Psyllid ID: psy12023


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50-----
MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY
ccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcc
cccccccccEEEcccHHHHHEEHccccccccccccccHHHHHHHHHHHHHHHccc
mfmcdvcgkgykykngiyrhkkfecgqepkyqcpqcpyrakqnAHLTTHMAIKHY
mfmcdvcgkgykykngiYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY
MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY
*FMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAK**************
MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKH*
MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY
MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query55 2.2.26 [Sep-21-2011]
Q7KQZ4787 Longitudinals lacking pro yes N/A 0.927 0.064 0.529 1e-12
P42283891 Longitudinals lacking pro no N/A 0.981 0.060 0.436 4e-10
Q9V5M3 878 Longitudinals lacking pro no N/A 0.727 0.045 0.525 3e-09
Q867Z4970 Longitudinals lacking pro no N/A 0.963 0.054 0.425 2e-08
Q01714786 Transcription factor Sp1 yes N/A 0.872 0.061 0.392 4e-05
O89090784 Transcription factor Sp1 no N/A 0.872 0.061 0.392 4e-05
P08048 801 Zinc finger Y-chromosomal no N/A 0.927 0.063 0.365 5e-05
Q6B4Z5 801 Zinc finger Y-chromosomal no N/A 0.927 0.063 0.365 5e-05
Q9BE73 1081 Zinc finger protein 827 O N/A N/A 0.927 0.047 0.403 6e-05
Q17R98 1081 Zinc finger protein 827 O no N/A 0.927 0.047 0.403 6e-05
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 4   CDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKH 54
           C VCG+ YK K+ +  H+K+ECG+EP++QCP C YRAKQ  H+  HM   H
Sbjct: 687 CPVCGRVYKLKSSLRNHQKWECGKEPQFQCPFCVYRAKQKMHIGRHMERMH 737




Putative transcription factor required for axon growth and guidance in the central and peripheral nervous systems. Repels CNS axons away from the midline by promoting the expression of the midline repellent sli and its receptor robo.
Drosophila melanogaster (taxid: 7227)
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 Back     alignment and function description
>sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 Back     alignment and function description
>sp|P08048|ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens GN=ZFY PE=1 SV=3 Back     alignment and function description
>sp|Q6B4Z5|ZFY_PANTR Zinc finger Y-chromosomal protein OS=Pan troglodytes GN=ZFY PE=2 SV=1 Back     alignment and function description
>sp|Q9BE73|ZN827_MACFA Zinc finger protein 827 OS=Macaca fascicularis GN=ZNF827 PE=2 SV=1 Back     alignment and function description
>sp|Q17R98|ZN827_HUMAN Zinc finger protein 827 OS=Homo sapiens GN=ZNF827 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query55
24652482 787 longitudinals lacking, isoform C [Drosop 0.927 0.064 0.529 5e-11
29539411 786 Lola protein isoform L [Drosophila melan 0.927 0.064 0.529 5e-11
157121098 731 lola [Aedes aegypti] gi|108874717|gb|EAT 0.963 0.072 0.509 5e-11
158292853 634 AGAP005245-PG [Anopheles gambiae str. PE 0.963 0.083 0.509 7e-11
194884229 346 GG22734 [Drosophila erecta] gi|190659385 0.927 0.147 0.529 1e-10
195483702 341 GE13093 [Drosophila yakuba] gi|194176498 0.927 0.149 0.529 1e-10
195333169 335 GM20512 [Drosophila sechellia] gi|194125 0.927 0.152 0.529 1e-10
195582220 335 GD25971 [Drosophila simulans] gi|1941929 0.927 0.152 0.529 1e-10
45552567 771 longitudinals lacking, isoform W [Drosop 0.963 0.068 0.490 1e-10
255522799 468 longitudinals lacking isoform 3 [Triboli 0.963 0.113 0.490 1e-10
>gi|24652482|ref|NP_724946.1| longitudinals lacking, isoform C [Drosophila melanogaster] gi|78711864|ref|NP_724949.2| longitudinals lacking, isoform B [Drosophila melanogaster] gi|73920870|sp|Q7KQZ4.1|LOLA3_DROME RecName: Full=Longitudinals lacking protein, isoforms A/B/D/L gi|7303724|gb|AAF58773.1| longitudinals lacking, isoform C [Drosophila melanogaster] gi|71911713|gb|AAF58776.3| longitudinals lacking, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 4   CDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKH 54
           C VCG+ YK K+ +  H+K+ECG+EP++QCP C YRAKQ  H+  HM   H
Sbjct: 687 CPVCGRVYKLKSSLRNHQKWECGKEPQFQCPFCVYRAKQKMHIGRHMERMH 737




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|29539411|dbj|BAC67588.1| Lola protein isoform L [Drosophila melanogaster] gi|29539451|dbj|BAC67608.1| Lola protein isoform L [Drosophila melanogaster] gi|29539491|dbj|BAC67628.1| Lola protein isoform L [Drosophila melanogaster] gi|29539531|dbj|BAC67648.1| Lola protein isoform L [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|157121098|ref|XP_001659824.1| lola [Aedes aegypti] gi|108874717|gb|EAT38942.1| AAEL009212-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|158292853|ref|XP_314150.4| AGAP005245-PG [Anopheles gambiae str. PEST] gi|157017188|gb|EAA09485.4| AGAP005245-PG [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194884229|ref|XP_001976198.1| GG22734 [Drosophila erecta] gi|190659385|gb|EDV56598.1| GG22734 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195483702|ref|XP_002090397.1| GE13093 [Drosophila yakuba] gi|194176498|gb|EDW90109.1| GE13093 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195333169|ref|XP_002033264.1| GM20512 [Drosophila sechellia] gi|194125234|gb|EDW47277.1| GM20512 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195582220|ref|XP_002080926.1| GD25971 [Drosophila simulans] gi|194192935|gb|EDX06511.1| GD25971 [Drosophila simulans] Back     alignment and taxonomy information
>gi|45552567|ref|NP_995806.1| longitudinals lacking, isoform W [Drosophila melanogaster] gi|29539421|dbj|BAC67593.1| Lola protein isoform Q [Drosophila melanogaster] gi|29539461|dbj|BAC67613.1| Lola protein isoform Q [Drosophila melanogaster] gi|29539501|dbj|BAC67633.1| Lola protein isoform Q [Drosophila melanogaster] gi|29539541|dbj|BAC67653.1| Lola protein isoform Q [Drosophila melanogaster] gi|45445597|gb|AAS64876.1| longitudinals lacking, isoform W [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|255522799|ref|NP_001157312.1| longitudinals lacking isoform 3 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query55
FB|FBgn0005630970 lola "longitudinals lacking" [ 0.963 0.054 0.436 3.2e-08
UNIPROTKB|P80944148 ZFX "Zinc finger X-chromosomal 0.927 0.344 0.365 6.8e-08
UNIPROTKB|Q29419148 ZFY "Zinc finger Y-chromosomal 0.927 0.344 0.365 6.8e-08
UNIPROTKB|F1NX71 478 ZNF250 "Uncharacterized protei 0.909 0.104 0.411 1.8e-07
ZFIN|ZDB-GENE-050208-469183 si:ch211-255f4.5 "si:ch211-255 0.963 0.289 0.362 2.3e-07
UNIPROTKB|K7EP55215 ZNF253 "Zinc finger protein 25 0.927 0.237 0.403 2.9e-07
UNIPROTKB|F1P5D9 693 ZNF250 "Uncharacterized protei 0.909 0.072 0.411 3.1e-07
UNIPROTKB|F1LYN5149 F1LYN5 "Uncharacterized protei 0.963 0.355 0.413 3.8e-07
WB|WBGene00009937 318 lsl-1 [Caenorhabditis elegans 0.927 0.160 0.392 4e-07
ZFIN|ZDB-GENE-070424-48 419 zgc:162971 "zgc:162971" [Danio 0.909 0.119 0.431 4e-07
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 139 (54.0 bits), Expect = 3.2e-08, P = 3.2e-08
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query:     2 FMCDVCGKGYKYKNGIYRHKKFECG-QEPKYQCPQCPYRAKQNAHLTTHMAIKHY 55
             ++C  CGK Y++K+ + RH+  ECG +EP + CP C Y+AKQ  +L  H+  KH+
Sbjct:   903 YVCRHCGKKYRWKSTLRRHENVECGGKEPCHPCPYCSYKAKQRGNLGVHVR-KHH 956




GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISS
GO:0007411 "axon guidance" evidence=IGI;NAS;IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007409 "axonogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0016199 "axon midline choice point recognition" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0007464 "R3/R4 cell fate commitment" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
GO:0001964 "startle response" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0008406 "gonad development" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|P80944 ZFX "Zinc finger X-chromosomal protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29419 ZFY "Zinc finger Y-chromosomal protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NX71 ZNF250 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-469 si:ch211-255f4.5 "si:ch211-255f4.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|K7EP55 ZNF253 "Zinc finger protein 253" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5D9 ZNF250 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LYN5 F1LYN5 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00009937 lsl-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-48 zgc:162971 "zgc:162971" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7KQZ4LOLA3_DROMENo assigned EC number0.52940.92720.0648yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 55
KOG2462|consensus279 99.84
KOG2462|consensus279 99.66
KOG3623|consensus 1007 99.62
PHA0276855 hypothetical protein; Provisional 99.55
KOG3623|consensus1007 99.54
KOG3576|consensus267 99.49
KOG1074|consensus 958 99.48
KOG1074|consensus958 99.45
PHA00733128 hypothetical protein 99.42
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.28
PHA0073279 hypothetical protein 99.13
PHA0061644 hypothetical protein 99.09
KOG3576|consensus267 99.02
PHA0276855 hypothetical protein; Provisional 98.94
KOG3993|consensus 500 98.94
PHA0061644 hypothetical protein 98.87
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.86
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.84
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.84
KOG3608|consensus 467 98.77
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.76
KOG3608|consensus 467 98.61
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.55
PHA00733128 hypothetical protein 98.5
smart0035526 ZnF_C2H2 zinc finger. 98.44
KOG3993|consensus 500 98.44
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 98.41
PRK04860160 hypothetical protein; Provisional 98.3
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.3
PHA0073279 hypothetical protein 98.23
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.21
PLN03086567 PRLI-interacting factor K; Provisional 98.18
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.17
PLN03086567 PRLI-interacting factor K; Provisional 98.13
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 98.09
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 98.07
smart0035526 ZnF_C2H2 zinc finger. 98.05
COG5189423 SFP1 Putative transcriptional repressor regulating 97.96
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.69
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.58
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 97.5
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 97.25
KOG2893|consensus 341 96.36
COG5048 467 FOG: Zn-finger [General function prediction only] 96.29
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.76
COG404965 Uncharacterized protein containing archaeal-type C 95.71
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 95.56
PF1371937 zinc_ribbon_5: zinc-ribbon domain 95.53
PF1371736 zinc_ribbon_4: zinc-ribbon domain 95.12
PRK00464 154 nrdR transcriptional regulator NrdR; Validated 94.87
PF04959 214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 94.81
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.78
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 94.68
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 94.58
PRK06266178 transcription initiation factor E subunit alpha; V 94.51
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 94.19
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 94.17
KOG2186|consensus 276 94.03
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 93.79
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 93.58
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 93.52
COG1592166 Rubrerythrin [Energy production and conversion] 93.51
KOG1146|consensus 1406 93.46
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 93.31
PHA0062659 hypothetical protein 93.3
smart00531147 TFIIE Transcription initiation factor IIE. 93.26
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 92.87
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 92.43
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 92.01
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 91.79
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 91.72
PRK0967872 DNA-binding transcriptional regulator; Provisional 91.59
COG335797 Predicted transcriptional regulator containing an 90.59
COG5048 467 FOG: Zn-finger [General function prediction only] 90.15
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 89.9
PF1526954 zf-C2H2_7: Zinc-finger 89.65
KOG4173|consensus253 89.34
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 89.17
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 89.08
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 88.43
PF14353128 CpXC: CpXC protein 88.29
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 88.28
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 88.14
PTZ0025590 60S ribosomal protein L37a; Provisional 87.54
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 87.41
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 87.31
PF1387841 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO 86.93
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 86.93
KOG2593|consensus 436 86.44
KOG4167|consensus907 86.04
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 85.95
PF1345149 zf-trcl: Probable zinc-binding domain 85.72
KOG2071|consensus 579 85.71
PF0879028 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IP 85.44
KOG2231|consensus 669 85.41
KOG2071|consensus 579 85.04
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 84.99
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 84.41
PF1290740 zf-met2: Zinc-binding 84.1
KOG0978|consensus698 84.0
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 83.63
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 82.99
KOG2482|consensus 423 82.88
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 82.48
COG4957148 Predicted transcriptional regulator [Transcription 82.3
COG1327 156 Predicted transcriptional regulator, consists of a 81.59
PF0996356 DUF2197: Uncharacterized protein conserved in bact 81.22
COG3364112 Zn-ribbon containing protein [General function pre 80.9
KOG1146|consensus 1406 80.67
PF0142843 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 80.5
>KOG2462|consensus Back     alignment and domain information
Probab=99.84  E-value=1e-21  Score=89.18  Aligned_cols=53  Identities=25%  Similarity=0.601  Sum_probs=50.5

Q ss_pred             CCCCccccccccchhhHHhHHHHHhCCCCCccCCCCCcccccchHHHHHHHhhc
Q psy12023          1 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKH   54 (55)
Q Consensus         1 p~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   54 (55)
                      |++|..||+.|.+.+.|+.|+++|+|||| |.|..|+++|..+++|+-|+++|.
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQTHS  239 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQTHS  239 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCC-ccCCcccchhcchHHHHHHHHhhc
Confidence            57899999999999999999999999998 999999999999999999999884



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>KOG2593|consensus Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13451 zf-trcl: Probable zinc-binding domain Back     alignment and domain information
>KOG2071|consensus Back     alignment and domain information
>PF08790 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2071|consensus Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>COG4957 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PF09963 DUF2197: Uncharacterized protein conserved in bacteria (DUF2197); InterPro: IPR019241 This family represents various hypothetical bacterial proteins with no known function Back     alignment and domain information
>COG3364 Zn-ribbon containing protein [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF01428 zf-AN1: AN1-like Zinc finger; InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query55
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-04
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
 Score = 41.3 bits (98), Expect = 3e-07
 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 2  FMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAI 52
            C  C      K  +  H++  C   P ++C  C +  KQ ++L+ HM  
Sbjct: 10 EKCSECSYSCSSKAALRIHERIHCTDRP-FKCNYCSFDTKQPSNLSKHMKK 59


>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query55
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.93
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.86
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.84
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.83
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.83
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.81
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.81
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.8
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.8
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.8
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.79
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.79
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.79
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.79
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.78
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.76
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.75
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.74
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.74
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.72
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.71
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.7
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.7
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.69
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.69
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.69
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.68
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.66
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.65
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.64
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.64
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.63
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.62
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.62
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.62
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.61
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.6
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.6
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.59
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.57
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.57
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.57
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.55
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.54
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.53
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 99.52
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.52
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.51
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.5
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.49
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.48
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.48
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.46
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.45
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.45
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.44
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.44
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.43
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.43
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.43
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.43
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.41
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.4
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.39
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.38
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.36
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.34
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.33
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.33
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.31
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.3
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.3
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.3
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.3
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.29
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.29
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.28
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.28
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.28
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.28
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.27
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.27
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.27
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.27
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.27
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.27
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.27
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.27
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.26
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.26
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 99.26
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.26
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.25
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.24
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.22
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.21
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.21
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.2
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.19
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.19
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.19
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.19
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.19
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.18
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.18
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.18
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 99.18
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.17
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.16
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 99.16
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.15
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 99.15
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 99.14
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.12
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 99.12
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.1
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.1
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 99.08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.08
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 99.07
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.07
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.07
1ard_A29 Yeast transcription factor ADR1; transcription reg 99.06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 99.06
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 99.06
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.06
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.06
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 99.06
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 99.05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 99.05
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.04
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 99.03
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.03
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 99.03
1ard_A29 Yeast transcription factor ADR1; transcription reg 99.03
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 99.02
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.02
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.59
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 99.02
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 99.01
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 99.01
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.0
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 99.0
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.99
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.98
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.97
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.96
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.96
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.95
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.95
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.48
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.93
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.93
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.47
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.93
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.93
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.46
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.9
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.9
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.89
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.89
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.89
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.88
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.87
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.37
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.86
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.84
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.84
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.83
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.81
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.81
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.8
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.8
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.8
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.8
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.8
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.24
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.76
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.72
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.66
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.66
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.63
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.56
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.56
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.33
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 98.28
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.18
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.17
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.95
2e72_A49 POGO transposable element with ZNF domain; zinc fi 97.67
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.58
2e72_A49 POGO transposable element with ZNF domain; zinc fi 97.35
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.07
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 97.01
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 95.84
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 95.67
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 95.41
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 94.95
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 94.61
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 94.57
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 94.22
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.98
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 93.53
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.28
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.12
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 93.01
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 92.42
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 92.41
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 92.28
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 91.61
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 91.45
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 90.58
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 90.53
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 90.43
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 89.42
3iyl_X 1214 VP3; non-enveloped virus, membrane penetration pro 89.27
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 89.24
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 88.81
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 88.71
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 88.46
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 88.35
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 88.0
1z60_A59 TFIIH basal transcription factor complex P44 subun 86.98
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 85.26
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 84.93
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 84.93
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 84.1
1wys_A75 Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc 83.59
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 83.27
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 82.86
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 82.61
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 82.56
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 82.38
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 82.04
1x4v_A63 Hypothetical protein LOC130617; ZF-AN1 domain, zin 81.34
3ax1_A358 Serrate RNA effector molecule; miRNA processing, p 80.65
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 80.04
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.93  E-value=6.5e-26  Score=84.28  Aligned_cols=53  Identities=28%  Similarity=0.787  Sum_probs=51.3

Q ss_pred             CCCCccccccccchhhHHhHHHHHhCCCCCccCCCCCcccccchHHHHHHHhhc
Q psy12023          1 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIKH   54 (55)
Q Consensus         1 p~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   54 (55)
                      ||.|..|++.|...+.|..|+++|+++++ |.|.+|++.|.+.+.|..|+++|.
T Consensus         4 py~C~~C~k~F~~~~~L~~H~~~Ht~ekp-~~C~~C~k~F~~~~~L~~H~~~Ht   56 (60)
T 4gzn_C            4 PFFCNFCGKTYRDASGLSRHRRAHLGYRP-RSCPECGKCFRDQSEVNRHLKVHQ   56 (60)
T ss_dssp             CEECTTTCCEESSHHHHHHHHHHHHTCCC-EECTTTCCEESSHHHHHHHGGGGS
T ss_pred             CccCCCCCCEeCCHHHHHHHHHHhCCCcC-eECCCCCCCcCCHHHHHHHhCccC
Confidence            79999999999999999999999999998 999999999999999999999985



>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3iyl_X VP3; non-enveloped virus, membrane penetration protein, autocleav myristol group, icosahedral virus; HET: MYR; 3.30A {Grass carp reovirus} PDB: 3k1q_C 3k1q_B Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>1wys_A Riken cDNA 2310008M20 protein; ZF-AN1 domain, zinc binding, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>1x4v_A Hypothetical protein LOC130617; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ax1_A Serrate RNA effector molecule; miRNA processing, protein binding; 2.74A {Arabidopsis thaliana} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query55
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.91
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.7
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.69
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.69
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.67
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.64
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.61
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.61
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.53
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.52
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.5
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.48
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.44
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.39
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.36
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.32
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.29
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.29
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.28
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.23
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.2
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.2
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.19
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.14
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 99.12
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.1
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.08
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.06
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.96
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.92
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.92
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.91
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.86
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.78
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.73
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.69
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.68
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.63
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.55
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.49
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.44
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.39
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.38
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.37
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.34
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.27
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.26
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.26
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.24
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 98.18
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.17
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.14
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.09
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.06
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.97
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.96
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.92
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.92
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.92
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.87
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.84
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.84
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.8
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 97.75
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.74
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 97.64
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.63
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.61
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.57
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 97.26
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.14
d1y0jb136 U-shaped transcription factor, different fingers { 97.13
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.96
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.62
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 96.33
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.16
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 96.06
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 96.0
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.71
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 94.98
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.77
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 94.39
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 93.96
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.88
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 93.43
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 92.51
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 90.73
d2ct5a160 Zinc finger BED domain-containing protein 1 {Human 90.66
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 90.36
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 89.84
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 88.93
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 88.9
d1twfl_46 RBP12 subunit of RNA polymerase II {Baker's yeast 88.66
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 88.5
d1wjpa142 Zinc finger protein 295, ZNF295 {Human (Homo sapie 88.48
d1d4ua236 DNA repair factor XPA DNA- and RPA-binding domain, 87.45
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 87.29
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 87.26
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.25
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 87.17
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 87.14
d1fu9a_36 U-shaped transcription factor, different fingers { 87.03
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 86.03
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 85.81
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 84.72
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 83.65
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 83.32
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 81.4
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=4.3e-25  Score=79.50  Aligned_cols=51  Identities=35%  Similarity=0.719  Sum_probs=48.8

Q ss_pred             CCCCccccccccchhhHHhHHHHHhCCCCCccCCCCCcccccchHHHHHHHhh
Q psy12023          1 MFMCDVCGKGYKYKNGIYRHKKFECGQEPKYQCPQCPYRAKQNAHLTTHMAIK   53 (55)
Q Consensus         1 p~~c~~c~~~~~~~~~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   53 (55)
                      ||.| .||+.|.....|..|+.+|+++++ |.|.+|+++|.+.+.|..|+++|
T Consensus         3 ~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekp-y~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           3 LYPC-QCGKSFTHKSQRDRHMSMHLGLRP-YGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CEEC-TTSCEESSHHHHHHHHHHHSCCCS-EECTTTSCEESSSHHHHHHHTTT
T ss_pred             CCCC-CCCCeECCHHHhHHHhhccccccC-CcCCCcCCEecCHHHHHHHHhcC
Confidence            7899 599999999999999999999988 99999999999999999999886



>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wjpa1 g.37.1.1 (A:1-42) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ua2 g.39.1.5 (A:1-36) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure