~~~~f~~l~~~~~~~~~~v~~  289 (851)
                      ++|.+||+||+|||||||||+|+.|+|+||+..|+|++||+|+|++++.++.+|+.+....++|+.|++..|+..+|+.+
T Consensus         4 ~~i~~f~~~k~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~p~~l~Kv~p   83 (467)
T KOG1221|consen    4 SDIVQFYKNKTIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKKPEALEKVVP   83 (467)
T ss_pred             ccHHHHhCCCeEEEEcccchhHHHHHHHHHhcCcCcceEEEEEecCCCCCHHHHHHHHHhhhHHHHHHhhCccceeccee
Confidence            45999999999999999999999999999999999999999999999999999999998889999999999999999999


Q ss_pred             EEcCCCCCcCCCCHHHHHHHhcCccEEEEccccCCcchhHHHHHHHHHHHHHHHHHHHHhcCCceEEEEeeeeeeeCCCc
Q psy11859        290 IEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQK  369 (851)
Q Consensus       290 v~gDi~~~~lgls~~~~~~~~~~vd~ViH~AA~~~~~~~~~~~~~~Nv~Gt~~ll~~a~~~~~~~~fV~vSTa~~~~~~~  369 (851)
                      |.||+.+++||+|+.++..+.++||+|||+||+++|+++++.++.+|+.||++++++|+++.+++.|||+||||+++...
T Consensus        84 i~GDi~~~~LGis~~D~~~l~~eV~ivih~AAtvrFde~l~~al~iNt~Gt~~~l~lak~~~~l~~~vhVSTAy~n~~~~  163 (467)
T KOG1221|consen   84 IAGDISEPDLGISESDLRTLADEVNIVIHSAATVRFDEPLDVALGINTRGTRNVLQLAKEMVKLKALVHVSTAYSNCNVG  163 (467)
T ss_pred             ccccccCcccCCChHHHHHHHhcCCEEEEeeeeeccchhhhhhhhhhhHhHHHHHHHHHHhhhhheEEEeehhheecccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998889


Q ss_pred             ccccccCCCCC--CHHHHHHHHhhccHHHHhhhCCcccCCCCchhhHHHHHHHHHHHHHhCCCCEEEEecccccCCCCCC
Q psy11859        370 VLEEKLYPSPV--SPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKTKLPVVIVRPSIVLPSFQEP  447 (851)
Q Consensus       370 ~i~E~~~~~p~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~Y~~SK~~aE~~v~~~~~~l~~~ivRp~~V~G~~~~p  447 (851)
                      .++|..|+.+.  ++++++++.++++++.++++++++.++|||||++||++||+++.+++.++|++|+||++|++++.+|
T Consensus       164 ~i~E~~y~~~~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~~~~lPivIiRPsiI~st~~EP  243 (467)
T KOG1221|consen  164 HIEEKPYPMPETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKEAENLPLVIIRPSIITSTYKEP  243 (467)
T ss_pred             cccccccCccccCCHHHHHhhhccchHHHHHHhhHHhcCCCCCceeehHhhHHHHHHhhccCCCeEEEcCCceeccccCC
Confidence            99999999988  8999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhHhhhhcCCceEEEEcccCceeEEEeecC-------------------------C--CCccEEEEeCCCCccccHHHH
Q psy11859        448 VPGWVDSLNGPVGVLVASGKGVVRSMILNDL-------------------------S--TETQVFNISSNEVEAITWGEI  500 (851)
Q Consensus       448 ~p~~i~~~~~~~~~~~~~g~~v~~~~~~~~~-------------------------~--~~~~iyni~~~~~~~~t~~el  500 (851)
                      +|||+++++|+.++++|.|+|+++.+.++++                         .  ....|||+++++.||++|+++
T Consensus       244 ~pGWidn~~gp~g~i~g~gkGvlr~~~~d~~~~adiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY~~tss~~Np~t~~~~  323 (467)
T KOG1221|consen  244 FPGWIDNLNGPDGVIIGYGKGVLRCFLVDPKAVADIIPVDMVVNAMIASAWQHAGNSKEKTPPIYHLTSSNDNPVTWGDF  323 (467)
T ss_pred             CCCccccCCCCceEEEEeccceEEEEEEccccccceeeHHHHHHHHHHHHHHHhccCCCCCCcEEEecccccCcccHHHH
Confidence            9999999999999999999999999999887                         1  125699999999999999999


Q ss_pred             HHHHHHHhhcCCCCCccccCcceeccchHHHHHHHHHHHHHHHHHHHHHHHHcCCChHHHHHHHHHHHHHHhccccccCe
Q psy11859        501 ISRGKQLIYQYPLEAGLWYPNGQIRSNRFWHYFFVIFTQILPAYLVDFIMVLIRQKTFLVRVQNRIWLGMHLLEYFTTRN  580 (851)
Q Consensus       501 ~~~~~~~~~~~p~~~~~~~p~~~~~~~~~~~~~~~~~~~~lpa~~~d~~~~l~G~~p~l~~~~~ki~~~~~~~~~f~~~~  580 (851)
                      .+...++....|+...+|+|.+..+++.+.|.+..+++|++||+++|+++++.|++|.+.+++++|++...+++||+.++
T Consensus       324 ~e~~~~~~~~~Pl~~~iw~P~~~~~sn~~~f~~~~~~~h~lPa~~~d~~~~i~g~k~~~~k~~~ki~~~~~~l~~f~~~~  403 (467)
T KOG1221|consen  324 IELALRYFEKIPLEKMIWYPFGTLTSNPWLFNLAAFLYHTLPAYILDLLLRLLGKKPRLVKLYRKIHKLVKLLEPFSLFK  403 (467)
T ss_pred             HHHHHHhcccCCcccceeccCceeeecHhHHHHHHHHHHHhhHHHHHHHHHHhCCChhhhHHHHHHHHHHHhhhhheece
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcChhHHHHHHhcCccCCCccccccccCCHHHHHHHHHHHHHHhhhCCCCCChHHHHHHHHH
Q psy11859        581 WDFKNKRLLALHDNISEKDKQTFYIANIDVNIDDYLKTIILGARQYCLKEPLTTLPKARRQIKF  644 (851)
Q Consensus       581 w~f~~~n~~~l~~~l~~~d~~~F~~d~~~i~W~~Y~~~~~~GirkyllKe~~~~l~~a~~~~~~  644 (851)
                      |.|+++|+.+|+++|+++||++|+||++++||++|+.++++|+|+|++||+++++|+||+++++
T Consensus       404 w~Fd~~n~~~L~~~~~~~d~~~f~fd~~~ldW~ey~~~~i~G~r~~llKe~~e~l~~~r~~~kr  467 (467)
T KOG1221|consen  404 WIFDNKNTEKLREKMSEEDKRLFNFDMKQLDWEEYFNRHLLGLRKYLLKESPESLPQARKRLKR  467 (467)
T ss_pred             EEecCccHHHHHHhCCHHHHhhcCCCcccCCHHHHHHHHHHHHHHHHhcCChhhhHHHHHhhcC
Confidence            9999999999999999999999999999999999999999999999999999999999998864



>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF03015 Sterile: Male sterility protein; InterPro: IPR004262 This family represents the C-terminal region of the male sterility protein in a number of organisms Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>cd09071 FAR_C C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03015 Sterile: Male sterility protein; InterPro: IPR004262 This family represents the C-terminal region of the male sterility protein in a number of organisms Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd09071 FAR_C C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG4288|consensus Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>KOG3019|consensus Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR03022 WbaP_sugtrans Undecaprenyl-phosphate galactose phosphotransferase, WbaP Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK15204 undecaprenyl-phosphate galactose phosphotransferase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR03013 EpsB_2 sugar transferase, PEP-CTERM system associated Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2013|consensus Back     alignment and domain information
>KOG1494|consensus Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>KOG1496|consensus Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query851
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-19
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-19
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-17
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-17
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 4e-16
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-11
4dqv_A478 Crystal Structure Of Reductase (R) Domain Of Non-Ri 2e-09
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-09
2ent_A48 Solution Structure Of The Second C2h2-Type Zinc Fin 3e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 9e-09
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 6e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-06
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-06
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 4e-05
2udp_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 5e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 6e-05
1kvr_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 7e-05
1kvs_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 8e-05
1kvu_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 9e-05
1a9y_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 1e-04
1lrj_A338 Crystal Structure Of E. Coli Udp-Galactose 4-Epimer 2e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-04
1lrk_A338 Crystal Structure Of Escherichia Coli Udp-Galactose 2e-04
1kvq_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 3e-04
1kvt_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 3e-04
1a9z_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 5e-04
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure

Iteration: 1

Score = 93.2 bits (230), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 39/70 (55%), Positives = 49/70 (70%) Query: 718 RTFQCTYPECLKFYAKMSHLKAHLRRHSGERSFKCDWQDCKWQFSRSDELSRHRRSHFGI 777 R C YP C K Y K SHLKAHLR H+GE+ +KC W+ C W+F+RSDEL+RH R H G Sbjct: 14 RIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGA 73 Query: 778 KPYPCTLCVK 787 KP+ C +C + Sbjct: 74 KPFQCGVCNR 83
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|4DQV|A Chain A, Crystal Structure Of Reductase (R) Domain Of Non-Ribosomal Peptide Synthetase From Mycobacterium Tuberculosis Length = 478 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2ENT|A Chain A, Solution Structure Of The Second C2h2-Type Zinc Finger Domain From Human Krueppel-Like Factor 15 Length = 48 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2UDP|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1KVR|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVS|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVU|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1A9Y|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Glucose Length = 338 Back     alignment and structure
>pdb|1LRJ|A Chain A, Crystal Structure Of E. Coli Udp-Galactose 4-Epimerase Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1LRK|A Chain A, Crystal Structure Of Escherichia Coli Udp-Galactose 4-Epimerase Mutant Y299c Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|1KVQ|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVT|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1A9Z|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Galactose Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query851
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 2e-43
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-35
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-33
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-15
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-28
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-27
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-23
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-22
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-21
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-04
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-17
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-13
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-12
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 8e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-09
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 6e-12
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 3e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 8e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-08
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-10
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 1e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-09
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 8e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 3e-08
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 3e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 4e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 5e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 2e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-07
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 5e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 8e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 2e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 2e-05
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
3slg_A372 PBGP3 protein; structural genomics, seattle struct 5e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-05
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 7e-05
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 8e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-04
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 2e-04
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 2e-04
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 2e-04
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 3e-04
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 3e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 4e-04
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 6e-04
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
 Score =  163 bits (414), Expect = 2e-43
 Identities = 70/337 (20%), Positives = 114/337 (33%), Gaps = 54/337 (16%)

Query: 218 GRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLR 277
            R+VL+TG TGF+G+ L+ +LLR     G++  L RA+     + RL +       E LR
Sbjct: 73  LRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELLR 132

Query: 278 KECPAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELKENVAANT 337
                   RL ++ GD  + +LG+       L E V ++ + AA +       E    N 
Sbjct: 133 HFKELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAF-PYHELFGPNV 191

Query: 338 RGTQRLLDIALKMKKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAMEWMDDETI 397
            GT  L+ IAL   KL  F + STA                 V       A     D  +
Sbjct: 192 AGTAELIRIALTT-KLKPFTYVSTAD----------------VGAAIEPSAFTEDADIRV 234

Query: 398 KQLTPKILGPHPNSYTFTKRLTETLVDEY--KTKLPVVIVRPSIVL----PSFQEPVPGW 451
              T  + G     Y  +K   E L+ E      LPV + R  ++L     + Q  +  W
Sbjct: 235 ISPTRTVDGGWAGGYGTSKWAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDW 294

Query: 452 VDSL-------------NGPVGVLVASGKG---------VVRSMI------LNDLSTETQ 483
           V  +                        +          V  ++                
Sbjct: 295 VTRMVLSLMATGIAPRSFYEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFA 354

Query: 484 VFNISSNEVEAITWGEIISRGKQLIYQYPLEAGLWYP 520
            +++ +   + I   E +    +    YP+     + 
Sbjct: 355 TYHVMNPHDDGIGLDEYVDWLIE--AGYPIRRIDDFA 389


>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query851
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.97
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.97
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.97
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.96
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.96
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.96
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.96
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.96
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.96
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.96
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.96
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.96
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.96
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.95
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.95
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.95
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.95
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.95
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.95
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.95
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.95
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.95
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.95
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.95
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.95
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.95
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.95
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.95
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.95
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.95
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.95
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.94
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.94
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.94
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.94
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.94
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.94
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.94
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.94
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.94
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.94
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.94
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.94
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.94
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.94
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.93
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.93
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.93
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.93
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.93
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.93
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.93
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.93
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.93
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.93
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.93
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.93
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.93
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.93
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.93
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.92
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.92
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.92
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 99.92
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.91
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.91
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.9
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.9
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.9
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.9
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.89
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.89
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.88
1xq6_A253 Unknown protein; structural genomics, protein stru 99.87
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.87
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.87
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.86
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.86
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.85
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.85
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.84
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.83
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.83
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.82
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.82
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.81
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.8
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.79
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.78
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.78
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.78
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.78
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.78
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.77
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.77
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.77
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.76
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.76
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.75
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.75
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.75
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.74
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.74
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.74
1spx_A278 Short-chain reductase family member (5L265); paral 99.74
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.73
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.72
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.72
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.72
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.72
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.72
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.71
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.71
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.71
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.71
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.7
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.7
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.7
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.7
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.7
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.7
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.7
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.7
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.7
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.7
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.69
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.69
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.69
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.69
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.69
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.69
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.69
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.69
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.69
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.68
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.68
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.68
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.68
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.68
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.68
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.67
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.67
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.67
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.67
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.67
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.67
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.67
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.67
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.67
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.66
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.66
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.66
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.66
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.66
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.66
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.66
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.66
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.66
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.66
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.65
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.65
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.65
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.65
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.65
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.65
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.65
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.65
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.65
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.65
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.65
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.65
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.65
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.65
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.65
3rih_A293 Short chain dehydrogenase or reductase; structural 99.65
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.65
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.65
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.65
3cxt_A291 Dehydrogenase with different specificities; rossma 99.64
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.64
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.64
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.64
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.64
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.64
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.64
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.64
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.64
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.64
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.64
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.64
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.64
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.64
1xkq_A280 Short-chain reductase family member (5D234); parra 99.64
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.64
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.63
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.63
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.63
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.63
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.63
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.63
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.63
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.63
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.63
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.63
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.63
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.63
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.63
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.63
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.63
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.63
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.63
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.63
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.62
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.62
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.62
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.62
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.62
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.62
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.62
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.62
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.62
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.62
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.62
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.62
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.62
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.61
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.61
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.61
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.61
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.61
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.61
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.61
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.61
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.61
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.61
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.61
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.61
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.6
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.6
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.6
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.6
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.6
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.6
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.6
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.6
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.6
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.6
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.6
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.6
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.6
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.6
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.6
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.6
4e4y_A244 Short chain dehydrogenase family protein; structur 99.6
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.59
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.59
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.59
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.59
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.59
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.59
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.59
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.59
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.59
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.59
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.59
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.59
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.58
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.58
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.58
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.58
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.58
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.58
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.58
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.58
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.58
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.58
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.58
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.58
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.58
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.58
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.58
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.57
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.57
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.57
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.57
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.57
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.57
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.56
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.56
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.56
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.55
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.55
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.54
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.54
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.54
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.54
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.53
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.53
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.52
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.52
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.52
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.52
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.52
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.52
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.52
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.51
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.51
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.5
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.5
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.5
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.5
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.49
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.49
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.48
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.48
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.47
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.46
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.46
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.45
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.42
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.42
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.39
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.37
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.37
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.36
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.36
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.35
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.35
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.34
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.33
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.32
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.32
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.31
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.31
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.3
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.29
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.29
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.28
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.27
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.27
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.26
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.26
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.23
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.23
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.23
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.22
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.21
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.2
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.2
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 99.19
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.19
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.18
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.14
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.13
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.12
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.1
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.1
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.08
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.07
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.05
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.03
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.02
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.01
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.99
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 98.97
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.96
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.95
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.95
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.94
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.94
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.88
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.87
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.87
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.87
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.87
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.87
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.86
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.86
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.85
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.85
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.84
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.84
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.84
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.83
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.83
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.83
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.82
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.82
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.82
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.82
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.81
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.8
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.8
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.8
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.78
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.78
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.77
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.77
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.77
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.76
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
Probab=99.97  E-value=1.4e-29  Score=280.74  Aligned_cols=246  Identities=25%  Similarity=0.322  Sum_probs=191.2

Q ss_pred             hcCCCEEEEecCccHHHHHHHHHHHHhCCCccEEEEEecCCCCCCHHHHHHHHhcChhhHHHhhhCc-ccCCCeEEEEcC
Q psy11859        215 WYAGRSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECP-AQLSRLHIIEGD  293 (851)
Q Consensus       215 ~~~~k~VlVTGatGFIG~~Lv~~Ll~~g~~v~~V~~l~R~~~~~~~~~rl~~~~~~~~f~~l~~~~~-~~~~~v~~v~gD  293 (851)
                      .+++|+|||||||||||++|+++|++.|   .+|++++|......  ..+..+         ....+ ...++++++.+|
T Consensus        22 ~~~~~~vlVtGatG~iG~~l~~~L~~~g---~~V~~~~r~~~~~~--~~~~~~---------~~~~~~~~~~~~~~~~~D   87 (351)
T 3ruf_A           22 IFSPKTWLITGVAGFIGSNLLEKLLKLN---QVVIGLDNFSTGHQ--YNLDEV---------KTLVSTEQWSRFCFIEGD   87 (351)
T ss_dssp             HHSCCEEEEETTTSHHHHHHHHHHHHTT---CEEEEEECCSSCCH--HHHHHH---------HHTSCHHHHTTEEEEECC
T ss_pred             CCCCCeEEEECCCcHHHHHHHHHHHHCC---CEEEEEeCCCCCch--hhhhhh---------hhccccccCCceEEEEcc
Confidence            4678999999999999999999999998   78999999776431  222111         11100 011589999999


Q ss_pred             CCCCcCCCCHHHHHHHhcCccEEEEccccCCcc---hhHHHHHHHHHHHHHHHHHHHHhcCCceEEEEeeeeeeeCCCc-
Q psy11859        294 ILQANLGIKDSDLLMLQEEVSVVFNGAASLKLE---AELKENVAANTRGTQRLLDIALKMKKLVAFIHFSTAFCHPDQK-  369 (851)
Q Consensus       294 i~~~~lgls~~~~~~~~~~vd~ViH~AA~~~~~---~~~~~~~~~Nv~Gt~~ll~~a~~~~~~~~fV~vSTa~~~~~~~-  369 (851)
                      ++|++      ++..+++++|+|||+||.....   .++...+++|+.||.+|+++|++.+ +++|||+||+.+|+... 
T Consensus        88 l~d~~------~~~~~~~~~d~Vih~A~~~~~~~~~~~~~~~~~~nv~~~~~ll~a~~~~~-~~~~v~~SS~~vyg~~~~  160 (351)
T 3ruf_A           88 IRDLT------TCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQ-VQSFTYAASSSTYGDHPA  160 (351)
T ss_dssp             TTCHH------HHHHHTTTCSEEEECCCCCCHHHHHHCHHHHHHHHTHHHHHHHHHHHHTT-CSEEEEEEEGGGGTTCCC
T ss_pred             CCCHH------HHHHHhcCCCEEEECCccCCcchhhhCHHHHHHHHHHHHHHHHHHHHHcC-CCEEEEEecHHhcCCCCC
Confidence            99886      8899999999999999987654   3456789999999999999999986 89999999998887653 


Q ss_pred             -ccccccCCCCCCHHHHHHHHhhccHHHHhhhCCcccCCCCchhhHHHHHHHHHHHHHhC--CCCEEEEecccccCCCCC
Q psy11859        370 -VLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKT--KLPVVIVRPSIVLPSFQE  446 (851)
Q Consensus       370 -~i~E~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~Y~~SK~~aE~~v~~~~~--~l~~~ivRp~~V~G~~~~  446 (851)
                       +++|+.+..|.++                             |+.||+.+|+++..++.  +++++|+||++||||+..
T Consensus       161 ~~~~E~~~~~p~~~-----------------------------Y~~sK~~~E~~~~~~~~~~g~~~~ilRp~~v~G~~~~  211 (351)
T 3ruf_A          161 LPKVEENIGNPLSP-----------------------------YAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQD  211 (351)
T ss_dssp             SSBCTTCCCCCCSH-----------------------------HHHHHHHHHHHHHHHHHHHCCCCEEEEECSEESTTCC
T ss_pred             CCCccCCCCCCCCh-----------------------------hHHHHHHHHHHHHHHHHHhCCCEEEEeeCceeCcCCC
Confidence             7888877776666                             99999999999988765  999999999999999875


Q ss_pred             C-------chhHhhhh-cCCceEEEEccc---------CceeEEEeecC---CCCccEEEEeCCCCccccHHHHHHHHHH
Q psy11859        447 P-------VPGWVDSL-NGPVGVLVASGK---------GVVRSMILNDL---STETQVFNISSNEVEAITWGEIISRGKQ  506 (851)
Q Consensus       447 p-------~p~~i~~~-~~~~~~~~~~g~---------~v~~~~~~~~~---~~~~~iyni~~~~~~~~t~~el~~~~~~  506 (851)
                      +       ++.++..+ .+....+.+.|.         |+++++.....   ...+++||++++  .++|+.|+++.+.+
T Consensus       212 ~~~~~~~~~~~~~~~~~~~~~~~~~g~g~~~~~~i~v~Dva~a~~~~~~~~~~~~~~~~ni~~~--~~~s~~e~~~~i~~  289 (351)
T 3ruf_A          212 PNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVG--DRTTLNELSGYIYD  289 (351)
T ss_dssp             CCSTTCCHHHHHHHHHHHTCCCEEESSSCCEECCEEHHHHHHHHHHHHTCCGGGCSEEEEESCS--CCEEHHHHHHHHHH
T ss_pred             CCcchhhHHHHHHHHHHcCCCcEEeCCCCeEEeeEEHHHHHHHHHHHHhhccccCCCEEEeCCC--CcccHHHHHHHHHH
Confidence            4       46677764 444444445543         33333332222   236789999998  68999999999999


Q ss_pred             HhhcCC
Q psy11859        507 LIYQYP  512 (851)
Q Consensus       507 ~~~~~p  512 (851)
                      .+|..+
T Consensus       290 ~~g~~~  295 (351)
T 3ruf_A          290 ELNLIH  295 (351)
T ss_dssp             HHHTTC
T ss_pred             HhCccc
Confidence            999743



>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 851
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-10
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 6e-10
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 8e-10
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 9e-10
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-09
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 7e-08
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 3e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 9e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 5e-06
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 8e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 7e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 2e-04
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 2e-04
d1tf3a131 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIII 5e-04
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 8e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-04
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 9e-04
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 0.003
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 0.003
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 0.003
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptococcus suis, serotype 2 [TaxId: 1307]
 Score = 60.5 bits (146), Expect = 3e-10
 Identities = 45/240 (18%), Positives = 83/240 (34%), Gaps = 51/240 (21%)

Query: 221 VLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKEC 280
           +L+TGG GF+G  ++  ++++  D   V  + +    LT    L   S +          
Sbjct: 3   ILITGGAGFIGSAVVRHIIKNTQD--TVVNIDK----LTYAGNLESLSDI---------- 46

Query: 281 PAQLSRLHIIEGDILQANLGIKDSDLLMLQEEVSVVFNGAASLKLEAELK---ENVAANT 337
            ++ +R +    DI  +    +    +  Q +   V + AA   ++  +      +  N 
Sbjct: 47  -SESNRYNFEHADICDSAEITR----IFEQYQPDAVMHLAAESHVDRSITGPAAFIETNI 101

Query: 338 RGTQRLLDIALKM--------KKLVAFIHFSTAFCHPDQKVLEEKLYPSPVSPHDIMRAM 389
            GT  LL++A K         K    F H ST   + D           P          
Sbjct: 102 VGTYALLEVARKYWSALGEDKKNNFRFHHISTDEVYGDL----------PHPDEVENSVT 151

Query: 390 EWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEY--KTKLPVVIVRPSIVLPSFQEP 447
             +  ET          P  + Y+ +K  ++ LV  +     LP ++   S     +  P
Sbjct: 152 LPLFTET------TAYAPS-SPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFP 204


>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Length = 31 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query851
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.98
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.97
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.96
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.96
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.96
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.96
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.96
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.96
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.95
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.95
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.95
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.95
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.94
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.94
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.94
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.94
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.93
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.93
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.92
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.91
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.88
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.88
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.85
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.85
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.78
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.77
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.77
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.77
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.75
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.62
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.41
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.41
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.4
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.39
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.39
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.38
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.37
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.37
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.37
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.36
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.36
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.36
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.36
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.35
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.35
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.35
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.35
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.35
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.34
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.34
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.34
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.34
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.34
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.33
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.32
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.32
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.31
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.31
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.3
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.29
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.29
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.29
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.28
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.28
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.26
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.25
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.24
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.24
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.24
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.23
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.23
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.23
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.23
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.22
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.21
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.21
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.2
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.2
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.19
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.16
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.13
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.09
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.08
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.08
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.08
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.07
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.03
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.02
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.96
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.95
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.93
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.88
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.85
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.85
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.82
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.77
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.73
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.7
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.67
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.64
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.62
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.6
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.59
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.56
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.55
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.53
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 98.52
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.5
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.5
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.5
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.49
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.48
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.47
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.45
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.45
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.41
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.41
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.38
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.37
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.36
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.35
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.31
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.29
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.25
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.24
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.24
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.14
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 98.13
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.03
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.0
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.96
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.62
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.61
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.53
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.31
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.23
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.16
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.14
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.09
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.04
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.02
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.02
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.01
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.91
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.88
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.85
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.79
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.79
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.73
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.67
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.49
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.46
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.46
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.44
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.41
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.22
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.16
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.12
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.09
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.08
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.02
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.98
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 95.94
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.91
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.87
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.84
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 95.8
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.8
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.71
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.69
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.65
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.62
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.57
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.53
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.48
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.47
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.38
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.35
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.3
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.22
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 95.19
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.19
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.02
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.93
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 94.85
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.84
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.81
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.73
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.6
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 94.53
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.45
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.2
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 94.18
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.14
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.11
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 93.97
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 93.96
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.72
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.63
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 93.42
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.09
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.94
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 92.83
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.75
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 92.67
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 92.54
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 92.54
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.46
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.1
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.96
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.86
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 91.82
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 91.01
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 90.95
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 90.89
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.68
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 90.67
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.46
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 90.03
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 89.68
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.25
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 89.22
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 89.09
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.02
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 88.8
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.39
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 88.36
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 87.94
d1id1a_153 Rck domain from putative potassium channel Kch {Es 87.52
d1yova1529 Amyloid beta precursor protein-binding protein 1, 86.58
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.14
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 86.13
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 85.93
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 85.7
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.24
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 85.18
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 85.15
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 82.89
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 82.86
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.79
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 82.65
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 82.12
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.97
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 81.91
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 81.63
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 81.51
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 80.86
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 80.66
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.42
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 80.19
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose 4,6-dehydratase
species: Escherichia coli [TaxId: 562]
Probab=99.98  E-value=9e-33  Score=304.90  Aligned_cols=242  Identities=17%  Similarity=0.119  Sum_probs=180.0

Q ss_pred             CEEEEecCccHHHHHHHHHHHHhCCCccEEEEEecCCCCCCHHHHHHHHhcChhhHHHhhhCcccCCCeEEEEcCCCCCc
Q psy11859        219 RSVLVTGGTGFMGKVLLEKLLRSCPDIGKVYILCRAKRGLTPKARLAEFSKLPVFERLRKECPAQLSRLHIIEGDILQAN  298 (851)
Q Consensus       219 k~VlVTGatGFIG~~Lv~~Ll~~g~~v~~V~~l~R~~~~~~~~~rl~~~~~~~~f~~l~~~~~~~~~~v~~v~gDi~~~~  298 (851)
                      |+|||||||||||++|+++|++.|   ..|++++|..... ..+++..+.         .+.....++++++.|||+|.+
T Consensus         2 K~vLITGatGfiGs~lv~~Ll~~g---~~V~~~~r~~~~~-~~~~~~~~~---------~~~~~~~~~~~~~~~Dl~d~~   68 (357)
T d1db3a_           2 KVALITGVTGQDGSYLAEFLLEKG---YEVHGIKRRASSF-NTERVDHIY---------QDPHTCNPKFHLHYGDLSDTS   68 (357)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTT---CEEEEECC-------------------------------CCEEECCCCSSCHH
T ss_pred             CEEEEeCCCcHHHHHHHHHHHHCc---CEEEEEECCCccc-chhhHHHHH---------hhhhhcCCCeEEEEeecCCHH
Confidence            789999999999999999999998   6889999965432 112222221         111223458999999999887


Q ss_pred             CCCCHHHHHHHhc--CccEEEEccccCCcc---hhHHHHHHHHHHHHHHHHHHHHhcC--CceEEEEeeeeeeeCCC--c
Q psy11859        299 LGIKDSDLLMLQE--EVSVVFNGAASLKLE---AELKENVAANTRGTQRLLDIALKMK--KLVAFIHFSTAFCHPDQ--K  369 (851)
Q Consensus       299 lgls~~~~~~~~~--~vd~ViH~AA~~~~~---~~~~~~~~~Nv~Gt~~ll~~a~~~~--~~~~fV~vSTa~~~~~~--~  369 (851)
                            ++..+++  ++|+|||+||..++.   +++...+++|+.||.|||++|++.+  +.++|||+||+.+||..  .
T Consensus        69 ------~~~~~~~~~~~d~v~h~aa~~~~~~~~~~~~~~~~~Nv~gt~nllea~~~~~~~~~~r~i~~SS~~vYG~~~~~  142 (357)
T d1db3a_          69 ------NLTRILREVQPDEVYNLGAMSHVAVSFESPEYTADVDAMGTLRLLEAIRFLGLEKKTRFYQASTSELYGLVQEI  142 (357)
T ss_dssp             ------HHHHHHHHHCCSEEEECCCCCTTTTTTSCHHHHHHHHTHHHHHHHHHHHHTTCTTTCEEEEEEEGGGGTTCCSS
T ss_pred             ------HHHHHHhccCCCEEEEeecccccchhhhCHHHHHHHHHHHHHHHHHHHHHhCCCCCcEEEEEEchhhhCCCCCC
Confidence                  8888887  569999999987654   4567889999999999999999864  45689999999988754  3


Q ss_pred             ccccccCCCCCCHHHHHHHHhhccHHHHhhhCCcccCCCCchhhHHHHHHHHHHHHHhC--CCCEEEEecccccCCCCCC
Q psy11859        370 VLEEKLYPSPVSPHDIMRAMEWMDDETIKQLTPKILGPHPNSYTFTKRLTETLVDEYKT--KLPVVIVRPSIVLPSFQEP  447 (851)
Q Consensus       370 ~i~E~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~Y~~SK~~aE~~v~~~~~--~l~~~ivRp~~V~G~~~~p  447 (851)
                      +++|+.+..|.++                             |+.||++||.++..+.+  +++++++||++||||+..+
T Consensus       143 ~~~E~~~~~P~~~-----------------------------Y~~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~  193 (357)
T d1db3a_         143 PQKETTPFYPRSP-----------------------------YAVAKLYAYWITVNYRESYGMYACNGILFNHESPRRGE  193 (357)
T ss_dssp             SBCTTSCCCCCSH-----------------------------HHHHHHHHHHHHHHHHHHHCCCEEEEEECCEECTTSCT
T ss_pred             CcCCCCCCCCCCh-----------------------------HHHHHHHHHHHHHHHHHHhCCCEEEEEeccccCCCCCc
Confidence            7899887777776                             99999999999999876  8999999999999997643


Q ss_pred             ------chhHhhh-hcCCc-eEEEEccc---------CceeEEEeecCCCCccEEEEeCCCCccccHHHHHHHHHHHhhc
Q psy11859        448 ------VPGWVDS-LNGPV-GVLVASGK---------GVVRSMILNDLSTETQVFNISSNEVEAITWGEIISRGKQLIYQ  510 (851)
Q Consensus       448 ------~p~~i~~-~~~~~-~~~~~~g~---------~v~~~~~~~~~~~~~~iyni~~~~~~~~t~~el~~~~~~~~~~  510 (851)
                            +..++.. ..+.. .+.+|.|.         |+++++..+.+...+++||+++|  .++|+.|+++.+.+.+|.
T Consensus       194 ~~~~~~i~~~~~~~~~~~~~~~~~g~~~~~r~~~~v~D~~~a~~~~~~~~~~~~yni~sg--~~~s~~~~~~~~~~~~g~  271 (357)
T d1db3a_         194 TFVTRKITRAIANIAQGLESCLYLGNMDSLRDWGHAKDYVKMQWMMLQQEQPEDFVIATG--VQYSVRQFVEMAAAQLGI  271 (357)
T ss_dssp             TSHHHHHHHHHHHHHTTSCCCEEESCTTCEECCEEHHHHHHHHHHTTSSSSCCCEEECCC--CCEEHHHHHHHHHHTTTE
T ss_pred             CCCchHHHHHHHHHHhCCCceEEECCCCeeecceeechHHHHHHHHHhCCCCCeEEECCC--CceehHHHHHHHHHHhCC
Confidence                  3344444 33333 34444443         34444444444567789999999  689999999999999874



>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure