Psyllid ID: psy12185
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 317 | ||||||
| 350415610 | 355 | PREDICTED: cathepsin O-like [Bombus impa | 0.936 | 0.836 | 0.515 | 1e-83 | |
| 328789602 | 368 | PREDICTED: cathepsin O-like [Apis mellif | 0.933 | 0.804 | 0.5 | 1e-81 | |
| 380026170 | 368 | PREDICTED: cathepsin O-like [Apis florea | 0.946 | 0.815 | 0.503 | 2e-81 | |
| 383852175 | 370 | PREDICTED: cathepsin O-like [Megachile r | 0.952 | 0.816 | 0.471 | 1e-78 | |
| 340710428 | 355 | PREDICTED: cathepsin O-like [Bombus terr | 0.899 | 0.802 | 0.503 | 2e-77 | |
| 307206026 | 353 | Cathepsin O [Harpegnathos saltator] | 0.917 | 0.824 | 0.476 | 6e-76 | |
| 332024588 | 356 | Cathepsin O [Acromyrmex echinatior] | 0.921 | 0.820 | 0.473 | 7e-75 | |
| 307169691 | 358 | Cathepsin O [Camponotus floridanus] | 0.914 | 0.810 | 0.490 | 3e-73 | |
| 156553312 | 345 | PREDICTED: cathepsin O-like [Nasonia vit | 0.858 | 0.788 | 0.486 | 3e-69 | |
| 401758202 | 368 | cathepsin O2-like protease [Chilo suppre | 0.974 | 0.839 | 0.422 | 4e-68 |
| >gi|350415610|ref|XP_003490694.1| PREDICTED: cathepsin O-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 316 bits (809), Expect = 1e-83, Method: Compositional matrix adjust.
Identities = 163/316 (51%), Positives = 210/316 (66%), Gaps = 19/316 (6%)
Query: 5 KNVLFIVALIALCFLAIPVKVSKPNLEQKLELFSSFQQRYKKSYSK--SEHDIRFKNFEK 62
+ V IV +++LCFLAIP++VS L+LF ++ RY KSY +E++ RFK F K
Sbjct: 4 RTVAVIVLVVSLCFLAIPIRVSPNTSNGDLKLFQNYVMRYNKSYRNDPTEYEERFKRFLK 63
Query: 63 SLDIIEELNKNRQSPESARYGITEFSDLSEEEFKTRHLRHSV----NKHVLMSHHKHHD- 117
SL IE++N R S ESA YG+TEFSD+SE+EF + L + KHV S+H+ H
Sbjct: 64 SLRHIEKMNGLRPSQESAYYGLTEFSDMSEDEFLSLTLLPDLPARGEKHVNESYHRRHHL 123
Query: 118 -HHHNHVKKRSITTGITIPTGIPVKKDWREAGIIGKVRNQQTCGACWAFSTVETAESMHA 176
N VKK IP++ DWR+ G+I VRNQ +CGACWAFSTVE ESM+A
Sbjct: 124 LQSTNRVKK---------SVSIPLRFDWRDKGVITPVRNQGSCGACWAFSTVEVVESMYA 174
Query: 177 LKNGTLSLLSVQEVIDCAGNGNMGCSGGDFCALLDWMDVNKVVLEPESEYPLLLKDAACK 236
+KNGTL +LSVQE+IDCA N N GC GGD C+LL W+ +KV + ES YPL+ K + CK
Sbjct: 175 IKNGTLHMLSVQEMIDCAKNSNFGCEGGDICSLLSWLLASKVQIFQESTYPLVGKTSMCK 234
Query: 237 --RKATSPNGVKIKSYTCDTLIPSESSILTDIATHGPVIAAVNALTWQYYLGGVIQYNCD 294
+ +GVKI+ + CD + +E +L +ATHGPV AAVNAL+WQ YLGGVIQY+CD
Sbjct: 235 LGKMIDKASGVKIRDFNCDNFVDAEDELLITVATHGPVAAAVNALSWQNYLGGVIQYHCD 294
Query: 295 GSLANINHAVQIVGYD 310
S N+NHAVQIVGYD
Sbjct: 295 SSFDNLNHAVQIVGYD 310
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328789602|ref|XP_623690.2| PREDICTED: cathepsin O-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380026170|ref|XP_003696831.1| PREDICTED: cathepsin O-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383852175|ref|XP_003701604.1| PREDICTED: cathepsin O-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340710428|ref|XP_003393792.1| PREDICTED: cathepsin O-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307206026|gb|EFN84119.1| Cathepsin O [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332024588|gb|EGI64786.1| Cathepsin O [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307169691|gb|EFN62267.1| Cathepsin O [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|156553312|ref|XP_001599758.1| PREDICTED: cathepsin O-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|401758202|gb|AFQ01136.1| cathepsin O2-like protease [Chilo suppressalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 317 | ||||||
| ZFIN|ZDB-GENE-080724-8 | 334 | ctso "cathepsin O" [Danio reri | 0.520 | 0.494 | 0.416 | 4.6e-40 | |
| UNIPROTKB|P43234 | 321 | CTSO "Cathepsin O" [Homo sapie | 0.536 | 0.529 | 0.421 | 2.5e-39 | |
| UNIPROTKB|F1P0K2 | 320 | CTSO "Uncharacterized protein" | 0.526 | 0.521 | 0.435 | 1.5e-37 | |
| MGI|MGI:2139628 | 312 | Ctso "cathepsin O" [Mus muscul | 0.533 | 0.541 | 0.396 | 1e-36 | |
| UNIPROTKB|F1PGK4 | 316 | CTSO "Uncharacterized protein" | 0.750 | 0.753 | 0.365 | 1.7e-36 | |
| TAIR|locus:2122113 | 355 | XCP1 "xylem cysteine peptidase | 0.507 | 0.453 | 0.355 | 4.9e-33 | |
| UNIPROTKB|E1BPI9 | 313 | CTSO "Uncharacterized protein" | 0.520 | 0.527 | 0.416 | 6.7e-33 | |
| DICTYBASE|DDB_G0291191 | 352 | DDB_G0291191 "cysteine proteas | 0.470 | 0.423 | 0.353 | 5.5e-32 | |
| MGI|MGI:1349426 | 334 | Ctsj "cathepsin J" [Mus muscul | 0.511 | 0.485 | 0.377 | 6.9e-32 | |
| RGD|69241 | 334 | Ctsj "cathepsin J" [Rattus nor | 0.511 | 0.485 | 0.377 | 1.8e-31 |
| ZFIN|ZDB-GENE-080724-8 ctso "cathepsin O" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 356 (130.4 bits), Expect = 4.6e-40, Sum P(2) = 4.6e-40
Identities = 70/168 (41%), Positives = 100/168 (59%)
Query: 143 DWREAGIIGKVRNQQTCGACWAFSTVETAESMHALKNGTLSLLSVQEVIDCAGNGNMGCS 202
DWR+ G++G V NQ +CG CWAFS VE ES+ A L LSVQ+VIDC+ N GC+
Sbjct: 126 DWRDHGVVGPVHNQGSCGGCWAFSIVEAIESVSAKGGEKLQQLSVQQVIDCSYQ-NQGCN 184
Query: 203 GGDFCALLDWMDVNKVVLEPESEYPLLLKDAACKRKATSPNGVKIKSYTCDTLIPSESSI 262
GG L W+ +K+ L E+EYP D C+ + GV +++Y+ E +
Sbjct: 185 GGSPVEALYWLTQSKLKLVSEAEYPFKGADGVCQFFPQAHAGVAVRNYSAYDFSGQEEVM 244
Query: 263 LTDIATHGPVIAAVNALTWQYYLGGVIQYNCDGSLANINHAVQIVGYD 310
++ + GP++ V+A++WQ YLGG+IQ++C AN HAV I GYD
Sbjct: 245 MSALVDFGPLVVIVDAISWQDYLGGIIQHHCSSHKAN--HAVLITGYD 290
|
|
| UNIPROTKB|P43234 CTSO "Cathepsin O" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P0K2 CTSO "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2139628 Ctso "cathepsin O" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PGK4 CTSO "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122113 XCP1 "xylem cysteine peptidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPI9 CTSO "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291191 DDB_G0291191 "cysteine protease" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1349426 Ctsj "cathepsin J" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|69241 Ctsj "cathepsin J" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 317 | |||
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-55 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 9e-47 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 8e-40 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-34 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 6e-28 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 2e-24 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 1e-19 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 4e-14 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 6e-14 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 7e-14 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 4e-13 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 4e-13 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-06 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 0.002 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
Score = 179 bits (457), Expect = 1e-55
Identities = 66/169 (39%), Positives = 99/169 (58%), Gaps = 6/169 (3%)
Query: 143 DWREAGIIGKVRNQQTCGACWAFSTVETAESMHALKNGTLSLLSVQEVIDCAGNGNMGCS 202
DWRE G + V++Q +CG+CWAFSTV E +A+K G L LS Q+++DC+ +GN GC+
Sbjct: 5 DWREKGAVTPVKDQGSCGSCWAFSTVGALEGAYAIKTGKLVSLSEQQLVDCSTSGNNGCN 64
Query: 203 GGDFCALLDWMDVNKVVLEPESEYPLLLKDAACKRKATSPNGVKIKSYTCDTLIPSESSI 262
GG+ +++ + ES+YP KD CK +S G KI Y + E ++
Sbjct: 65 GGNPDNAFEYVKNGGLAS--ESDYPYTGKDGTCKYN-SSKVGAKITGY-SNVPPGDEEAL 120
Query: 263 LTDIATHGPVIAAVNA-LTWQYYLGGVIQYNCDGSLANINHAVQIVGYD 310
+A +GPV A++A ++Q+Y GG+ C S N+NHAV +VGY
Sbjct: 121 KAALANYGPVSVAIDASSSFQFYKGGIYSGPC-CSNTNLNHAVLLVGYG 168
|
Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 317 | |||
| KOG1542|consensus | 372 | 100.0 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| KOG1543|consensus | 325 | 100.0 | ||
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| KOG1544|consensus | 470 | 99.97 | ||
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 99.71 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.67 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 99.55 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.36 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 97.56 | |
| PF08127 | 41 | Propeptide_C1: Peptidase family C1 propeptide; Int | 95.64 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 93.91 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 92.09 | |
| KOG4128|consensus | 457 | 87.28 | ||
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 86.99 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 86.65 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 81.64 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-70 Score=487.16 Aligned_cols=260 Identities=35% Similarity=0.588 Sum_probs=227.0
Q ss_pred HHHHHHHHHHHhCCccCch-hHHHHHHHHHHHHHHHHHHhhcCCCCCCeEEecCcCCCCCHHHHHHhhhccccc-ccccc
Q psy12185 33 KLELFSSFQQRYKKSYSKS-EHDIRFKNFEKSLDIIEELNKNRQSPESARYGITEFSDLSEEEFKTRHLRHSVN-KHVLM 110 (317)
Q Consensus 33 ~~~~f~~~~~~~~K~Y~~~-E~~~R~~iF~~n~~~I~~~N~~~~~~~~~~~g~N~fsD~t~eEf~~~~~~~~~~-~~~~~ 110 (317)
....|..|+.+|+|+|.+. |...|+.||+.|+..+++++.. ...+..+|+|+|||||+|||+++++..... .+.+.
T Consensus 67 ~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~--d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~ 144 (372)
T KOG1542|consen 67 LEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQEN--DPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPG 144 (372)
T ss_pred hHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhc--CccccccCccchhhcCHHHHHHHhhccccccccCcc
Confidence 4789999999999999998 9999999999999999998852 445899999999999999998765532211 00111
Q ss_pred cCCCCCCCCCccccccccccCCCCCCCCCceeecccCCCCCCCcCCCCCccHHHHHHHHHHHHHHHHHcCCCccCCHHHH
Q psy12185 111 SHHKHHDHHHNHVKKRSITTGITIPTGIPVKKDWREAGIIGKVRNQQTCGACWAFSTVETAESMHALKNGTLSLLSVQEV 190 (317)
Q Consensus 111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~g~v~~v~dQg~CGsCwAfa~~~~le~~~~i~~~~~~~lS~q~l 190 (317)
.. ......+...||++||||++|+||||||||.||||||||+++++|++++|++|++++||||||
T Consensus 145 ~~---------------~~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeL 209 (372)
T KOG1542|consen 145 DA---------------AEAPIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQEL 209 (372)
T ss_pred cc---------------ccCcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhh
Confidence 00 000123456899999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCCCCCCCCCCchHHHHHHHHHhCCCCCCCCCCccccCCC-cccCCCCCCCceEEeeeEEecCCCcHHHHHHHHHhC
Q psy12185 191 IDCAGNGNMGCSGGDFCALLDWMDVNKVVLEPESEYPLLLKDA-ACKRKATSPNGVKIKSYTCDTLIPSESSILTDIATH 269 (317)
Q Consensus 191 ~dC~~~~~~gC~GG~~~~a~~y~~~~~~Gi~~e~~yPY~~~~~-~C~~~~~~~~~~~i~~~~~~~~~~~~~~i~~al~~~ 269 (317)
+||+. .++||+||.+..||+|+++. .||..|.+|||++..+ .|..++.. ..+.|++|..+. .||++|...|+++
T Consensus 210 vDCD~-~d~gC~GGl~~nA~~~~~~~-gGL~~E~dYPY~g~~~~~C~~~~~~-~~v~I~~f~~l~--~nE~~ia~wLv~~ 284 (372)
T KOG1542|consen 210 VDCDS-CDNGCNGGLMDNAFKYIKKA-GGLEKEKDYPYTGKKGNQCHFDKSK-IVVSIKDFSMLS--NNEDQIAAWLVTF 284 (372)
T ss_pred hcccC-cCCcCCCCChhHHHHHHHHh-CCccccccCCccccCCCccccchhh-ceEEEeccEecC--CCHHHHHHHHHhc
Confidence 99998 89999999999999997664 8999999999999988 89998877 889999998765 6999999999999
Q ss_pred CCeEEEEecccccccCCCeEeC---CCCCCCCCCCeEEEEEEeecCC---Cee
Q psy12185 270 GPVIAAVNALTWQYYLGGVIQY---NCDGSLANINHAVQIVGYDNYS---RTW 316 (317)
Q Consensus 270 gPv~v~i~~~~f~~Y~~GIy~~---~c~~~~~~~~Hav~iVGyg~~~---~~W 316 (317)
|||+|+|++..+|+|.+||+.+ .|.+.. +||||+|||||.++ .||
T Consensus 285 GPi~vgiNa~~mQ~YrgGV~~P~~~~Cs~~~--~~HaVLlvGyG~~g~~~PYW 335 (372)
T KOG1542|consen 285 GPLSVGINAKPMQFYRGGVSCPSKYICSPKL--LNHAVLLVGYGSSGYEKPYW 335 (372)
T ss_pred CCeEEEEchHHHHHhcccccCCCcccCCccc--cCceEEEEeecCCCCCCceE
Confidence 9999999999999999999998 698876 89999999999876 477
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 317 | ||||
| 1pci_A | 322 | Procaricain Length = 322 | 6e-22 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 3e-21 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 1e-19 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 3e-19 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 3e-19 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 4e-19 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 4e-19 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 4e-19 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 5e-19 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 5e-19 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 5e-19 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 5e-19 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 7e-19 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 2e-18 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 2e-18 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 3e-18 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 5e-18 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 5e-18 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 6e-18 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 6e-18 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 7e-18 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 7e-18 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 7e-18 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 8e-18 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 9e-18 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 9e-18 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 9e-18 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 1e-17 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 1e-17 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 1e-17 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 2e-17 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 2e-17 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-17 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 3e-17 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 3e-17 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 4e-17 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 4e-17 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 6e-17 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 6e-17 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 7e-17 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 8e-17 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 9e-17 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 1e-16 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 1e-16 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 1e-16 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 1e-16 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 1e-16 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 1e-16 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 3e-16 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 4e-16 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 4e-16 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 5e-16 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 8e-16 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 1e-15 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 3e-15 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 3e-15 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 3e-15 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 6e-15 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 9e-15 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 1e-14 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 1e-14 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-14 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 3e-14 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 3e-14 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 4e-14 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 4e-14 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 7e-14 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 1e-13 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 2e-13 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 2e-13 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 3e-13 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 5e-13 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 6e-13 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 1e-12 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 2e-12 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 3e-12 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 3e-12 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 5e-12 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 8e-12 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 1e-11 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 2e-11 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 1e-10 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 1e-08 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 3e-07 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 3e-06 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 4e-06 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 4e-06 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 5e-06 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 2e-05 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 2e-05 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 4e-05 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 9e-05 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 1e-04 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 1e-04 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 2e-04 |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
|
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 317 | |||
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 1e-65 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 2e-62 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 5e-62 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 7e-62 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 2e-61 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 2e-60 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 3e-60 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 7e-59 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 1e-45 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 7e-45 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 5e-44 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 1e-42 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 2e-42 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 2e-42 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 2e-42 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 2e-42 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 2e-42 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 3e-42 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 3e-42 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 3e-42 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 4e-42 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 4e-42 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 5e-42 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 6e-42 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 9e-42 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 2e-41 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 4e-41 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 1e-40 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 2e-40 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 3e-40 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 6e-40 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 4e-39 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 4e-37 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 1e-33 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 2e-32 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 1e-31 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 1e-31 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 4e-31 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 2e-30 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 2e-14 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 4e-14 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 1e-04 |
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
Score = 207 bits (530), Expect = 1e-65
Identities = 74/285 (25%), Positives = 129/285 (45%), Gaps = 37/285 (12%)
Query: 35 ELFSSFQQRYKKSYSKSEHDIRFKNFEKSLDIIEELN-KNRQSPESARYGITEFSDLSEE 93
+L+ +++ Y K Y+ ++ R +EK++ I+E N ++ + G+ +F+D++ E
Sbjct: 3 DLWHQWKRMYNKEYNGADDQHRRNIWEKNVKHIQEHNLRHDLGLVTYTLGLNQFTDMTFE 62
Query: 94 EFKTRHLRHSVNKHVLMSHHKHHDHHHNHVKKRSITTGITIPTGIPVKKDWREAGIIGKV 153
EFK ++L ++SH ++ ++ +P K DWRE+G + +V
Sbjct: 63 EFKAKYLTEMSRASDILSHGVPYEANN---------------RAVPDKIDWRESGYVTEV 107
Query: 154 RNQQTCGACWAFSTVETAESMHALKNGTLSLLSVQEVIDCAGN-GNMGCSGGDFCALLDW 212
++Q CG+ WAFST T E + T S Q+++DC+ GN GC GG
Sbjct: 108 KDQGNCGSGWAFSTTGTMEGQYMKNERTSISFSEQQLVDCSRPWGNNGCGGG-------L 160
Query: 213 MD-----VNKVVLEPESEYPLLLKDAACKRKATSPNGVKIKSYTCDTLIPS--ESSILTD 265
M+ + + LE ES YP + C+ K+ + + S E +
Sbjct: 161 MENAYQYLKQFGLETESSYPYTAVEGQCRYNK-QLGVAKVTGF---YTVHSGSEVELKNL 216
Query: 266 IATHGPVIAAVNAL-TWQYYLGGVIQYNCDGSLANINHAVQIVGY 309
+ GP AV+ + Y G+ + S +NHAV VGY
Sbjct: 217 VGAEGPAAVAVDVESDFMMYRSGIY-QSQTCSPLRVNHAVLAVGY 260
|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 317 | |||
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.97 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.96 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.89 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 99.75 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 99.71 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 96.44 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 95.8 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 95.79 | |
| 3erv_A | 236 | Putative C39-like peptidase; structural genomics, | 80.2 |
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.1e-69 Score=499.65 Aligned_cols=262 Identities=29% Similarity=0.486 Sum_probs=218.4
Q ss_pred chHHHHHHHHHHHHHhCCccCch-hHHHHHHHHHHHHHHHHHHhhcCCCCCCeEEecCcCCCCCHHHHHHhhhccccccc
Q psy12185 29 NLEQKLELFSSFQQRYKKSYSKS-EHDIRFKNFEKSLDIIEELNKNRQSPESARYGITEFSDLSEEEFKTRHLRHSVNKH 107 (317)
Q Consensus 29 ~~~~~~~~f~~~~~~~~K~Y~~~-E~~~R~~iF~~n~~~I~~~N~~~~~~~~~~~g~N~fsD~t~eEf~~~~~~~~~~~~ 107 (317)
+++++..+|++|+.+|+|+|.+. |+.+|++||++|+++|++||+ .+.+|++|+|+|+|||.|||+++++..... .
T Consensus 58 s~~~~~~lf~~f~~~~~K~Y~~~~E~~~R~~iF~~Nl~~I~~~N~---~~~sy~~g~N~FaDlT~eEf~~~~~~~~~~-~ 133 (363)
T 3tnx_A 58 STERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNK---KNNSYWLGLNVFADMSNDEFKEKYTGSIAG-N 133 (363)
T ss_dssp CHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHTT---SCCSEEECSCTTTTSCHHHHHHHHSCSSCS-C
T ss_pred CHHHHHHHHHHHHHHcCCcCCCHHHHHHHHHHHHHHHHHHHHHHc---CCCCeEEeccccccCCHHHHHHHhcccccc-c
Confidence 44678999999999999999998 999999999999999999994 567999999999999999997665432211 0
Q ss_pred ccccCCCCCCCCCccccccccccCCCCCCCCCceeecccCCCCCCCcCCCCCccHHHHHHHHHHHHHHHHHcCCCccCCH
Q psy12185 108 VLMSHHKHHDHHHNHVKKRSITTGITIPTGIPVKKDWREAGIIGKVRNQQTCGACWAFSTVETAESMHALKNGTLSLLSV 187 (317)
Q Consensus 108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~g~v~~v~dQg~CGsCwAfa~~~~le~~~~i~~~~~~~lS~ 187 (317)
.... ....... ......+||++||||++|+||||||||.||||||||++++||++++|+++..+.||+
T Consensus 134 ~~~~---~~~~~~~---------~~~~~~~lP~s~DWR~~g~VtpVkdQG~CGSCWAFsa~~alE~~~~i~tg~~~~LSe 201 (363)
T 3tnx_A 134 YTTT---ELSYEEV---------LNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSE 201 (363)
T ss_dssp CCCS---SSSSSCC---------CCCSCCCCCSCEEGGGGTCCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHSCCCCBCH
T ss_pred cccc---ccccccc---------cCcccCCCCcceecccCCCCCCCccCCcCCchhhhhhcccHHHHHHHHcCCCCCcCH
Confidence 0000 0000000 012245799999999999999999999999999999999999999999999999999
Q ss_pred HHHhhcCCCCCCCCCCCchHHHHHHHHHhCCCCCCCCCCccccCCCcccCCCCCCCceEEeeeEEecCCCcHHHHHHHHH
Q psy12185 188 QEVIDCAGNGNMGCSGGDFCALLDWMDVNKVVLEPESEYPLLLKDAACKRKATSPNGVKIKSYTCDTLIPSESSILTDIA 267 (317)
Q Consensus 188 q~l~dC~~~~~~gC~GG~~~~a~~y~~~~~~Gi~~e~~yPY~~~~~~C~~~~~~~~~~~i~~~~~~~~~~~~~~i~~al~ 267 (317)
|+|+||+. .+.||+||++..||+|+.+ .||++|++|||.+.++.|..........++.+|..+. ..++..++.+|+
T Consensus 202 Q~LvdC~~-~~~GC~GG~~~~a~~yi~~--~Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~-~~~e~~l~~~v~ 277 (363)
T 3tnx_A 202 QELLDCDR-RSYGCNGGYPWSALQLVAQ--YGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQ-PYNEGALLYSIA 277 (363)
T ss_dssp HHHHHHCT-TSCTTBCCCHHHHHHHHHH--TCBCBTTTSCCCSSCCCCCGGGGCSCSBCCCEEEEEC-SSCHHHHHHHHT
T ss_pred HHHhcccC-CCCCCCCCChHHHHhHHHh--cCccccccCCCcCcCCCcccCCCCCceeeccceEEcc-hhhHHHHHHHHH
Confidence 99999998 7889999999999999987 6999999999999998887644432456777777665 567888888886
Q ss_pred hCCCeEEEEec--ccccccCCCeEeCCCCCCCCCCCeEEEEEEeecCCCee
Q psy12185 268 THGPVIAAVNA--LTWQYYLGGVIQYNCDGSLANINHAVQIVGYDNYSRTW 316 (317)
Q Consensus 268 ~~gPv~v~i~~--~~f~~Y~~GIy~~~c~~~~~~~~Hav~iVGyg~~~~~W 316 (317)
+|||+|+|++ ++|++|++|||...|+.. +||||+|||||+ +||
T Consensus 278 -~gPvsvai~a~~~~F~~Y~sGVy~~~~~~~---lnHaV~iVGyG~--~YW 322 (363)
T 3tnx_A 278 -NQPVSVVLEAAGKDFQLYRGGIFVGPCGNK---VDHAVAAVGYGP--NYI 322 (363)
T ss_dssp -TSCEEEEECCCSHHHHTEEEEEECCCCCSC---CCEEEEEEEEET--TEE
T ss_pred -cCCcEEEEEecchhhhCCCCCEECCCCCCC---CCeEEEEEEcCC--CcE
Confidence 5999999998 689999999999888754 799999999997 477
|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 317 | ||||
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 1e-33 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 5e-31 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 9e-26 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 2e-25 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 3e-24 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 5e-24 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 2e-23 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 4e-23 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 4e-23 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 6e-23 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 2e-22 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 2e-22 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 4e-22 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 1e-21 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 1e-21 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 1e-21 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 4e-21 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 2e-20 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 1e-19 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 1e-15 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Score = 123 bits (309), Expect = 1e-33
Identities = 68/279 (24%), Positives = 118/279 (42%), Gaps = 24/279 (8%)
Query: 35 ELFSSFQQRYKKSYSKSEHDIRFKNFEKSLDIIEELNKN-RQSPESARYGITEFSDLSEE 93
++ ++ + + Y +E R +EK++ +IE N+ R+ S + F D++ E
Sbjct: 10 AQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSE 69
Query: 94 EFKTRHLRHSVNKHVLMSHHKHHDHHHNHVKKRSITTGITIPTGIPVKKDWREAGIIGKV 153
EF+ + ++ V + + P DWRE G + V
Sbjct: 70 EFRQVM-----------NGFQNRKPRKGKVFQEPLFYEA------PRSVDWREKGYVTPV 112
Query: 154 RNQQTCGACWAFSTVETAESMHALKNGTLSLLSVQEVIDCAGNG-NMGCSGGDFCALLDW 212
+NQ CG+CWAFS E K G L LS Q ++DC+G N GC+GG +
Sbjct: 113 KNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQY 172
Query: 213 MDVNKVVLEPESEYPLLLKDAACKRKATSPNGVKIKSYTCDTLIPSESSILTDIATHGPV 272
+ N + + E YP +A + +P + E +++ +AT GP+
Sbjct: 173 VQDNGGL-DSEESYP---YEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPI 228
Query: 273 IAAVNALTWQ-YYLGGVIQYNCDGSLANINHAVQIVGYD 310
A++A + I + D S +++H V +VGY
Sbjct: 229 SVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYG 267
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 317 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.58 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 97.76 | |
| d1pxva_ | 183 | Staphopain SspB {Staphylococcus aureus [TaxId: 128 | 93.98 | |
| d1cv8a_ | 173 | Staphopain StpA {Staphylococcus aureus [TaxId: 128 | 89.88 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=7e-63 Score=453.60 Aligned_cols=258 Identities=27% Similarity=0.478 Sum_probs=214.9
Q ss_pred HHHHHHHHHHHHhCCccCchhHHHHHHHHHHHHHHHHHHhhc-CCCCCCeEEecCcCCCCCHHHHHHhhhcccccccccc
Q psy12185 32 QKLELFSSFQQRYKKSYSKSEHDIRFKNFEKSLDIIEELNKN-RQSPESARYGITEFSDLSEEEFKTRHLRHSVNKHVLM 110 (317)
Q Consensus 32 ~~~~~f~~~~~~~~K~Y~~~E~~~R~~iF~~n~~~I~~~N~~-~~~~~~~~~g~N~fsD~t~eEf~~~~~~~~~~~~~~~ 110 (317)
.+..+|++||++|+|+|.+.|+.+|++||.+|+++|++||++ ..++.+|+||+|+|+|||.|||.+.++..... .
T Consensus 7 ~l~~~F~~f~~~~~K~Y~~~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~----~ 82 (316)
T d1cs8a_ 7 SLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNR----K 82 (316)
T ss_dssp GGHHHHHHHHHHTTCCCCTTHHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCC----C
T ss_pred HHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhcccccc----c
Confidence 467889999999999997778899999999999999999986 34678999999999999999997654322111 0
Q ss_pred cCCCCCCCCCccccccccccCCCCCCCCCceeecccCCCCCCCcCCCCCccHHHHHHHHHHHHHHHHHcCCCccCCHHHH
Q psy12185 111 SHHKHHDHHHNHVKKRSITTGITIPTGIPVKKDWREAGIIGKVRNQQTCGACWAFSTVETAESMHALKNGTLSLLSVQEV 190 (317)
Q Consensus 111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~DwR~~g~v~~v~dQg~CGsCwAfa~~~~le~~~~i~~~~~~~lS~q~l 190 (317)
. ...... ..+...+||++||||++|+|+||||||.||||||||+++++|++++++++..+.||+|+|
T Consensus 83 ~-~~~~~~------------~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~l 149 (316)
T d1cs8a_ 83 P-RKGKVF------------QEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNL 149 (316)
T ss_dssp C-SCCEEC------------CCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHH
T ss_pred c-ccCccc------------cCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhh
Confidence 0 000000 012346899999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCC-CCCCCCCCchHHHHHHHHHhCCCCCCCCCCccccCCCcccCCCCCCCceEEeeeEEecCCCcHHHHHHHHHhC
Q psy12185 191 IDCAGN-GNMGCSGGDFCALLDWMDVNKVVLEPESEYPLLLKDAACKRKATSPNGVKIKSYTCDTLIPSESSILTDIATH 269 (317)
Q Consensus 191 ~dC~~~-~~~gC~GG~~~~a~~y~~~~~~Gi~~e~~yPY~~~~~~C~~~~~~~~~~~i~~~~~~~~~~~~~~i~~al~~~ 269 (317)
+||+.. ++.||.||++..|++|+..+ +++..|.+|||.+....|...... ....+..+... ..++..|+++|+.+
T Consensus 150 vdC~~~~~~~~c~gg~~~~a~~y~~~~-g~~~~e~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~--~~~~~~l~~~l~~~ 225 (316)
T d1cs8a_ 150 VDCSGPQGNEGCNGGLMDYAFQYVQDN-GGLDSEESYPYEATEESCKYNPKY-SVANDAGFVDI--PKQEKALMKAVATV 225 (316)
T ss_dssp HHHCGGGTCCGGGCBCHHHHHHHHHHH-TCEEBTTTSCCCSSCCCCCCCGGG-EEECCCCEEEC--CSCHHHHHHHHHHH
T ss_pred hhccccccCCCCCCCchHHHHHHHHhc-Cccccccccccccccccccccccc-ccccccccccc--cCcHHHHHHHHHHh
Confidence 999863 57899999999999999885 568899999999988888766554 44555555543 46789999999999
Q ss_pred CCeEEEEec--ccccccCCCeEeC-CCCCCCCCCCeEEEEEEeecC
Q psy12185 270 GPVIAAVNA--LTWQYYLGGVIQY-NCDGSLANINHAVQIVGYDNY 312 (317)
Q Consensus 270 gPv~v~i~~--~~f~~Y~~GIy~~-~c~~~~~~~~Hav~iVGyg~~ 312 (317)
|||+|+|++ .+|++|++|||.. .|+... +||||+|||||.+
T Consensus 226 gpv~v~i~~~~~~f~~y~~Gi~~~~~c~~~~--~nHaV~iVGyG~d 269 (316)
T d1cs8a_ 226 GPISVAIDAGHESFLFYKEGIYFEPDCSSED--MDHGVLVVGYGFE 269 (316)
T ss_dssp CCEEEEECCCSHHHHTEEEEEECCTTCCSSC--CCEEEEEEEEEEE
T ss_pred CCeEEEEEeccchhccccCCcccCCCCCCCc--CCEEEEEEEEccc
Confidence 999999998 6899999999987 676654 8999999999954
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|