Psyllid ID: psy12792

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570
MDVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIAQEQK
ccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHccccccccccccccHHHHHHHHHHccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHcHHHHHHcccHHHHHHccHHHHHHHHHccccccccHHHHHHHHHcccHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccHHHHHHHHHHHHHHcccccccccccccEEEccccccccccccEEEEEEEEEcccccEEEEEEEEHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHcccccccEEEEEccccEEEcccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccEEEcEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcc
MDVFNKLKSTVTSTVNQissvlpgnpvtreyditghigsAGQGLLWKIYsgtkrstnqdaSIFVLEKRQLEKLDMKLREEYFTFVKRGVSqltrlrhpqilivqhpleesslanvlghtenlpnplpphlrsyklyDIEIKYGLMQvgeglnflhndakkihhnlcphniivshhgawkifgfdfsrelcldptrqltpardmFSLGATICAVYnngksiissdqnitfselgsaninsarlSDIDEGLRELVKMMLntspelrpdnhdflkspyfddigvkTLNYLDSIfqwdnlekskfykglpQIMEklphrintnrilPCLMKEfinssmvpfvlPNVLYIAEQCsqqeftrdvlphlipvmklqEPIQVLLIFMQKMEVLlkltppeqvkseVLPLLYRALESDSQQIQELCLSILPSlanlieypamknALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVldevlpflpqipsrdpaVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIAQEQK
mdvfnklkSTVTstvnqissvlpgnpVTREYDITGHIGSAGQGLLWKIYSGTkrstnqdasifVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTspelrpdnhDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRtkleqlnsiaqeqk
MDVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIAQEQK
****************QISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANIN*ARLSDIDEGLRELVKMML**********HDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRV*******************
*D*FNKL********************TREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKR**************TFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMV**********************
MDVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIAQEQK
*DVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQLTPARDMFSLGATICAVYNNGKSIISSDQNITFSELGSANINSARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIAQEQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query570 2.2.26 [Sep-21-2011]
Q6P3W7 929 SCY1-like protein 2 OS=Ho yes N/A 0.996 0.611 0.524 0.0
Q8CFE4 930 SCY1-like protein 2 OS=Mu yes N/A 0.996 0.610 0.519 0.0
Q9P7X5 749 Protein kinase domain-con yes N/A 0.896 0.682 0.277 5e-61
P53009 804 Protein kinase-like prote yes N/A 0.898 0.636 0.243 3e-34
Q55BQ3 1125 Probable inactive serine/ yes N/A 0.522 0.264 0.294 7e-33
Q55GS2 813 Probable inactive serine/ no N/A 0.833 0.584 0.225 9e-28
Q96KG9 808 N-terminal kinase-like pr no N/A 0.852 0.601 0.227 4e-25
A6QLH6 807 N-terminal kinase-like pr no N/A 0.835 0.589 0.226 1e-24
Q28FH2 827 N-terminal kinase-like pr no N/A 0.826 0.569 0.235 7e-24
Q5M9F8 807 N-terminal kinase-like pr no N/A 0.852 0.602 0.226 1e-23
>sp|Q6P3W7|SCYL2_HUMAN SCY1-like protein 2 OS=Homo sapiens GN=SCYL2 PE=1 SV=1 Back     alignment and function desciption
 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/618 (52%), Positives = 438/618 (70%), Gaps = 50/618 (8%)

Query: 3   VFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASI 62
           + NKLKSTVT     ++S + GNPVTRE+D+  HI S G GL WKI++GTK+ST Q+ ++
Sbjct: 4   MLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAV 63

Query: 63  FVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEES------------ 110
           FV +K+ ++K     +++    +KRGV QLTRLRHP++L VQHPLEES            
Sbjct: 64  FVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVF 123

Query: 111 -SLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHN 169
            SLANVLG+ ENLP+P+ P ++ YKLYD+E KYGL+QV EGL+FLH+  K +H N+ P N
Sbjct: 124 ASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPEN 183

Query: 170 IIVSHHGAWKIFGFDFS----------------------RELCLDPTRQLTP-------- 199
           II++  GAWKI GFDF                         LCL     L P        
Sbjct: 184 IILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSC 243

Query: 200 --ARDMFSLGATICAVYNNGKSIISSDQNITFSELGS-----ANINSARLSDIDEGLREL 252
             A DM+SLG  + AV+N GK I   ++   +          + + S+ L++I E +RE 
Sbjct: 244 ETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSSLTNIPEEVREH 303

Query: 253 VKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKL 312
           VK++LN +P +RPD     K P+FDD+G  TL Y D++FQ DNL+KS+F+KGLP+++ KL
Sbjct: 304 VKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKSQFFKGLPKVLPKL 363

Query: 313 PHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPI 372
           P R+   RILPCL  EF+N  MVPFVLPNVL IAE+C+++E+ + +LP L PV K QEPI
Sbjct: 364 PKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQEPI 423

Query: 373 QVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPA 432
           Q+LLIF+QKM++LL  TPP+++K+ VLP++YRALE+ S QIQELCL+I+P+ ANLI+YP+
Sbjct: 424 QILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPS 483

Query: 433 MKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVL 492
           MKNAL+PRIK  C+ TS ++VRVN LVCLGK++EYLDKW VLD++LPFL QIPS++PAVL
Sbjct: 484 MKNALIPRIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVL 543

Query: 493 MGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVE 552
           MGILGIYK    HKK+ I+KE +A K+LP L+PL IEN+L+LNQFNS ++VIK+M+NR+E
Sbjct: 544 MGILGIYKCTFTHKKLGITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLE 603

Query: 553 AEHRTKLEQLNSIAQEQK 570
           +EH+TKLEQL+ + ++QK
Sbjct: 604 SEHKTKLEQLHIMQEQQK 621
Component of AP2-containing clathrin coated structures at the plasma membrane or of endocytic coated vesicles. According to PubMed:15809293, probable serine/threonine-protein kinase that phosphorylates, in vitro, the beta2-subunit of the plasma membrane adapter complex AP2 and other proteins in presence of poly-L-lysine. According to PubMed:16914521, has no detectable kinase activity in vitro. May regulate clathrin-dependent trafficking between the TGN and/or the endosomal system.
Homo sapiens (taxid: 9606)
>sp|Q8CFE4|SCYL2_MOUSE SCY1-like protein 2 OS=Mus musculus GN=Scyl2 PE=1 SV=1 Back     alignment and function description
>sp|Q9P7X5|PPK32_SCHPO Protein kinase domain-containing protein ppk32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk32 PE=1 SV=1 Back     alignment and function description
>sp|P53009|SCY1_YEAST Protein kinase-like protein SCY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCY1 PE=1 SV=1 Back     alignment and function description
>sp|Q55BQ3|SCY2_DICDI Probable inactive serine/threonine-protein kinase scy2 OS=Dictyostelium discoideum GN=scy2 PE=3 SV=1 Back     alignment and function description
>sp|Q55GS2|SCY1_DICDI Probable inactive serine/threonine-protein kinase scy1 OS=Dictyostelium discoideum GN=scy1 PE=3 SV=1 Back     alignment and function description
>sp|Q96KG9|NTKL_HUMAN N-terminal kinase-like protein OS=Homo sapiens GN=SCYL1 PE=1 SV=1 Back     alignment and function description
>sp|A6QLH6|NTKL_BOVIN N-terminal kinase-like protein OS=Bos taurus GN=SCYL1 PE=2 SV=1 Back     alignment and function description
>sp|Q28FH2|NTKL_XENTR N-terminal kinase-like protein OS=Xenopus tropicalis GN=scyl1 PE=2 SV=1 Back     alignment and function description
>sp|Q5M9F8|NTKL_RAT N-terminal kinase-like protein OS=Rattus norvegicus GN=Scyl1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query570
443429455 830 SCY1-like protein 2 [Heliconius erato] 1.0 0.686 0.610 0.0
357624578 856 hypothetical protein KGM_08305 [Danaus p 0.998 0.664 0.608 0.0
229487384 830 unnamed protein product [Heliconius melp 1.0 0.686 0.605 0.0
193613204 798 PREDICTED: SCY1-like protein 2-like isof 0.987 0.705 0.585 0.0
427779927 743 Putative protein kinase [Rhipicephalus p 0.987 0.757 0.553 0.0
427788691 877 Putative protein kinase [Rhipicephalus p 0.987 0.641 0.553 0.0
91094623 789 PREDICTED: similar to SCY1-like 2 [Tribo 0.992 0.717 0.560 0.0
242006434616 conserved hypothetical protein [Pediculu 0.996 0.922 0.555 0.0
449272208 929 SCY1-like protein 2 [Columba livia] 0.996 0.611 0.530 0.0
326911745 931 PREDICTED: SCY1-like protein 2-like isof 0.996 0.610 0.527 0.0
>gi|443429455|gb|AGC92739.1| SCY1-like protein 2 [Heliconius erato] Back     alignment and taxonomy information
 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/619 (61%), Positives = 476/619 (76%), Gaps = 49/619 (7%)

Query: 1   MDVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDA 60
           MDVFNK  S+V++TV+Q+S VLPGNPVTRE++ T +I SAG GLLWK+Y G K+ST Q+A
Sbjct: 1   MDVFNKFYSSVSNTVSQLSGVLPGNPVTREFEATQYIASAGPGLLWKVYKGFKKSTKQEA 60

Query: 61  SIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEES---------- 110
           SIFVLEK+QL++     R+     +KRG+ QLT+LRHPQIL VQH LEES          
Sbjct: 61  SIFVLEKKQLDRWSKPDRDIMIDILKRGIVQLTKLRHPQILTVQHSLEESRESLAFATEP 120

Query: 111 ---SLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCP 167
              SLANVLG++EN+P P+P +L +YKLY++EIKYGLMQ+ EGL FLHND K +HHN+CP
Sbjct: 121 VFASLANVLGNSENMPQPIPTNLVNYKLYEVEIKYGLMQIAEGLAFLHNDVKLLHHNICP 180

Query: 168 HNIIVSHHGAWKIFGFDFS---------------RELC-------------LDPTRQLT- 198
            +IIV+  GAWKIFGFDF                 E C             L P   L+ 
Sbjct: 181 ESIIVNQQGAWKIFGFDFCIANQSMAGSAPFWPFNEYCQAMPPLTQPILDYLAPEYILSA 240

Query: 199 ---PARDMFSLGATICAVYNNGKSIISSDQN--ITFSELGSA--NINSARLSDIDEGLRE 251
              PA D++SLG  I +V++ G   + +  N    F    +   N+  +RL  ++EGLRE
Sbjct: 241 THSPASDIYSLGMLIYSVHSTGHQTLGNIGNDYAKFKRFVNEIRNLPPSRLLCVNEGLRE 300

Query: 252 LVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEK 311
            VK+MLN +PELRPD H FLK PYF+DIGVKTLNYLDS+FQWDNL+KS+FYKGLPQI++K
Sbjct: 301 FVKLMLNVTPELRPDPHQFLKIPYFEDIGVKTLNYLDSLFQWDNLQKSQFYKGLPQIIQK 360

Query: 312 LPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEP 371
           +PHRI   RILPCL KEF+N  MVPFVLPNVL IAE  +++E+ + +LP L PVM +Q+P
Sbjct: 361 MPHRICIYRILPCLTKEFVNPPMVPFVLPNVLLIAENSTKEEYAKYILPVLKPVMLIQDP 420

Query: 372 IQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYP 431
           IQ+LLIFMQKME+LLKLTP ++VKS++LP+LYRALESD+QQIQELCLS+LP+ A+LI+YP
Sbjct: 421 IQILLIFMQKMELLLKLTPGDEVKSDILPMLYRALESDAQQIQELCLSVLPTFASLIDYP 480

Query: 432 AMKNALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAV 491
           AMKNALLPRIKRLC+ T++ISVRVNCL+CLGKL+E+LDKWLVLDE++PFLPQIPSR+PAV
Sbjct: 481 AMKNALLPRIKRLCLGTNYISVRVNCLLCLGKLLEHLDKWLVLDEIIPFLPQIPSREPAV 540

Query: 492 LMGILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRV 551
           LMGILGIYKL L+HKK+ I+KE+MATK+LPFL+PL +EN L+LNQFN+L++++K M+ +V
Sbjct: 541 LMGILGIYKLTLSHKKLGITKEVMATKVLPFLIPLCVENGLTLNQFNALISLVKQMIGKV 600

Query: 552 EAEHRTKLEQLNSIAQEQK 570
           E EHRTKLEQLNSI  E K
Sbjct: 601 ETEHRTKLEQLNSIQNESK 619

Source: Heliconius erato

Species: Heliconius erato

Genus: Heliconius

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357624578|gb|EHJ75302.1| hypothetical protein KGM_08305 [Danaus plexippus] Back     alignment and taxonomy information
>gi|229487384|emb|CAY54151.1| unnamed protein product [Heliconius melpomene] Back     alignment and taxonomy information
>gi|193613204|ref|XP_001944793.1| PREDICTED: SCY1-like protein 2-like isoform 1 [Acyrthosiphon pisum] gi|328710316|ref|XP_003244223.1| PREDICTED: SCY1-like protein 2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|427779927|gb|JAA55415.1| Putative protein kinase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427788691|gb|JAA59797.1| Putative protein kinase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|91094623|ref|XP_969159.1| PREDICTED: similar to SCY1-like 2 [Tribolium castaneum] gi|270016433|gb|EFA12879.1| hypothetical protein TcasGA2_TC011557 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242006434|ref|XP_002424055.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507361|gb|EEB11317.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|449272208|gb|EMC82230.1| SCY1-like protein 2 [Columba livia] Back     alignment and taxonomy information
>gi|326911745|ref|XP_003202216.1| PREDICTED: SCY1-like protein 2-like isoform 2 [Meleagris gallopavo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query570
UNIPROTKB|F1NWS5 932 SCYL2 "Uncharacterized protein 0.650 0.398 0.593 1.5e-175
UNIPROTKB|F8VSC5681 SCYL2 "SCY1-like protein 2" [H 0.650 0.544 0.585 1.5e-175
UNIPROTKB|Q6P3W7 929 SCYL2 "SCY1-like protein 2" [H 0.650 0.399 0.585 1.5e-175
RGD|1305665 930 Scyl2 "SCY1-like 2 (S. cerevis 0.649 0.397 0.590 7.5e-174
MGI|MGI:1289172 930 Scyl2 "SCY1-like 2 (S. cerevis 0.649 0.397 0.587 1.2e-173
ZFIN|ZDB-GENE-041210-205 929 si:ch211-244b2.1 "si:ch211-244 0.649 0.398 0.587 4.2e-171
UNIPROTKB|E2RHE6 905 SCYL2 "Uncharacterized protein 0.650 0.409 0.585 2.1e-167
UNIPROTKB|F1MID0 929 SCYL2 "Uncharacterized protein 0.650 0.399 0.547 3.1e-164
FB|FBgn0039623 835 CG1951 [Drosophila melanogaste 0.663 0.452 0.541 1.4e-159
FB|FBgn0085385 1099 CG34356 [Drosophila melanogast 0.647 0.335 0.256 2.1e-64
UNIPROTKB|F1NWS5 SCYL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1181 (420.8 bits), Expect = 1.5e-175, Sum P(2) = 1.5e-175
 Identities = 223/376 (59%), Positives = 300/376 (79%)

Query:   200 ARDMFSLGATICAVYNNGKSIIS-SDQNI--TFS-ELGS-ANINSARLSDIDEGLRELVK 254
             A DM+SLGA + AV+N GK I   + Q+I  +FS +L   + ++S+ L +I E +RE VK
Sbjct:   246 ASDMYSLGAVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLSSSTLQNIPEEVREHVK 305

Query:   255 MMLNTSPELRPDNHDFLKSPYFDDIGVKTLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPH 314
             ++LN +P +RPD     K P+FDD+G  TL Y DS+FQ DNL+KS+F+KGLP+++ KLP 
Sbjct:   306 LLLNVAPAVRPDADQMTKIPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPK 365

Query:   315 RINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIPVMKLQEPIQV 374
             R+   RILPCL  EF+N  MVPFVLPNVL IAE+C+++E+ R +LP L PV K QEPIQ+
Sbjct:   366 RVIIQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYIRLILPDLGPVFKQQEPIQI 425

Query:   375 LLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMK 434
             LLIF+QKM++LL  TPP+++K+ VLP++YRALE+ S QIQELCL+I+P+ ANLI+YP+MK
Sbjct:   426 LLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMK 485

Query:   435 NALLPRIKRLCISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMG 494
             N+L+PRIK  C+ TS ++VRVN LVCLGK++EYLDKW VLD++LPFL QIPS++PAVLMG
Sbjct:   486 NSLIPRIKTACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMG 545

Query:   495 ILGIYKLVLNHKKMAISKEIMATKILPFLMPLVIENSLSLNQFNSLVAVIKDMVNRVEAE 554
             ILGIYK    HKK+ I+KE +A ++LP L+PL IEN+L+LNQFNS + VIKDM+NR+EAE
Sbjct:   546 ILGIYKCTFTHKKLGITKEQLAGRVLPHLIPLSIENNLNLNQFNSFICVIKDMLNRLEAE 605

Query:   555 HRTKLEQLNSIAQEQK 570
             H+TKLEQL+ + ++QK
Sbjct:   606 HKTKLEQLHVMQEQQK 621
GO:0004672 "protein kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0002092 "positive regulation of receptor internalization" evidence=IEA
GO:0005102 "receptor binding" evidence=IEA
GO:0008333 "endosome to lysosome transport" evidence=IEA
GO:0090090 "negative regulation of canonical Wnt receptor signaling pathway" evidence=IEA
GO:2000286 "receptor internalization involved in canonical Wnt receptor signaling pathway" evidence=IEA
GO:2000370 "positive regulation of clathrin-mediated endocytosis" evidence=IEA
UNIPROTKB|F8VSC5 SCYL2 "SCY1-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P3W7 SCYL2 "SCY1-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305665 Scyl2 "SCY1-like 2 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1289172 Scyl2 "SCY1-like 2 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-205 si:ch211-244b2.1 "si:ch211-244b2.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHE6 SCYL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MID0 SCYL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0039623 CG1951 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0085385 CG34356 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CFE4SCYL2_MOUSENo assigned EC number0.51940.99640.6107yesN/A
Q6P3W7SCYL2_HUMANNo assigned EC number0.52420.99640.6114yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-10
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 4e-10
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 7e-10
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 5e-09
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-06
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 6e-05
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-04
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-04
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 0.002
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 0.003
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 0.003
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 0.004
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 0.004
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 0.004
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information 
 Score = 61.5 bits (150), Expect = 2e-10
 Identities = 56/276 (20%), Positives = 95/276 (34%), Gaps = 46/276 (16%)

Query: 31  YDITGHIGSAGQGLLWKIYSGTKRSTNQDASI--FVLEKRQLEKLDMKLREEYFTFVKRG 88
           Y++   +GS   G    +Y    + T +  ++        + +K     RE         
Sbjct: 1   YELLRKLGSGSFG---TVYKAKHKGTGKIVAVKILKKRSEKSKKDQTARREIRI------ 51

Query: 89  VSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPN-PLPPHLRSYKLYDI-EIKYGLMQ 146
              L RL HP I+ +    E+     ++   E      L  +L         E K   +Q
Sbjct: 52  ---LRRLSHPNIVRLIDAFEDKDHLYLV--MEYCEGGDLFDYLSRGGPLSEDEAKKIALQ 106

Query: 147 VGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSR------------------- 187
           +  GL +LH+    IH +L P NI++  +G  KI  F  ++                   
Sbjct: 107 ILRGLEYLHS-NGIIHRDLKPENILLDENGVVKIADFGLAKKLLKSSSSLTTFVGTPWYM 165

Query: 188 --ELCLDPTRQLTPARDMFSLGATICAVYNNG---KSIISSDQNITFSELGSANINSAR- 241
             E+ L          D++SLG  +  +             DQ      +    +     
Sbjct: 166 APEVLLGGNGYGPKV-DVWSLGVILYELLTGKPPFSGENILDQLQLIRRILGPPLEFDEP 224

Query: 242 -LSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYF 276
             S   E  ++L+K  LN  P  RP   + L+ P+F
Sbjct: 225 KWSSGSEEAKDLIKKCLNKDPSKRPTAEEILQHPWF 260

Length = 260
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 570
KOG2137|consensus 700 100.0
KOG1243|consensus 690 100.0
KOG0615|consensus475 100.0
KOG0575|consensus592 100.0
KOG0593|consensus396 100.0
KOG0592|consensus604 100.0
KOG0581|consensus364 100.0
KOG0598|consensus357 100.0
KOG0595|consensus429 100.0
KOG0661|consensus538 100.0
KOG0591|consensus375 100.0
KOG0659|consensus318 100.0
KOG0600|consensus560 100.0
KOG0588|consensus 786 100.0
KOG0660|consensus359 100.0
KOG0585|consensus576 100.0
KOG0605|consensus550 100.0
KOG0616|consensus355 100.0
KOG0597|consensus 808 100.0
KOG0578|consensus550 100.0
KOG0663|consensus419 100.0
KOG0583|consensus370 100.0
KOG0033|consensus355 100.0
KOG0582|consensus516 100.0
KOG0658|consensus364 100.0
KOG0198|consensus313 100.0
KOG0694|consensus694 100.0
KOG0580|consensus281 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG0599|consensus411 100.0
KOG0611|consensus668 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0594|consensus323 100.0
KOG0610|consensus459 100.0
KOG0032|consensus382 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0192|consensus362 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
KOG0201|consensus467 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
KOG0604|consensus400 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
KOG0667|consensus586 100.0
KOG0197|consensus468 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
KOG4717|consensus 864 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
KOG0579|consensus 1187 100.0
KOG0662|consensus292 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
KOG0983|consensus391 100.0
KOG2345|consensus302 100.0
KOG0607|consensus463 100.0
KOG0589|consensus426 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
KOG0193|consensus678 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
KOG0986|consensus591 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
PHA02988283 hypothetical protein; Provisional 100.0
KOG0574|consensus502 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
KOG0690|consensus516 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
KOG1989|consensus 738 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
KOG4279|consensus1226 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
KOG0577|consensus 948 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
KOG0666|consensus438 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
KOG0669|consensus376 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
KOG1026|consensus774 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
KOG0612|consensus 1317 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
KOG0603|consensus612 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
KOG0586|consensus596 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
KOG0584|consensus632 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
KOG1035|consensus 1351 100.0
KOG0596|consensus677 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
KOG1240|consensus 1431 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
KOG4236|consensus888 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
KOG4645|consensus1509 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
KOG0194|consensus474 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG4721|consensus 904 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
KOG0668|consensus338 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.98
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.98
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.98
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.98
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.98
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.98
KOG0671|consensus415 99.98
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.98
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.98
KOG1006|consensus361 99.98
KOG0696|consensus683 99.98
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.98
KOG1095|consensus1025 99.98
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.98
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.98
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.98
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.97
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.97
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.97
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.97
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.97
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.97
PHA02882294 putative serine/threonine kinase; Provisional 99.97
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.97
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.97
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.97
KOG1187|consensus361 99.97
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.97
KOG0614|consensus732 99.97
KOG1151|consensus775 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
KOG4257|consensus974 99.97
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.97
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.97
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.97
KOG0695|consensus593 99.97
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.97
KOG0608|consensus1034 99.97
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.97
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.97
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.97
KOG0199|consensus 1039 99.97
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.97
KOG4278|consensus 1157 99.97
KOG0670|consensus752 99.97
KOG1027|consensus903 99.97
KOG0196|consensus996 99.97
KOG0664|consensus449 99.97
KOG1094|consensus807 99.97
KOG0665|consensus369 99.96
KOG0587|consensus 953 99.96
KOG2052|consensus513 99.96
KOG4250|consensus 732 99.96
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.96
KOG1290|consensus590 99.96
KOG1025|consensus1177 99.95
PLN03224507 probable serine/threonine protein kinase; Provisio 99.95
KOG0984|consensus282 99.95
KOG0200|consensus609 99.95
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0576|consensus 829 99.94
KOG3653|consensus534 99.94
KOG1152|consensus772 99.94
KOG1345|consensus378 99.93
KOG1167|consensus418 99.92
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.91
KOG1024|consensus563 99.91
PLN00181 793 protein SPA1-RELATED; Provisional 99.9
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.89
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.87
KOG1165|consensus449 99.86
KOG0590|consensus601 99.85
PRK09188365 serine/threonine protein kinase; Provisional 99.84
KOG4158|consensus598 99.84
KOG1163|consensus341 99.83
KOG0603|consensus612 99.8
KOG0606|consensus 1205 99.8
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.79
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.79
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.78
KOG1164|consensus322 99.78
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.77
KOG0195|consensus448 99.74
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.74
smart00090237 RIO RIO-like kinase. 99.69
PRK10345210 hypothetical protein; Provisional 99.69
KOG1033|consensus516 99.67
PRK12274218 serine/threonine protein kinase; Provisional 99.66
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.57
KOG1023|consensus484 99.55
PRK14879211 serine/threonine protein kinase; Provisional 99.54
KOG1166|consensus974 99.53
KOG0590|consensus601 99.52
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.48
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.48
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.48
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.46
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.33
KOG0601|consensus524 99.24
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.18
KOG0211|consensus759 99.16
KOG1266|consensus458 99.14
KOG0606|consensus1205 99.12
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.1
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.06
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.06
KOG3741|consensus655 99.02
KOG0601|consensus524 98.86
KOG3087|consensus229 98.71
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.7
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.68
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.63
KOG0211|consensus 759 98.59
COG4248637 Uncharacterized protein with protein kinase and he 98.56
COG0478304 RIO-like serine/threonine protein kinase fused to 98.35
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.26
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.2
KOG1240|consensus 1431 98.15
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.1
PRK09902216 hypothetical protein; Provisional 97.93
KOG1243|consensus 690 97.91
COG0661517 AarF Predicted unusual protein kinase [General fun 97.9
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.72
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.59
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.58
KOG2137|consensus 700 97.53
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 97.51
KOG2270|consensus520 97.51
KOG1235|consensus538 97.48
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.44
KOG1035|consensus 1351 97.34
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.27
KOG2171|consensus 1075 97.09
PF01636239 APH: Phosphotransferase enzyme family This family 97.08
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.0
PRK09687280 putative lyase; Provisional 96.95
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 96.95
KOG0576|consensus829 96.91
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.89
KOG1242|consensus 569 96.77
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.69
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 96.69
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.64
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.59
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.58
PTZ00429 746 beta-adaptin; Provisional 96.58
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 96.55
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.54
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 96.53
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 96.42
KOG2171|consensus 1075 96.4
KOG1241|consensus 859 96.37
PLN02876 822 acyl-CoA dehydrogenase 96.33
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.31
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.13
PRK09687280 putative lyase; Provisional 95.92
KOG1967|consensus1030 95.91
KOG1241|consensus859 95.91
KOG0213|consensus 1172 95.82
PF05004309 IFRD: Interferon-related developmental regulator ( 95.79
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 95.7
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 95.68
>KOG2137|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-71  Score=569.98  Aligned_cols=512  Identities=41%  Similarity=0.659  Sum_probs=449.1

Q ss_pred             ChhhhhhhhhhhhhhhhcccCCCCCCCccCceecccccccCCCCceEEEEeEecCCCCeE-----EEEEEEecchhhhhH
Q psy12792          1 MDVFNKLKSTVTSTVNQISSVLPGNPVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDA-----SIFVLEKRQLEKLDM   75 (570)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~y~~~~~lg~G~~g~~~~Vy~~~~~~~~~~v-----avK~~~k~~~~~~~~   75 (570)
                      |++.+++.+....++......++|.-..++|+..+.+|.++.|.-|++|.++.+.++.+.     +++++++.       
T Consensus         9 ~~~s~~~~ss~~~t~e~~~~~l~~~~~~~~~~~~~~~~~~g~g~~~~ly~~~~~~sk~~~~~~s~~~~~ld~~-------   81 (700)
T KOG2137|consen    9 TTMSDKFTSSTATTAETIVQVLPGPKESQSYRSLNQVGSAGPGDAWKLYAGKKSGSKAPTLKKSAVVWMLDKR-------   81 (700)
T ss_pred             hhhccccccccceeecceeEecCCcccccccccccceeecCCCchhhhhhhhccCccCccccceeeeeecChh-------
Confidence            367788888888888888999999999999999999999999999999999988766554     33433322       


Q ss_pred             HHHHHHHHHHHHHHHhhhhcCCCCceEEeccccccchhhhhccccCCCCCCCcccccCCCCHHHHHHHHHHHHHHHHHHh
Q psy12792         76 KLREEYFTFVKRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLH  155 (570)
Q Consensus        76 ~~~~~~~~~~~~E~~~l~~l~HpnIv~~~~~~~~~~l~~v~~~~~~~~~~L~~~l~~~~l~~~~~~~~~~qi~~aL~~LH  155 (570)
                                   ...+.+++|              +..+....+                  ....-+.+.+.|+.|+|
T Consensus        82 -------------~~~~~~lr~--------------~~~vs~aTe------------------~~f~nl~~v~dgl~flh  116 (700)
T KOG2137|consen   82 -------------ASSLQQLRG--------------LDGVSKATE------------------DGFANLGNVADGLAFLH  116 (700)
T ss_pred             -------------hhHHHHHhc--------------ccchhhccc------------------Hhhhhhhcccchhhhhc
Confidence                         223445555              111111111                  11222345569999999


Q ss_pred             ccccccccCCccccEEEccCCCEEEeccCccc------------------------ccCCCCCC----CCCCCchhhhHH
Q psy12792        156 NDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSR------------------------ELCLDPTR----QLTPARDMFSLG  207 (570)
Q Consensus       156 ~~~~ivH~dIkp~NIlv~~~~~~kL~dfg~a~------------------------~~~~~PE~----~~~~~~Dv~slG  207 (570)
                      +++++||++|.|++|+++.+|.|||+||+++.                        .-|.+||+    ..+.++|+||+|
T Consensus       117 ~sAk~VH~ni~p~~i~~na~~~wkl~Gf~f~v~~~~~~~~p~~~yd~~lp~~~~~~~~f~apE~~~~~~~~~~sd~fSlG  196 (700)
T KOG2137|consen  117 RSAKVVHGNIQPEAIVVNANGDWKLAGFSFCVNANGPTEYPFSEYDPPLPLLLQPHLNFLAPEYLLGTTNTPASDVFSLG  196 (700)
T ss_pred             cCcceeecccchhheeeccCcceeeccchhhhccCCCCccccccCCCCCChhhccCcccccchhhccccccccccceeee
Confidence            99999999999999999999999999999987                        22445888    677899999999


Q ss_pred             HHHHHHHhCCCCCCCCC--hhHHHHhhccCCCCC-ccccCCCHHHHHHHHHhcCCCCCCCCChhhhhcCCCccCcccccc
Q psy12792        208 ATICAVYNNGKSIISSD--QNITFSELGSANINS-ARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIGVKTL  284 (570)
Q Consensus       208 ~ll~el~~~g~~pf~~~--~~~~~~~~~~~~~~~-~~~~~~~~~l~~li~~~l~~~p~~Rpt~~~~l~~~~f~~~~~~~~  284 (570)
                      +++|.++++|+..+..+  ...+........... ....++|.++++-+.+++..++..||++..++..|||.+....++
T Consensus       197 ~li~~i~~~gk~i~~a~~~~~~~~~~~~~~~~~~~~~s~~~p~el~~~l~k~l~~~~~~rp~~~~l~~~~ff~D~~~~aL  276 (700)
T KOG2137|consen  197 VLIYTIYNGGKSIIAANGGLLSYSFSRNLLNAGAFGYSNNLPSELRESLKKLLNGDSAVRPTLDLLLSIPFFSDPGLKAL  276 (700)
T ss_pred             eEEEEEecCCcchhhccCCcchhhhhhcccccccccccccCcHHHHHHHHHHhcCCcccCcchhhhhcccccCCchhhhh
Confidence            99999998888887762  112211111112111 123789999999999999999999999999999999999999999


Q ss_pred             ccchhcccCCHHHHHHHHhhhHHHhhcCChhhhccCCchhhHHhhhCCCcccccchhHHHHhhhCChHhhhhhccchhhh
Q psy12792        285 NYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRINTNRILPCLMKEFINSSMVPFVLPNVLYIAEQCSQQEFTRDVLPHLIP  364 (570)
Q Consensus       285 ~~l~~~~~~~~~~k~~f~~~l~~~l~~~p~~~~~~kilP~l~~~~~~~~~~~~~l~~~~~i~~~l~~~~f~~~i~p~l~~  364 (570)
                      +|||.+.+|++.+|.+|+++|.+.++.||.+++.+||||.|++++.+..++|.+||.++.|++.++..+|..+++|.|.+
T Consensus       277 rfLD~l~~kdn~qKs~Flk~Ls~~ip~fp~rv~~~kiLP~L~~el~n~~~vp~~LP~v~~i~~~~s~~~~~~~~~p~l~p  356 (700)
T KOG2137|consen  277 RFLDDLPQKDNSQKSSFLKGLSKLIPTFPARVLFQKILPTLVAELVNTKMVPIVLPLVLLIAEGLSQNEFGPKMLPALKP  356 (700)
T ss_pred             hhcccccccCcHHHHHHHHHHHHhhccCCHHHHHHhhhhHHHHHhccccccccccchhhhhhhccchhhhhhhhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCchhHHHHHHHHhHHHHHhcCChhHHhhhhHHHHHhhhcCCcHHHHHHHHHhhhhhhhhcChHHHhhhhhHHHHHH
Q psy12792        365 VMKLQEPIQVLLIFMQKMEVLLKLTPPEQVKSEVLPLLYRALESDSQQIQELCLSILPSLANLIEYPAMKNALLPRIKRL  444 (570)
Q Consensus       365 l~~~~~~~~v~~~ll~~l~~~~~~~~~~~~~~~ilP~l~~~l~d~~~~vr~~~l~~i~~~~~~l~~~~~~~~llp~l~~l  444 (570)
                      +++.+++.+++++++|+++.+.+|++++++.++|+|+++.+++|.+.++|+.+|+.+|.+++.+|+.++++.|+|+|..+
T Consensus       357 i~~~~~~~~~~l~i~e~mdlL~~Kt~~e~~~~~IlplL~~S~~~~~~~iQ~~~L~~lptv~e~iD~~~vk~~ilP~l~~l  436 (700)
T KOG2137|consen  357 IYSASDPKQALLFILENMDLLKEKTPPEEVKEKILPLLYRSLEDSDVQIQELALQILPTVAESIDVPFVKQAILPRLKNL  436 (700)
T ss_pred             HhccCCcccchhhHHhhHHHHHhhCChHHHHHHHHHHHHHHhcCcchhhHHHHHHhhhHHHHhccHHHHHHHHHHHhhcc
Confidence            99988888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCcceEehhHHHHHHHHhhhhchHHHHHhhhccCCCCCCCChHHHHHHHHHHHHHHhhcccCCCHHHHHHHHhhhhh
Q psy12792        445 CISTSHISVRVNCLVCLGKLIEYLDKWLVLDEVLPFLPQIPSRDPAVLMGILGIYKLVLNHKKMAISKEIMATKILPFLM  524 (570)
Q Consensus       445 ~~~~~~~~vR~~~~~~l~~l~~~l~~~~~~~~~lp~l~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~a~~vlP~l~  524 (570)
                      +.+++++.||+|++.|++++++.+|++.+++.++|.++.++.+||+++|+++.+|+.+....+.|  .|.++.+|+|.++
T Consensus       437 ~~~tt~~~vkvn~L~c~~~l~q~lD~~~v~d~~lpi~~~~~~~dp~iv~~~~~i~~~l~~~~~~g--~ev~~~~VlPlli  514 (700)
T KOG2137|consen  437 AFKTTNLYVKVNVLPCLAGLIQRLDKAAVLDELLPILKCIKTRDPAIVMGFLRIYEALALIIYSG--VEVMAENVLPLLI  514 (700)
T ss_pred             hhcccchHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHhhcccc--eeeehhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999988765433  7999999999999


Q ss_pred             hhhhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Q psy12792        525 PLVIENSLSLNQFNSLVAVIKDMVNRVEAEHRTKLEQLNSIA  566 (570)
Q Consensus       525 ~l~~d~~~~~~qf~~~~~~i~~~~~~ie~~~~~~l~~~~~~~  566 (570)
                      |+++.+.++..||..+|+.|++|+++||+.|++||+.+...+
T Consensus       515 ~ls~~~~L~~~Qy~~~m~~i~~ml~~ie~~~~~kLq~~~~~~  556 (700)
T KOG2137|consen  515 PLSVAPSLNGEQYNKYMSEIRLMLSAIEKPRANKLQKQSSSQ  556 (700)
T ss_pred             hhhhcccccHHHHHHHHHHHHHHHhhhhHHHHHHhhhccccc
Confidence            999999999999999999999999999999999999876543

>KOG1243|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information
>KOG1235|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-04
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 5e-04
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 5e-04
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 6e-04
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 6e-04
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 8e-04
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure 
Iteration: 1

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 104/253 (41%), Gaps = 28/253 (11%)
Query: 41  GQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQI 100
           G+G    +Y   ++++    ++ VL K QLEK  ++ +      ++R V   + LRHP I
Sbjct: 17  GKGKFGNVYLAREKNSKFILALKVLFKAQLEKAGVEHQ------LRREVEIQSHLRHPNI 70
Query: 101 LIVQHPLEESSLANVLGHTENLPNPLPPHLRSYKLYDIEIKYGLMQVGEGLNFLHNDAKK 160
           L +     +S+   ++     L        +  K  +      + ++   L++ H+  K 
Sbjct: 71  LRLYGYFHDSTRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSK-KV 129
Query: 161 IHHNLCPHNIIVSHHGAWKIFGFDF------SRELCLDPTRQLTPAR-----------DM 203
           IH ++ P N+++   G  KI  F +      SR   L  T    P             D+
Sbjct: 130 IHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRAALCGTLDYLPPEMIEGRMHDEKVDL 189
Query: 204 FSLGATICAVYNNGKSIISSDQ-NITFSELGSANINSARLSDIDEGLRELVKMMLNTSPE 262
           +SLG  +C  +  GK    ++    T+  +            + EG R+L+  +L  +P 
Sbjct: 190 WSLG-VLCYEFLVGKPPFEANTYQDTYKRISRVEFTFPDF--VTEGARDLISRLLKHNPS 246
Query: 263 LRPDNHDFLKSPY 275
            RP   + L+ P+
Sbjct: 247 QRPMLREVLEHPW 259
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-11
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 1e-09
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-04
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 8e-11
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 5e-08
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-08
2a19_B284 Interferon-induced, double-stranded RNA-activated 9e-08
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 6e-07
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 7e-07
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 9e-07
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-06
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 4e-06
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 5e-06
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 8e-06
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-05
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-05
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-05
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 3e-05
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 4e-05
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 8e-05
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 8e-05
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 1e-04
3niz_A311 Rhodanese family protein; structural genomics, str 1e-04
3o0g_A292 Cell division protein kinase 5; kinase activator c 1e-04
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-04
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-04
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 3e-04
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-04
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-04
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 3e-04
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 4e-04
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 4e-04
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 5e-04
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 6e-04
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 6e-04
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 7e-04
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 75.3 bits (184), Expect = 2e-14
 Identities = 54/374 (14%), Positives = 118/374 (31%), Gaps = 114/374 (30%)

Query: 268 HDFLKSPYFDDIGVK-TLNYLDSIFQWDNLEKSKFYKGLPQIMEKLPHRIN-TNRILPCL 325
             F    + D+   K   +   SI         +       I+      ++ T R+   L
Sbjct: 23  SVFED-AFVDNFDCKDVQDMPKSIL------SKEEID---HII-MSKDAVSGTLRLFWTL 71

Query: 326 M-------KEFINSSMVP---FV------------LPNVLYIAE----QCSQQEFTRDVL 359
           +       ++F+   +     F+            +   +YI +        Q F +  +
Sbjct: 72  LSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNV 131

Query: 360 PHLIPVMKLQEPIQVL----LIFMQKM----------EVLLKLTPPEQVKSEV--LPL-L 402
             L P +KL++ +  L     + +  +          +V L      ++  ++  L L  
Sbjct: 132 SRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKN 191

Query: 403 YRALESDSQQIQELCLSILPSLANLIE----YPAMKNALLPRIKRLCISTSHISVRVNCL 458
             + E+  + +Q+L   I P+  +  +         +++   ++RL  S  +     NCL
Sbjct: 192 CNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPY----ENCL 247

Query: 459 VCLGKLIEYLDKWLVLDEVL------PFLPQ----IPSRDPAVL--MGILGIYKLVLNHK 506
                        LVL  V        F       + +R   V   +       + L+H 
Sbjct: 248 -------------LVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHH 294

Query: 507 KMAI----SKEIMATKI------LPFLM----PLVIENSLSLNQFNSLV-AVIKDMVNRV 551
            M +     K ++   +      LP  +    P  +          S++   I+D +   
Sbjct: 295 SMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRL----------SIIAESIRDGLATW 344

Query: 552 EAEHRTKLEQLNSI 565
           +       ++L +I
Sbjct: 345 DNWKHVNCDKLTTI 358
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query570
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.91
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.82
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.82
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.7
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.55
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.38
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.37
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.83
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 98.76
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 98.61
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.49
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.29
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.23
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.14
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.06
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.04
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.03
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.0
3r70_A320 Aminoglycoside phosphotransferase; structural geno 97.97
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.96
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.95
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 97.93
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.92
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 97.87
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.81
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.74
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 97.71
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 97.69
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 97.65
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 97.65
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.64
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 97.63
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 97.62
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.6
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 97.58
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.57
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.48
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.47
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 97.47
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.44
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 97.4
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.38
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 97.34
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 97.29
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 97.26
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 97.19
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 97.18
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 97.16
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 97.12
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.09
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 97.09
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.02
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.02
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 96.98
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.87
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 96.77
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 96.72
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 96.66
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 96.63
3ats_A357 Putative uncharacterized protein; hypothetical pro 96.62
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 96.54
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 96.38
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 96.37
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.0
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 95.84
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.71
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 95.69
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 95.65
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 95.55
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 95.29
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 95.29
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 95.25
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 95.07
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 95.01
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 95.0
2q83_A346 YTAA protein; 2635576, structural genomics, joint 94.78
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 94.77
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 94.73
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 94.64
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 94.59
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 94.54
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 94.24
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 93.87
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 93.71
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 93.54
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 93.39
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 93.27
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 93.05
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 93.01
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 92.91
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 92.29
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 91.64
3nmz_A458 APC variant protein; protein-protein complex, arma 91.6
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 91.26
2x19_B 963 Importin-13; nuclear transport, protein transport; 90.91
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 90.51
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 89.28
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 88.86
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 88.82
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 88.64
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 88.6
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 88.39
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 87.58
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 87.5
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 87.18
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 86.88
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 86.79
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 86.78
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 86.41
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 86.35
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 86.24
2x1g_F 971 Cadmus; transport protein, developmental protein, 85.95
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 85.28
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 85.06
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 84.31
3nmz_A458 APC variant protein; protein-protein complex, arma 84.04
2x1g_F 971 Cadmus; transport protein, developmental protein, 82.85
2db0_A253 253AA long hypothetical protein; heat repeats, hel 82.72
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 82.42
2x19_B 963 Importin-13; nuclear transport, protein transport; 81.56
4ann_A215 ESSB; membrane protein, membrane secretion, ESS ty 81.53
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 81.27
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 81.25
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 80.45
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=3.5e-52  Score=414.92  Aligned_cols=242  Identities=19%  Similarity=0.320  Sum_probs=209.2

Q ss_pred             CccCceecccccccCCCCceEEEEeEecCCCCeEEEEEEEecchhhhhHHHHHHHHHHHHHHHHhhhhcCCCCceEEecc
Q psy12792         27 VTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQHP  106 (570)
Q Consensus        27 ~~~~y~~~~~lg~G~~g~~~~Vy~~~~~~~~~~vavK~~~k~~~~~~~~~~~~~~~~~~~~E~~~l~~l~HpnIv~~~~~  106 (570)
                      ..++|++++.||+|+||   +||+|+++.+|+.||||++++.....      +...+.+.+|+++|++++||||++++++
T Consensus        30 ~~~dy~i~~~lG~G~fg---~V~~a~~~~~~~~~AiK~i~k~~~~~------~~~~~~~~~E~~il~~l~HpnIv~l~~~  100 (311)
T 4aw0_A           30 RPEDFKFGKILGEGSFS---TVVLARELATSREYAIKILEKRHIIK------ENKVPYVTRERDVMSRLDHPFFVKLYFT  100 (311)
T ss_dssp             CGGGEEEEEEEEEETTE---EEEEEEETTTCCEEEEEEEEHHHHHH------TTCHHHHHHHHHHHTTCCCTTBCCEEEE
T ss_pred             CccccEEEEEEecccCe---EEEEEEECCCCCEEEEEEEEHHHCCC------HHHHHHHHHHHHHHHhCCCCCCCeEEEE
Confidence            34689999999999999   99999999999999999998765422      1224678899999999999999999999


Q ss_pred             cccc-chhhhhccccCCCCCCCccccc-CCCCHHHHHHHHHHHHHHHHHHhccccccccCCccccEEEccCCCEEEeccC
Q psy12792        107 LEES-SLANVLGHTENLPNPLPPHLRS-YKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFD  184 (570)
Q Consensus       107 ~~~~-~l~~v~~~~~~~~~~L~~~l~~-~~l~~~~~~~~~~qi~~aL~~LH~~~~ivH~dIkp~NIlv~~~~~~kL~dfg  184 (570)
                      ++++ .++.+|++++++  +|.+.+.. ..+++.+++.++.||+.||+|||++ ||+||||||+|||++.+|.+||+|||
T Consensus       101 ~~~~~~~yivmEy~~gG--~L~~~i~~~~~l~e~~~~~~~~qi~~al~ylH~~-~IiHRDlKPeNILl~~~g~vKl~DFG  177 (311)
T 4aw0_A          101 FQDDEKLYFGLSYAKNG--ELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGK-GIIHRDLKPENILLNEDMHIQITDFG  177 (311)
T ss_dssp             EECSSEEEEEECCCTTE--EHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHT-TEECSCCSGGGEEECTTSCEEECCCT
T ss_pred             EEeCCEEEEEEecCCCC--CHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHC-CCccCCCCHHHeEEcCCCCEEEEEcC
Confidence            9776 778889988887  67777754 5699999999999999999999995 99999999999999999999999999


Q ss_pred             ccc-----------------ccCCCCCC----CCCCCchhhhHHHHHHHHHhCCCCCCCC-ChhHHHHhhccCCCCCccc
Q psy12792        185 FSR-----------------ELCLDPTR----QLTPARDMFSLGATICAVYNNGKSIISS-DQNITFSELGSANINSARL  242 (570)
Q Consensus       185 ~a~-----------------~~~~~PE~----~~~~~~Dv~slG~ll~el~~~g~~pf~~-~~~~~~~~~~~~~~~~~~~  242 (570)
                      +|+                 +.|+|||+    .|+.++||||+||++|+|+ +|++||.+ +..++.+.+....++  .+
T Consensus       178 la~~~~~~~~~~~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml-~G~~PF~~~~~~~~~~~i~~~~~~--~p  254 (311)
T 4aw0_A          178 TAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLV-AGLPPFRAGNEGLIFAKIIKLEYD--FP  254 (311)
T ss_dssp             TCEECCTTTTCCCBCCCCSCGGGCCHHHHHHSCBCHHHHHHHHHHHHHHHH-HSSCSSCCSSHHHHHHHHHHTCCC--CC
T ss_pred             CceecCCCCCcccccCcccCcccCCHHHHcCCCCCcHHHHHHHHHHHHHHH-hCCCCCCCCCHHHHHHHHHcCCCC--CC
Confidence            986                 57888999    7899999999999999999 89999988 666665555422222  33


Q ss_pred             cCCCHHHHHHHHHhcCCCCCCCCChhh------hhcCCCccCccccc
Q psy12792        243 SDIDEGLRELVKMMLNTSPELRPDNHD------FLKSPYFDDIGVKT  283 (570)
Q Consensus       243 ~~~~~~l~~li~~~l~~~p~~Rpt~~~------~l~~~~f~~~~~~~  283 (570)
                      ..++++++++|.+||..||++|||++|      +++||||++..+..
T Consensus       255 ~~~s~~~~dli~~lL~~dp~~R~t~~e~~~~~~i~~Hp~F~~idw~~  301 (311)
T 4aw0_A          255 EKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWEN  301 (311)
T ss_dssp             TTCCHHHHHHHHHHSCSSGGGSTTSGGGTCHHHHHTSGGGTTCCCTT
T ss_pred             cccCHHHHHHHHHHccCCHhHCcChHHHcCCHHHHCCCCcCCCCHHH
Confidence            678999999999999999999999988      57899999876543
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4ann_A ESSB; membrane protein, membrane secretion, ESS type VII secretion virulence; 1.05A {Staphylococcus aureus subsp} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 570
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-18
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-18
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-17
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-17
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-17
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-16
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 6e-16
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 9e-16
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-15
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-15
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-15
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 6e-15
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-15
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 6e-15
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 8e-15
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-14
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-14
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-14
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-14
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-14
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-14
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-14
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 6e-14
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-13
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-13
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-13
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-13
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-13
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 4e-13
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-13
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 6e-13
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 7e-13
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 9e-13
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-12
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-12
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-12
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-12
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-11
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-11
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-11
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-11
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-11
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-11
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-11
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 7e-11
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-10
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-10
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-10
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-09
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-09
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-09
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-09
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-09
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 5e-09
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-08
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-08
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 7e-07
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 9e-07
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 5e-06
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-06
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 7e-05
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 9e-05
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 2e-04
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 83.1 bits (205), Expect = 2e-18
 Identities = 38/278 (13%), Positives = 89/278 (32%), Gaps = 41/278 (14%)

Query: 26  PVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFV 85
           P   ++D+   +G    G   ++     R T +  ++ +++ ++       +++E     
Sbjct: 2   PFVEDWDLVQTLGEGAYG---EVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKE----- 53

Query: 86  KRGVSQLTRLRHPQILIVQHPLEESSLANVLGHTENLPNPLPPHL--RSYKLYDIEIKYG 143
              +     L H  ++       E ++  +    E                + + + +  
Sbjct: 54  ---ICINKMLNHENVVKFYGHRREGNIQYLF--LEYCSGGELFDRIEPDIGMPEPDAQRF 108

Query: 144 LMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGFDFSRELCLDPTRQL------ 197
             Q+  G+ +LH      H ++ P N+++      KI  F  +     +   +L      
Sbjct: 109 FHQLMAGVVYLH-GIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCG 167

Query: 198 ----------------TPARDMFSLGATICAVYNNGKSII--SSDQNITFSELGSANINS 239
                               D++S G  + A+   G+      SD    +S+        
Sbjct: 168 TLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLA-GELPWDQPSDSCQEYSDWKEKKTYL 226

Query: 240 ARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFD 277
                ID     L+  +L  +P  R    D  K  +++
Sbjct: 227 NPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYN 264
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query570
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.84
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 99.36
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.33
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.66
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.47
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.33
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.23
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 96.93
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 96.8
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.76
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 96.67
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 96.6
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 96.57
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 96.46
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.42
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.29
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 96.27
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 96.24
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 95.91
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.77
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 95.75
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 95.58
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 95.45
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.21
d1oyza_ 276 Hypothetical protein YibA {Escherichia coli [TaxId 95.16
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 94.9
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 94.87
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 94.76
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 94.61
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 94.18
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 94.14
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 93.11
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 92.74
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 92.22
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 91.66
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 91.45
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 90.4
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 84.78
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7e-51  Score=398.95  Aligned_cols=240  Identities=16%  Similarity=0.236  Sum_probs=200.9

Q ss_pred             CCccCceecccccccCCCCceEEEEeEecCCCCeEEEEEEEecchhhhhHHHHHHHHHHHHHHHHhhhhcCCCCceEEec
Q psy12792         26 PVTREYDITGHIGSAGQGLLWKIYSGTKRSTNQDASIFVLEKRQLEKLDMKLREEYFTFVKRGVSQLTRLRHPQILIVQH  105 (570)
Q Consensus        26 ~~~~~y~~~~~lg~G~~g~~~~Vy~~~~~~~~~~vavK~~~k~~~~~~~~~~~~~~~~~~~~E~~~l~~l~HpnIv~~~~  105 (570)
                      |+.++|++.+.||+|+||   +||+|+++.+|+.||||+++++....        ..+.+.+|++++++++||||+++++
T Consensus         2 Pf~~dy~~~~~lG~G~fg---~V~~~~~~~~~~~vAiK~i~~~~~~~--------~~~~~~~Ei~~l~~l~HpnIv~~~~   70 (271)
T d1nvra_           2 PFVEDWDLVQTLGEGAYG---EVQLAVNRVTEEAVAVKIVDMKRAVD--------CPENIKKEICINKMLNHENVVKFYG   70 (271)
T ss_dssp             TTTTEEEEEEEEEEETTE---EEEEEEETTTCCEEEEEEEECC---------------CHHHHHHHHHTCCCTTBCCEEE
T ss_pred             CCCcceEEEEEEecCcCe---EEEEEEECCCCCEEEEEEEehhhcch--------HHHHHHHHHHHHHhCCCCCEeeEee
Confidence            578899999999999999   99999999999999999998754321        1345789999999999999999999


Q ss_pred             ccccc-chhhhhccccCCCCCCCccccc-CCCCHHHHHHHHHHHHHHHHHHhccccccccCCccccEEEccCCCEEEecc
Q psy12792        106 PLEES-SLANVLGHTENLPNPLPPHLRS-YKLYDIEIKYGLMQVGEGLNFLHNDAKKIHHNLCPHNIIVSHHGAWKIFGF  183 (570)
Q Consensus       106 ~~~~~-~l~~v~~~~~~~~~~L~~~l~~-~~l~~~~~~~~~~qi~~aL~~LH~~~~ivH~dIkp~NIlv~~~~~~kL~df  183 (570)
                      ++.++ .++.+|++++++  +|...+.. ..+++.+++.++.||+.||+|||++ ||+||||||+||+++.+|.+||+||
T Consensus        71 ~~~~~~~~~ivmEy~~gg--~L~~~l~~~~~l~e~~~~~i~~qi~~al~ylH~~-~IiHrDiKp~NILl~~~~~~KL~DF  147 (271)
T d1nvra_          71 HRREGNIQYLFLEYCSGG--ELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGI-GITHRDIKPENLLLDERDNLKISDF  147 (271)
T ss_dssp             EEEETTEEEEEEECCTTE--EGGGGSBTTTBCCHHHHHHHHHHHHHHHHHHHHT-TEECSCCCGGGEEECTTCCEEECCC
T ss_pred             eeccCceeEEEEeccCCC--cHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHHHc-CCccCcccHHHEEECCCCCEEEccc
Confidence            99776 667788888776  67777764 4599999999999999999999995 9999999999999999999999999


Q ss_pred             Cccc-----------------ccCCCCCC----C-CCCCchhhhHHHHHHHHHhCCCCCCCC--ChhHHHHhhccCCCCC
Q psy12792        184 DFSR-----------------ELCLDPTR----Q-LTPARDMFSLGATICAVYNNGKSIISS--DQNITFSELGSANINS  239 (570)
Q Consensus       184 g~a~-----------------~~~~~PE~----~-~~~~~Dv~slG~ll~el~~~g~~pf~~--~~~~~~~~~~~~~~~~  239 (570)
                      |+|.                 +.|+|||+    . ++.++||||+||++|+|+ +|++||..  +...............
T Consensus       148 G~a~~~~~~~~~~~~~~~~GT~~Y~APE~~~~~~~~~~~~DiwSlGvilyeml-~G~~pf~~~~~~~~~~~~~~~~~~~~  226 (271)
T d1nvra_         148 GLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAML-AGELPWDQPSDSCQEYSDWKEKKTYL  226 (271)
T ss_dssp             TTCEECEETTEECCBCCCCSCGGGSCTHHHHCSSBCHHHHHHHHHHHHHHHHH-HSSCSCSSSSTTSHHHHHHHTTCTTS
T ss_pred             hhheeeccCCccccccceeeCcCccCHhHhcCCCCCCCceeeeHhHHHHHHHH-hCCCCCCCCChHHHHHHHHhcCCCCC
Confidence            9987                 46889998    3 457899999999999999 89999977  2222222222222222


Q ss_pred             ccccCCCHHHHHHHHHhcCCCCCCCCChhhhhcCCCccCcc
Q psy12792        240 ARLSDIDEGLRELVKMMLNTSPELRPDNHDFLKSPYFDDIG  280 (570)
Q Consensus       240 ~~~~~~~~~l~~li~~~l~~~p~~Rpt~~~~l~~~~f~~~~  280 (570)
                      ..+..+|+++.+++.+||+.||++|||++|+++||||++..
T Consensus       227 ~~~~~~s~~~~~li~~~L~~dP~~R~t~~eil~hpwf~~~l  267 (271)
T d1nvra_         227 NPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPL  267 (271)
T ss_dssp             TTGGGSCHHHHHHHHHHSCSSTTTSCCHHHHTTCTTTTCCC
T ss_pred             CccccCCHHHHHHHHHHcCCChhHCcCHHHHhcCHhhCcCC
Confidence            34567899999999999999999999999999999998653
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure