Psyllid ID: psy13416
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 67 | ||||||
| 5853356 | 376 | actin [Lymantria dispar] | 0.955 | 0.170 | 1.0 | 1e-31 | |
| 341899346 | 361 | hypothetical protein CAEBREN_32825 [Caen | 0.955 | 0.177 | 0.984 | 2e-31 | |
| 187281837 | 376 | actin, cytoplasmic A3 [Bombyx mori] gi|3 | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 156750 | 376 | actin [Drosophila melanogaster] | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 3182902 | 376 | RecName: Full=Actin, cytoplasmic A3a; Fl | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 383853395 | 376 | PREDICTED: actin-5C-like [Megachile rotu | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 339249175 | 376 | actin-5C [Trichinella spiralis] gi|31697 | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 254679590 | 376 | actin 1 [Ditylenchus destructor] | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 268619130 | 376 | actin-4 [Bursaphelenchus xylophilus] gi| | 0.955 | 0.170 | 1.0 | 2e-31 | |
| 195119912 | 376 | GI19595 [Drosophila mojavensis] gi|19540 | 0.955 | 0.170 | 1.0 | 2e-31 |
| >gi|5853356|gb|AAD54427.1|AF182715_1 actin [Lymantria dispar] | Back alignment and taxonomy information |
|---|
Score = 140 bits (352), Expect = 1e-31, Method: Composition-based stats.
Identities = 64/64 (100%), Positives = 64/64 (100%)
Query: 1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
Query: 61 SKRG 64
SKRG
Sbjct: 61 SKRG 64
|
Source: Lymantria dispar Species: Lymantria dispar Genus: Lymantria Family: Lymantriidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|341899346|gb|EGT55281.1| hypothetical protein CAEBREN_32825 [Caenorhabditis brenneri] | Back alignment and taxonomy information |
|---|
| >gi|187281837|ref|NP_001119726.1| actin, cytoplasmic A3 [Bombyx mori] gi|3123181|sp|P04829.3|ACT3_BOMMO RecName: Full=Actin, cytoplasmic A3; Flags: Precursor gi|1737056|gb|AAC47446.1| Actin A3 [Bombyx mori] gi|379697528|dbj|BAL70288.1| cytoplsmic actin A3 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|156750|gb|AAA28314.1| actin [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|3182902|sp|Q25010.1|ACT3A_HELAM RecName: Full=Actin, cytoplasmic A3a; Flags: Precursor gi|19526211|gb|AAL89657.1|AF286059_1 cytoplasmic actin A3b [Helicoverpa zea] gi|19526213|gb|AAL89658.1|AF286060_1 cytoplasmic actin A3a1 [Helicoverpa zea] gi|1296532|emb|CAA66218.1| Cytoplasmin actin A3a [Helicoverpa armigera] gi|28070937|emb|CAD58315.1| non-muscle actin [Manduca sexta] gi|154091302|gb|ABS57458.1| actin 1 [Heliconius erato] gi|307695433|gb|ADN84932.1| actin [Helicoverpa armigera] gi|308512669|gb|ADO32988.1| cytoplasmic actin A3 [Biston betularia] gi|327082402|gb|AEA29698.1| actin [Trichoplusia ni] gi|359843282|gb|AEV89776.1| actin [Schistocerca gregaria] gi|389608207|dbj|BAM17715.1| actin, cytoplasmic A3 [Papilio xuthus] gi|389610811|dbj|BAM19016.1| actin, cytoplasmic A3 [Papilio polytes] gi|443419072|gb|AGC84408.1| actin [Locusta migratoria] | Back alignment and taxonomy information |
|---|
| >gi|383853395|ref|XP_003702208.1| PREDICTED: actin-5C-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|339249175|ref|XP_003373575.1| actin-5C [Trichinella spiralis] gi|316970244|gb|EFV54220.1| actin-5C [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
| >gi|254679590|gb|ACT78498.1| actin 1 [Ditylenchus destructor] | Back alignment and taxonomy information |
|---|
| >gi|268619130|gb|ACZ13341.1| actin-4 [Bursaphelenchus xylophilus] gi|270309008|dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] | Back alignment and taxonomy information |
|---|
| >gi|195119912|ref|XP_002004473.1| GI19595 [Drosophila mojavensis] gi|195401469|ref|XP_002059335.1| GJ18395 [Drosophila virilis] gi|193909541|gb|EDW08408.1| GI19595 [Drosophila mojavensis] gi|194142341|gb|EDW58747.1| GJ18395 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 67 | ||||||
| FB|FBgn0000043 | 376 | Act42A "Actin 42A" [Drosophila | 0.955 | 0.170 | 1.0 | 1.4e-30 | |
| FB|FBgn0000042 | 376 | Act5C "Actin 5C" [Drosophila m | 0.955 | 0.170 | 1.0 | 1.4e-30 | |
| FB|FBgn0000044 | 376 | Act57B "Actin 57B" [Drosophila | 0.955 | 0.170 | 0.984 | 3e-30 | |
| FB|FBgn0000046 | 376 | Act87E "Actin 87E" [Drosophila | 0.955 | 0.170 | 0.984 | 3e-30 | |
| WB|WBGene00000063 | 376 | act-1 [Caenorhabditis elegans | 0.955 | 0.170 | 0.984 | 3e-30 | |
| WB|WBGene00000065 | 376 | act-3 [Caenorhabditis elegans | 0.955 | 0.170 | 0.984 | 3e-30 | |
| WB|WBGene00000066 | 376 | act-4 [Caenorhabditis elegans | 0.955 | 0.170 | 0.984 | 3e-30 | |
| ZFIN|ZDB-GENE-051030-60 | 376 | zgc:123289 "zgc:123289" [Danio | 0.955 | 0.170 | 0.984 | 3e-30 | |
| WB|WBGene00000064 | 376 | act-2 [Caenorhabditis elegans | 0.955 | 0.170 | 0.968 | 6.2e-30 | |
| UNIPROTKB|P10984 | 376 | act-2 "Actin-2" [Caenorhabditi | 0.955 | 0.170 | 0.968 | 6.2e-30 |
| FB|FBgn0000043 Act42A "Actin 42A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
Identities = 64/64 (100%), Positives = 64/64 (100%)
Query: 1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
Query: 61 SKRG 64
SKRG
Sbjct: 61 SKRG 64
|
|
| FB|FBgn0000042 Act5C "Actin 5C" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000044 Act57B "Actin 57B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000046 Act87E "Actin 87E" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000063 act-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000065 act-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000066 act-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051030-60 zgc:123289 "zgc:123289" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000064 act-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10984 act-2 "Actin-2" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 67 | |||
| PTZ00281 | 376 | PTZ00281, PTZ00281, actin; Provisional | 6e-39 | |
| PTZ00004 | 378 | PTZ00004, PTZ00004, actin-2; Provisional | 1e-30 | |
| smart00268 | 373 | smart00268, ACTIN, Actin | 3e-26 | |
| pfam00022 | 367 | pfam00022, Actin, Actin | 1e-25 | |
| COG5277 | 444 | COG5277, COG5277, Actin and related proteins [Cyto | 4e-23 | |
| PTZ00466 | 380 | PTZ00466, PTZ00466, actin-like protein; Provisiona | 4e-18 | |
| PTZ00452 | 375 | PTZ00452, PTZ00452, actin; Provisional | 1e-17 | |
| PTZ00280 | 414 | PTZ00280, PTZ00280, Actin-related protein 3; Provi | 2e-08 |
| >gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional | Back alignment and domain information |
|---|
Score = 130 bits (329), Expect = 6e-39
Identities = 58/64 (90%), Positives = 60/64 (93%)
Query: 1 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
M E+V ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDSYVGDEAQ
Sbjct: 1 MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQ 60
Query: 61 SKRG 64
SKRG
Sbjct: 61 SKRG 64
|
Length = 376 |
| >gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214592 smart00268, ACTIN, Actin | Back alignment and domain information |
|---|
| >gnl|CDD|200935 pfam00022, Actin, Actin | Back alignment and domain information |
|---|
| >gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 67 | ||||
| 3eks_A | 375 | Crystal Structure Of Monomeric Actin Bound To Cytoc | 2e-33 | ||
| 1d4x_A | 375 | Crystal Structure Of Caenorhabditis Elegans Mg-Atp | 7e-33 | ||
| 2hf3_A | 374 | Crystal Structure Of Monomeric Actin In The Adp Bou | 2e-32 | ||
| 3u4l_A | 375 | Cryocooled Bovine Profilin:actin Crystal Structure | 2e-31 | ||
| 3byh_A | 374 | Model Of Actin-Fimbrin Abd2 Complex Length = 374 | 2e-31 | ||
| 2oan_A | 375 | Structure Of Oxidized Beta-Actin Length = 375 | 2e-31 | ||
| 2btf_A | 375 | The Structure Of Crystalline Profilin-Beta-Actin Le | 2e-31 | ||
| 1yvn_A | 375 | The Yeast Actin Val 159 Asn Mutant Complex With Hum | 2e-31 | ||
| 1yag_A | 375 | Structure Of The Yeast Actin-human Gelsolin Segment | 1e-30 | ||
| 3w3d_A | 374 | Crystal Structure Of Smooth Muscle G Actin Dnase I | 4e-30 | ||
| 3b63_L | 365 | Actin Filament Model In The Extended Form Of Acroms | 5e-30 | ||
| 4efh_A | 375 | Acanthamoeba Actin Complex With Spir Domain D Lengt | 8e-30 | ||
| 1ijj_A | 377 | The X-Ray Crystal Structure Of The Complex Between | 8e-30 | ||
| 1eqy_A | 377 | Complex Between Rabbit Muscle Alpha-Actin: Human Ge | 9e-30 | ||
| 1dej_A | 375 | Crystal Structure Of A DictyosteliumTETRAHYMENA CHI | 1e-29 | ||
| 1nlv_A | 375 | Crystal Structure Of Dictyostelium Discoideum Actin | 1e-29 | ||
| 1c0g_A | 375 | Crystal Structure Of 1:1 Complex Between Gelsolin S | 1e-29 | ||
| 3chw_A | 375 | Complex Of Dictyostelium Discoideum Actin With Prof | 1e-29 | ||
| 3b63_C | 365 | Actin Filament Model In The Extended Form Of Acroms | 1e-29 | ||
| 3b63_A | 365 | Actin Filament Model In The Extended Form Of Acroms | 1e-29 | ||
| 3a5m_C | 375 | Crystal Structure Of A Dictyostelium P109i Mg2+-Act | 2e-29 | ||
| 3a5l_C | 375 | Crystal Structure Of A Dictyostelium P109a Mg2+-Act | 2e-29 | ||
| 4b1v_A | 376 | Structure Of The Phactr1 Rpel-N Domain Bound To G-A | 4e-29 | ||
| 3ci5_A | 375 | Complex Of Phosphorylated Dictyostelium Discoideum | 1e-28 | ||
| 1kxp_A | 375 | Crystal Structure Of Human Vitamin D-binding Protei | 1e-28 | ||
| 3g37_O | 376 | Cryo-Em Structure Of Actin Filament In The Presence | 2e-28 | ||
| 1qz5_A | 375 | Structure Of Rabbit Actin In Complex With Kabiramid | 2e-28 | ||
| 3m6g_A | 371 | Crystal Structure Of Actin In Complex With Lobophor | 2e-28 | ||
| 2w49_D | 372 | Isometrically Contracting Insect Asynchronous Fligh | 2e-28 | ||
| 1atn_A | 373 | Atomic Structure Of The Actin:dnase I Complex Lengt | 2e-28 | ||
| 3b63_F | 357 | Actin Filament Model In The Extended Form Of Acroms | 1e-27 | ||
| 2gwj_A | 371 | Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form | 1e-27 | ||
| 1t44_A | 370 | Structural Basis Of Actin Sequestration By Thymosin | 1e-27 | ||
| 3b63_D | 357 | Actin Filament Model In The Extended Form Of Acroms | 1e-27 | ||
| 3b63_E | 365 | Actin Filament Model In The Extended Form Of Acroms | 1e-27 | ||
| 3b63_B | 364 | Actin Filament Model In The Extended Form Of Acroms | 2e-27 | ||
| 1lcu_A | 371 | Polylysine Induces An Antiparallel Actin Dimer That | 8e-26 | ||
| 1c0f_A | 368 | Crystal Structure Of Dictyostelium Caatp-Actin In C | 2e-23 | ||
| 3mn5_A | 359 | Structures Of Actin-Bound Wh2 Domains Of Spire And | 6e-15 | ||
| 2p9k_B | 394 | Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta | 1e-07 | ||
| 1k8k_B | 394 | Crystal Structure Of Arp23 COMPLEX Length = 394 | 2e-07 | ||
| 3dwl_A | 427 | Crystal Structure Of Fission Yeast Arp2/3 Complex L | 1e-04 | ||
| 1k8k_A | 418 | Crystal Structure Of Arp23 COMPLEX Length = 418 | 1e-04 |
| >pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 | Back alignment and structure |
|
| >pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 | Back alignment and structure |
| >pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 | Back alignment and structure |
| >pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 | Back alignment and structure |
| >pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 | Back alignment and structure |
| >pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 | Back alignment and structure |
| >pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 | Back alignment and structure |
| >pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 | Back alignment and structure |
| >pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 | Back alignment and structure |
| >pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 | Back alignment and structure |
| >pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 | Back alignment and structure |
| >pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 | Back alignment and structure |
| >pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 | Back alignment and structure |
| >pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 | Back alignment and structure |
| >pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 | Back alignment and structure |
| >pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 | Back alignment and structure |
| >pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 | Back alignment and structure |
| >pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 | Back alignment and structure |
| >pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 | Back alignment and structure |
| >pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 | Back alignment and structure |
| >pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 | Back alignment and structure |
| >pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 | Back alignment and structure |
| >pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 | Back alignment and structure |
| >pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 | Back alignment and structure |
| >pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 | Back alignment and structure |
| >pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 | Back alignment and structure |
| >pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 | Back alignment and structure |
| >pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 | Back alignment and structure |
| >pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 | Back alignment and structure |
| >pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 | Back alignment and structure |
| >pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 | Back alignment and structure |
| >pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 | Back alignment and structure |
| >pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 | Back alignment and structure |
| >pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 67 | |||
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 5e-36 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 6e-33 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 4e-32 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 2e-30 | |
| 3dwl_A | 427 | Actin-related protein 3; propellor, actin-binding, | 3e-27 |
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 | Back alignment and structure |
|---|
Score = 122 bits (309), Expect = 5e-36
Identities = 55/64 (85%), Positives = 58/64 (90%)
Query: 3 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 62
++E ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2 EDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61
Query: 63 RGSY 66
RG
Sbjct: 62 RGIL 65
|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 | Back alignment and structure |
|---|
| >3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| 3dwl_A | 427 | Actin-related protein 3; propellor, actin-binding, | 99.74 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 99.58 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 99.56 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 99.52 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 99.45 | |
| 4fo0_A | 593 | Actin-related protein 8; chromatin remodeling, nuc | 99.36 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 98.22 | |
| 4am6_A | 655 | Actin-like protein ARP8; nuclear protein, chromati | 97.85 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 97.27 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 96.84 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 96.45 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 94.69 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 93.13 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 93.05 | |
| 4apw_A | 329 | ALP12; actin-like protein; 19.70A {Clostridium tet | 92.56 | |
| 3js6_A | 355 | Uncharacterized PARM protein; partition, segregati | 91.38 | |
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 90.65 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 89.51 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 89.26 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 85.9 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 83.19 |
| >3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=99.74 E-value=6.3e-19 Score=121.59 Aligned_cols=61 Identities=30% Similarity=0.573 Sum_probs=46.5
Q ss_pred CCcceEEEECCCCceEEEEeCCCCCeeeeeccccccccC----------------------cceecCCCcceEEchhhhh
Q psy13416 4 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ----------------------GVMVGMGQKDSYVGDEAQS 61 (67)
Q Consensus 4 ~~~~~vViD~GS~~~K~G~ag~~~P~~~~ps~vg~~~~~----------------------~~~~~~~~~~~~vG~ea~~ 61 (67)
.+.+||||||||+++||||||++.|+++|||+||+++++ ..+.+..++++|||+||+.
T Consensus 3 ~~~~~iViDnGs~~~KaG~ag~~~P~~v~Ps~vg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~ea~~ 82 (427)
T 3dwl_A 3 SFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSGPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALK 82 (427)
T ss_dssp CCCSCEEECCCSSBC-CEETTSSSCSCCCBCCEECC------------------------------CCSSCCEETHHHHH
T ss_pred CCCCeEEEECCCCeEEEEECCCCCCCCcCCceEEeecccccccccccccccccccccccccccccCcccCCeEEchHHhh
Confidence 357899999999999999999999999999999999864 1122445678999999987
Q ss_pred hcc
Q psy13416 62 KRG 64 (67)
Q Consensus 62 ~~~ 64 (67)
.++
T Consensus 83 ~~~ 85 (427)
T 3dwl_A 83 KAS 85 (427)
T ss_dssp THH
T ss_pred Ccc
Confidence 653
|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} | Back alignment and structure |
|---|
| >3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 67 | ||||
| d2fxua1 | 140 | c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: | 3e-29 | |
| d1k8ka1 | 158 | c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { | 3e-24 |
| >d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Actin species: Cow (Bos taurus) [TaxId: 9913]
Score = 98.6 bits (245), Expect = 3e-29
Identities = 54/59 (91%), Positives = 55/59 (93%)
Query: 8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGSY 66
ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG
Sbjct: 1 ALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 59
|
| >d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| d2fxua1 | 140 | Actin {Cow (Bos taurus) [TaxId: 9913]} | 99.74 | |
| d1k8ka1 | 158 | Actin-related protein 3, Arp3 {Cow (Bos taurus) [T | 99.72 | |
| d2fsja2 | 164 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 94.88 | |
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 94.84 | |
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 92.15 | |
| d1u6za2 | 124 | Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 | 85.33 | |
| d1t6ca1 | 126 | Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 | 83.59 |
| >d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Actin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.74 E-value=7.4e-19 Score=103.80 Aligned_cols=58 Identities=93% Similarity=1.407 Sum_probs=45.7
Q ss_pred eEEEECCCCceEEEEeCCCCCeeeeeccccccccCcceecCCCcceEEchhhhhhccC
Q psy13416 8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGS 65 (67)
Q Consensus 8 ~vViD~GS~~~K~G~ag~~~P~~~~ps~vg~~~~~~~~~~~~~~~~~vG~ea~~~~~~ 65 (67)
+||||+||+++|+||||++.|++++||++|+++.+....+....+.++|+++...+..
T Consensus 1 avViD~Gs~~~k~G~age~~P~~~~ps~~g~~~~~~~~~~~~~~~~~igd~~~~~~~~ 58 (140)
T d2fxua1 1 ALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 58 (140)
T ss_dssp CEEEEECSSEEEEEETTCSSCSEEEECCEEEECTTTC-------CCEEHHHHHHHTTS
T ss_pred CEEEECCCCeEEEeeCCCCCcceEeccceeeecccccccCccccceeeChhHhhcccc
Confidence 5999999999999999999999999999999987765555556678999998876543
|
| >d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|