Psyllid ID: psy13211


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MFFHGKTKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALRKLRGPKPKPDSTRSLRKKK
cccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHcccccccccccccccccccc
cccccccccccHHHHHHHHHHHHHHHHHcccccccEcEccccccccHHHHHHHHHHHccccccccHHHHHHHccccccccccHHHHccc
mffhgktkstDIQVRMFRIHIIRNHyrkhtgrkpfkcvvcKQFFATYSGAYQHLrrthgqesCSSLKALRklrgpkpkpdstrslrkkk
mffhgktkstdiqvRMFRIHIIRNhyrkhtgrkpfKCVVCKQFFATYSGAYQHLRRTHGQESCSSLkalrklrgpkpkpdstrslrkkk
MFFHGKTKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALRKLRGPKPKPDSTRSLRKKK
**********DIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR**********************************
***HGKTKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALR*******************
*********TDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHL*********SSLKALRKL*****************
*FFHGKTKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYS***Q*************************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFHGKTKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALRKLRGPKPKPDSTRSLRKKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query89 2.2.26 [Sep-21-2011]
Q802Y8671 Zinc finger and BTB domai yes N/A 0.685 0.090 0.405 4e-06
Q05516673 Zinc finger and BTB domai yes N/A 0.685 0.090 0.391 2e-05
Q9GZV8571 PR domain zinc finger pro no N/A 0.584 0.091 0.384 6e-05
P17032561 Zinc finger protein 37A O no N/A 0.426 0.067 0.487 6e-05
E9Q3T6561 PR domain zinc finger pro no N/A 0.494 0.078 0.446 0.0001
Q9JKD9465 Zinc finger and BTB domai no N/A 0.640 0.122 0.382 0.0002
Q00453 211 Probable transcription re yes N/A 0.685 0.289 0.344 0.0002
A2T7E6487 Zinc finger and BTB domai no N/A 0.640 0.117 0.382 0.0002
Q9Y2Y4487 Zinc finger and BTB domai no N/A 0.640 0.117 0.382 0.0003
A1YGK1487 Zinc finger and BTB domai N/A N/A 0.640 0.117 0.382 0.0003
>sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 40/74 (54%), Gaps = 13/74 (17%)

Query: 20  HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQ---------ESCSSLKALR 70
           H +  HYR HTG KPF+C +C Q    YS   +HLR  +G          E C SL A++
Sbjct: 585 HQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICLEYCPSLSAMQ 644

Query: 71  K-LRGPKPK---PD 80
           K ++G KP+   PD
Sbjct: 645 KHMKGHKPEDIPPD 658




Probable transcription factor. Probable substrate-recognition component of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Inhibits neurogenesis.
Danio rerio (taxid: 7955)
>sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 Back     alignment and function description
>sp|Q9GZV8|PRD14_HUMAN PR domain zinc finger protein 14 OS=Homo sapiens GN=PRDM14 PE=1 SV=1 Back     alignment and function description
>sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 Back     alignment and function description
>sp|E9Q3T6|PRD14_MOUSE PR domain zinc finger protein 14 OS=Mus musculus GN=Prdm14 PE=1 SV=1 Back     alignment and function description
>sp|Q9JKD9|ZBT32_MOUSE Zinc finger and BTB domain-containing protein 32 OS=Mus musculus GN=Zbtb32 PE=1 SV=1 Back     alignment and function description
>sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 Back     alignment and function description
>sp|A2T7E6|ZBT32_PANTR Zinc finger and BTB domain-containing protein 32 OS=Pan troglodytes GN=ZBTB32 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y2Y4|ZBT32_HUMAN Zinc finger and BTB domain-containing protein 32 OS=Homo sapiens GN=ZBTB32 PE=1 SV=1 Back     alignment and function description
>sp|A1YGK1|ZBT32_PANPA Zinc finger and BTB domain-containing protein 32 OS=Pan paniscus GN=ZBTB32 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
432901337 664 PREDICTED: zinc finger and BTB domain-co 0.685 0.091 0.405 0.0001
348532516 664 PREDICTED: zinc finger and BTB domain-co 0.685 0.091 0.405 0.0002
403304166 529 PREDICTED: PR domain zinc finger protein 0.494 0.083 0.466 0.0002
296226660 195 PREDICTED: PR domain zinc finger protein 0.584 0.266 0.403 0.0002
41054501 671 zinc finger and BTB domain-containing pr 0.685 0.090 0.405 0.0002
182892192 671 Zbtb16 protein [Danio rerio] 0.685 0.090 0.405 0.0002
284468449 667 promyelocytic leukemia zinc finger prote 0.685 0.091 0.405 0.0002
432889905 636 PREDICTED: zinc finger and BTB domain-co 0.662 0.092 0.405 0.0002
348535244 701 PREDICTED: zinc finger and BTB domain-co 0.662 0.084 0.405 0.0002
256076308 420 zinc finger protein [Schistosoma mansoni 0.471 0.1 0.5 0.0002
>gi|432901337|ref|XP_004076837.1| PREDICTED: zinc finger and BTB domain-containing protein 16-A-like [Oryzias latipes] Back     alignment and taxonomy information
 Score = 50.4 bits (119), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 40/74 (54%), Gaps = 13/74 (17%)

Query: 20  HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQ---------ESCSSLKALR 70
           H +  HYR HTG KPF+C +C Q    YS   +HLR  +G          E C SL A++
Sbjct: 578 HQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICLEYCPSLSAMQ 637

Query: 71  K-LRGPKPK---PD 80
           K ++G KP+   PD
Sbjct: 638 KHMKGHKPEDIPPD 651




Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|348532516|ref|XP_003453752.1| PREDICTED: zinc finger and BTB domain-containing protein 16-A-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|403304166|ref|XP_003942679.1| PREDICTED: PR domain zinc finger protein 14 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|296226660|ref|XP_002759030.1| PREDICTED: PR domain zinc finger protein 14-like [Callithrix jacchus] Back     alignment and taxonomy information
>gi|41054501|ref|NP_955929.1| zinc finger and BTB domain-containing protein 16-A [Danio rerio] gi|82241827|sp|Q802Y8.1|ZB16A_DANRE RecName: Full=Zinc finger and BTB domain-containing protein 16-A; AltName: Full=Promyelocytic leukemia zinc finger protein-A; AltName: Full=Zinc finger protein PLZF-A gi|28422784|gb|AAH46887.1| Zinc finger and BTB domain containing 16 [Danio rerio] Back     alignment and taxonomy information
>gi|182892192|gb|AAI65228.1| Zbtb16 protein [Danio rerio] Back     alignment and taxonomy information
>gi|284468449|gb|ADB90284.1| promyelocytic leukemia zinc finger protein [Labeo rohita] Back     alignment and taxonomy information
>gi|432889905|ref|XP_004075389.1| PREDICTED: zinc finger and BTB domain-containing protein 16-A-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|348535244|ref|XP_003455111.1| PREDICTED: zinc finger and BTB domain-containing protein 16-A-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|256076308|ref|XP_002574455.1| zinc finger protein [Schistosoma mansoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
SGD|S000004794 211 RGM1 "Putative zinc finger DNA 0.707 0.298 0.369 4.6e-07
UNIPROTKB|F1N9T2303 LOC100858709 "Uncharacterized 0.696 0.204 0.384 4.6e-07
ZFIN|ZDB-GENE-030131-1989671 zbtb16a "zinc finger and BTB d 0.662 0.087 0.405 6.3e-07
UNIPROTKB|Q32PJ4673 ZBTB16 "Uncharacterized protei 0.662 0.087 0.391 1e-06
UNIPROTKB|F1N9T4378 LOC100858709 "Uncharacterized 0.505 0.119 0.444 1.2e-06
UNIPROTKB|F6Y0P3673 ZBTB16 "Uncharacterized protei 0.662 0.087 0.391 1.3e-06
UNIPROTKB|Q05516673 ZBTB16 "Zinc finger and BTB do 0.662 0.087 0.391 1.3e-06
UNIPROTKB|Q5S3S9673 Zbtb16 "Zinc finger and BTB do 0.662 0.087 0.391 1.3e-06
UNIPROTKB|F1RU08571 PRDM14 "Uncharacterized protei 0.494 0.077 0.466 1.4e-06
UNIPROTKB|E1C9I5665 ZBTB16 "Uncharacterized protei 0.662 0.088 0.391 1.7e-06
SGD|S000004794 RGM1 "Putative zinc finger DNA binding transcription factor" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
 Score = 117 (46.2 bits), Expect = 4.6e-07, P = 4.6e-07
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query:    20 HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALRKLRGPKPK- 78
             H+ R H RKHTG KPF+C +C +FF+      QH    H      SL+ L++        
Sbjct:    36 HLAR-HIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRLQQSANSTAND 94

Query:    79 PDSTR 83
             P++TR
Sbjct:    95 PNATR 99




GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000790 "nuclear chromatin" evidence=IDA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS
UNIPROTKB|F1N9T2 LOC100858709 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1989 zbtb16a "zinc finger and BTB domain containing 16a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q32PJ4 ZBTB16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9T4 LOC100858709 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y0P3 ZBTB16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q05516 ZBTB16 "Zinc finger and BTB domain-containing protein 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5S3S9 Zbtb16 "Zinc finger and BTB domain containing 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU08 PRDM14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C9I5 ZBTB16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 89
KOG2462|consensus279 99.86
KOG2462|consensus279 99.85
KOG3623|consensus1007 99.79
KOG3623|consensus 1007 99.52
KOG3576|consensus267 99.5
KOG1074|consensus 958 99.45
KOG3576|consensus267 99.26
KOG1074|consensus 958 99.16
PHA0276855 hypothetical protein; Provisional 99.09
PHA0276855 hypothetical protein; Provisional 99.02
PHA00733128 hypothetical protein 98.96
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.92
KOG3608|consensus 467 98.83
KOG3608|consensus 467 98.77
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.74
PHA0061644 hypothetical protein 98.68
PHA0061644 hypothetical protein 98.53
PHA00733128 hypothetical protein 98.52
PLN03086567 PRLI-interacting factor K; Provisional 98.32
PLN03086567 PRLI-interacting factor K; Provisional 98.26
KOG3993|consensus 500 98.11
PHA0073279 hypothetical protein 98.05
PHA0073279 hypothetical protein 98.02
KOG3993|consensus 500 97.86
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.84
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.8
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.65
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.55
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.38
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.17
smart0035526 ZnF_C2H2 zinc finger. 97.17
PRK04860160 hypothetical protein; Provisional 97.05
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.05
smart0035526 ZnF_C2H2 zinc finger. 96.95
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.82
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.62
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.52
PRK04860160 hypothetical protein; Provisional 96.45
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.45
COG5189423 SFP1 Putative transcriptional repressor regulating 96.1
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.02
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.01
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.42
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.03
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.68
COG5048467 FOG: Zn-finger [General function prediction only] 92.61
KOG1146|consensus 1406 91.13
COG5048 467 FOG: Zn-finger [General function prediction only] 90.68
KOG2186|consensus 276 90.46
KOG4167|consensus907 89.24
KOG2893|consensus 341 88.5
COG404965 Uncharacterized protein containing archaeal-type C 88.0
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.25
COG5189423 SFP1 Putative transcriptional repressor regulating 80.33
>KOG2462|consensus Back     alignment and domain information
Probab=99.86  E-value=2.1e-23  Score=120.32  Aligned_cols=75  Identities=16%  Similarity=0.230  Sum_probs=38.5

Q ss_pred             CccchhhcccHHHHHHHHHHhcCCCCcccccchhhhcChhhHHHHHhHhcCCCCCCchHHHhhhcCCCCCCCCcchh
Q psy13211          9 STDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALRKLRGPKPKPDSTRSL   85 (89)
Q Consensus         9 ~~~c~~~f~~~~~l~~h~~~h~~~~p~~c~~c~~~f~~~~~l~~h~~~h~~ek~~~c~~~~~~~~~~~~~~~~~~~~   85 (89)
                      |.+|+++|.....|..|.++|+  -|.+|.+||+.|..+..|+.|+|+|+|||||.|..|+|.|.|.++|..|+++|
T Consensus       164 C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTH  238 (279)
T KOG2462|consen  164 CKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTH  238 (279)
T ss_pred             CCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhh
Confidence            4444444444444544544444  34455555555555555555555555555555555555555555555555444



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-04
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 27/40 (67%) Query: 22 IRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQE 61 + H R HTG+KPF+C +C + F+ ++G QH+R G++ Sbjct: 22 LDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGEK 61

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-04
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
 Score = 42.6 bits (101), Expect = 4e-07
 Identities = 8/36 (22%), Positives = 14/36 (38%)

Query: 23 RNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTH 58
          + H + H G    K   C     T++   +H+   H
Sbjct: 50 KRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECH 85


>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.77
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.76
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.74
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.73
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.72
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.71
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.71
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.7
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.7
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.7
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.67
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.67
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.66
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.65
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.65
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.64
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.64
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.63
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.63
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.59
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.59
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.58
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.56
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.56
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.54
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.54
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.54
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.54
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.54
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.53
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.48
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.48
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.47
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.47
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.47
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.47
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.46
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.46
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.46
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.46
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.46
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.45
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.45
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.44
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.44
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.44
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.44
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.43
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.43
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.42
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.42
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.42
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.41
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.41
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.4
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.4
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.39
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.39
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.39
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.39
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.38
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.38
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.38
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.38
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.38
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.37
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.37
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.37
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.35
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.35
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.34
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.33
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.33
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.32
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.31
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.3
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.28
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.27
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.27
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.26
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.26
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.25
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.25
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.25
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.21
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.16
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.04
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.03
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.02
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.02
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.01
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.01
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.99
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.97
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.95
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.94
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.92
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.91
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.9
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.88
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.87
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.87
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.84
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.82
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.81
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.77
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.73
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.72
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.71
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.68
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.64
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.62
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.6
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.6
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.57
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.57
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.55
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.54
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.54
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.54
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.54
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.5
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.48
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.87
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.47
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.86
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.42
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.41
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.4
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.39
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.75
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.38
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.37
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.35
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.34
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.32
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.64
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.27
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.27
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.21
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.2
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.19
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.18
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.17
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.46
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.15
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.43
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.07
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.04
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.0
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.0
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.97
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.96
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.94
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.94
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.92
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.89
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.79
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.74
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.14
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.21
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.67
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.12
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.41
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.71
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.01
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 89.72
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 87.54
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 85.83
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.86  E-value=3.2e-24  Score=114.31  Aligned_cols=82  Identities=13%  Similarity=0.216  Sum_probs=77.1

Q ss_pred             CCCccchhhcccHHHHHHHHHHhcCCCCcccccchhhhcChhhHHHHHhHhcCCCCCCchHHHhhhcCCCCCCCCcchhh
Q psy13211          7 TKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESCSSLKALRKLRGPKPKPDSTRSLR   86 (89)
Q Consensus         7 ~~~~~c~~~f~~~~~l~~h~~~h~~~~p~~c~~c~~~f~~~~~l~~h~~~h~~ek~~~c~~~~~~~~~~~~~~~~~~~~~   86 (89)
                      +.|.+|+++|....+|..|+++|++++||.|..|+..|.....|..|+++|++++||.|+.|++.|.....|..|+++++
T Consensus        23 y~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~hh  102 (133)
T 2lt7_A           23 YICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVH  102 (133)
T ss_dssp             EEETTTCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESSHHHHHHHHHHHT
T ss_pred             eECCCCCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhccccCCCccccCCCCCCCcCCHHHHHHHhHHhc
Confidence            56999999999999999999999999999999999999999999999999999999999999999999999988888776


Q ss_pred             hc
Q psy13211         87 KK   88 (89)
Q Consensus        87 ~~   88 (89)
                      .+
T Consensus       103 ~~  104 (133)
T 2lt7_A          103 SQ  104 (133)
T ss_dssp             CC
T ss_pred             CC
Confidence            43



>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 89
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.003
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.3 bits (87), Expect = 6e-06
 Identities = 10/35 (28%), Positives = 17/35 (48%)

Query: 27 RKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQE 61
          R H+G KP++C +C   F        H+ + H + 
Sbjct: 1  RTHSGEKPYECYICHARFTQSGTMKMHILQKHTEN 35


>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.67
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.48
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.47
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.35
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.34
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.29
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.24
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.24
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.2
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.19
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.19
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.11
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.09
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.09
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.05
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.05
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.04
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.04
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.0
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.92
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.9
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.89
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.88
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.83
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.79
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.71
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.62
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.41
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.36
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.36
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.34
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.31
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.27
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.25
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.19
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.06
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.93
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.92
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.84
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.74
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.69
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.55
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.52
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.52
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.48
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.38
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.25
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.06
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.04
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.02
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.93
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.85
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.84
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.82
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.81
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.77
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.67
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.51
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.41
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.34
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.21
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.93
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.85
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.83
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.59
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.49
d1y0jb136 U-shaped transcription factor, different fingers { 93.29
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.92
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.05
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 90.61
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.6
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.68
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.67
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.22
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.13
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 83.86
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 83.23
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=6.5e-18  Score=75.74  Aligned_cols=50  Identities=18%  Similarity=0.291  Sum_probs=42.6

Q ss_pred             CCCccchhhcccHHHHHHHHHHhcCCCCcccccchhhhcChhhHHHHHhHh
Q psy13211          7 TKSTDIQVRMFRIHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRT   57 (89)
Q Consensus         7 ~~~~~c~~~f~~~~~l~~h~~~h~~~~p~~c~~c~~~f~~~~~l~~h~~~h   57 (89)
                      ++| +|+++|....+|..|+++|+|++||.|.+|++.|.....|..|+++|
T Consensus         4 y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           4 YPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             EEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            468 58888888888888888888888888888888888888888888765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure