Psyllid ID: psy13444


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MKDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIKHKIVGKS
cccccccccccccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccHHHccccccccc
ccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccc
mkdvfcyhcnltlpsstEALILHSKICsavnrpdnklkcyhckqvLSSSMDDLLfhsrkcavvwrpgksfnyvcclcdynvngrtdmkrhlqthtgekpykcshcgyetlrsHDLKRHMRIkhkivgks
MKDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLqthtgekpykcshCGYETlrshdlkrhmrikhkivgks
MKDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIKHKIVGKS
***VFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDL**************
MKDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRH***********
MKDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIKHKIVGKS
**DVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIK*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIKHKIVGKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q13127 1097 RE1-silencing transcripti yes N/A 0.310 0.036 0.442 4e-09
Q8VIG1 1082 RE1-silencing transcripti yes N/A 0.310 0.036 0.442 5e-09
O54963 1069 RE1-silencing transcripti yes N/A 0.310 0.037 0.442 6e-09
A6QPM3590 Putative histone-lysine N yes N/A 0.852 0.186 0.288 1e-08
Q9NQX0595 Putative histone-lysine N no N/A 0.852 0.184 0.288 1e-08
Q5T619 568 Zinc finger protein 648 O no N/A 0.395 0.089 0.461 3e-08
A1YPR0 619 Zinc finger and BTB domai no N/A 0.379 0.079 0.42 3e-08
Q8VCZ7 619 Zinc finger and BTB domai no N/A 0.379 0.079 0.42 3e-08
A2APF3 636 Transcriptional repressor no N/A 0.604 0.122 0.369 6e-08
Q01611 794 Zinc finger Y-chromosomal N/A N/A 0.372 0.060 0.428 6e-08
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 72  YVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIKH 123
           Y C LC Y+ + +T + RH++TH+GEKP+KC  C Y     H++ RH R  H
Sbjct: 304 YKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRHARQVH 355




Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.
Homo sapiens (taxid: 9606)
>sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=2 SV=2 Back     alignment and function description
>sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=2 SV=1 Back     alignment and function description
>sp|A6QPM3|PRDM6_BOVIN Putative histone-lysine N-methyltransferase PRDM6 OS=Bos taurus GN=PRDM6 PE=2 SV=1 Back     alignment and function description
>sp|Q9NQX0|PRDM6_HUMAN Putative histone-lysine N-methyltransferase PRDM6 OS=Homo sapiens GN=PRDM6 PE=2 SV=2 Back     alignment and function description
>sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 Back     alignment and function description
>sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 Back     alignment and function description
>sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 Back     alignment and function description
>sp|A2APF3|CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus GN=Ctcfl PE=1 SV=1 Back     alignment and function description
>sp|Q01611|ZFY1_XENLA Zinc finger Y-chromosomal protein 1 OS=Xenopus laevis GN=zfy1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
291223509 852 PREDICTED: enhancer binding protein-like 0.604 0.091 0.380 7e-09
72028083 939 PREDICTED: uncharacterized protein LOC59 0.813 0.111 0.336 9e-09
18539217 939 enhancer binding protein [Paracentrotus 0.813 0.111 0.336 1e-08
405954203 868 Transcriptional repressor CTCF [Crassost 0.604 0.089 0.369 1e-08
345322786 937 PREDICTED: RE1-silencing transcription f 0.418 0.057 0.424 1e-08
427795365 916 Putative transcriptional repressor ctcf, 0.604 0.085 0.357 8e-08
427788693 875 Putative transcriptional repressor ctcf 0.604 0.089 0.357 1e-07
260833931 473 hypothetical protein BRAFLDRAFT_60349 [B 0.775 0.211 0.330 1e-07
432959345 833 PREDICTED: transcriptional repressor CTC 0.596 0.092 0.373 2e-07
403284745 1190 PREDICTED: LOW QUALITY PROTEIN: RE1-sile 0.310 0.033 0.442 2e-07
>gi|291223509|ref|XP_002731752.1| PREDICTED: enhancer binding protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
 Score = 65.5 bits (158), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 38  KCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTHTGE 97
           KC  C++   +S  +L  H++      +P K     C LCDY     + +KRH+++HTGE
Sbjct: 445 KCELCERAFGTS-GELARHTKYIHTHEKPHK-----CPLCDYISVESSKIKRHMRSHTGE 498

Query: 98  KPYKCSHCGYETLRSHDLKRHMRI 121
           KP+KC  C Y +  ++ LKRHMR+
Sbjct: 499 KPFKCQLCAYASTDNYKLKRHMRV 522




Source: Saccoglossus kowalevskii

Species: Saccoglossus kowalevskii

Genus: Saccoglossus

Family: Harrimaniidae

Order:

Class: Enteropneusta

Phylum: Hemichordata

Superkingdom: Eukaryota

>gi|72028083|ref|XP_797592.1| PREDICTED: uncharacterized protein LOC593001 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|18539217|emb|CAD22532.1| enhancer binding protein [Paracentrotus lividus] Back     alignment and taxonomy information
>gi|405954203|gb|EKC21709.1| Transcriptional repressor CTCF [Crassostrea gigas] Back     alignment and taxonomy information
>gi|345322786|ref|XP_003430630.1| PREDICTED: RE1-silencing transcription factor-like [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|427795365|gb|JAA63134.1| Putative transcriptional repressor ctcf, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427788693|gb|JAA59798.1| Putative transcriptional repressor ctcf [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|260833931|ref|XP_002611965.1| hypothetical protein BRAFLDRAFT_60349 [Branchiostoma floridae] gi|229297338|gb|EEN67974.1| hypothetical protein BRAFLDRAFT_60349 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|432959345|ref|XP_004086251.1| PREDICTED: transcriptional repressor CTCF-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|403284745|ref|XP_003933717.1| PREDICTED: LOW QUALITY PROTEIN: RE1-silencing transcription factor [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
ZFIN|ZDB-GENE-060503-152224 si:dkey-20i20.9 "si:dkey-20i20 0.620 0.357 0.413 2.8e-12
ZFIN|ZDB-GENE-071004-66346 zgc:173816 "zgc:173816" [Danio 0.798 0.297 0.393 4.1e-12
ZFIN|ZDB-GENE-050306-35281 zgc:113102 "zgc:113102" [Danio 0.844 0.387 0.347 2.6e-11
UNIPROTKB|P80944148 ZFX "Zinc finger X-chromosomal 0.875 0.763 0.300 2.8e-11
UNIPROTKB|Q29419148 ZFY "Zinc finger Y-chromosomal 0.875 0.763 0.300 2.8e-11
UNIPROTKB|O42424179 ZNF6 "ZNF6 protein" [Gallus ga 0.674 0.486 0.333 3.5e-11
ZFIN|ZDB-GENE-050320-63407 zgc:112958 "zgc:112958" [Danio 0.844 0.267 0.347 4.7e-11
UNIPROTKB|F1NMT1 559 ZFP64 "Uncharacterized protein 0.875 0.202 0.328 8.4e-11
UNIPROTKB|J9P8G2688 J9P8G2 "Uncharacterized protei 0.798 0.149 0.358 9e-11
FB|FBgn0260741 538 CG3281 [Drosophila melanogaste 0.806 0.193 0.330 1e-10
ZFIN|ZDB-GENE-060503-152 si:dkey-20i20.9 "si:dkey-20i20.9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 2.8e-12, Sum P(2) = 2.8e-12
 Identities = 36/87 (41%), Positives = 43/87 (49%)

Query:    35 NKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQTH 94
             N L C  C + LS    +L  H R        G+   Y C  CD   +   ++K H +TH
Sbjct:   115 NSLTCTQCGKTLSCK-SNLKKHMRI-----HTGEK-PYQCSHCDKRFSFLQNLKAHERTH 167

Query:    95 TGEKPYKCSHCGYETLRSHDLKRHMRI 121
             TGEKPYKCSHC      S  LK HMRI
Sbjct:   168 TGEKPYKCSHCDKRFGHSEVLKTHMRI 194


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-071004-66 zgc:173816 "zgc:173816" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050306-35 zgc:113102 "zgc:113102" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P80944 ZFX "Zinc finger X-chromosomal protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29419 ZFY "Zinc finger Y-chromosomal protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O42424 ZNF6 "ZNF6 protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-63 zgc:112958 "zgc:112958" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMT1 ZFP64 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8G2 J9P8G2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0260741 CG3281 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 34.3 bits (79), Expect = 0.001
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 86  DMKRHLQTHTGEKPYKCSHCGYETLR 111
           +++RH++THTGEKPYKC  CG     
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26


Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-07
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 7e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-05
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-05
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-05
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-05
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 7e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 8e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-04
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 9e-04
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 32/88 (36%), Positives = 43/88 (48%), Gaps = 7/88 (7%) Query: 34 DNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNVNGRTDMKRHLQT 93 + KC C + S S +L H R +P Y C C + + +D+++H +T Sbjct: 2 EKPYKCPECGKSFSQS-SNLQKHQR-THTGEKP-----YKCPECGKSFSQSSDLQKHQRT 54 Query: 94 HTGEKPYKCSHCGYETLRSHDLKRHMRI 121 HTGEKPYKC CG RS L RH R Sbjct: 55 HTGEKPYKCPECGKSFSRSDHLSRHQRT 82
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 9e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 6e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-06
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 8e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-05
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 9e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 9e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 9e-04
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
 Score = 59.4 bits (145), Expect = 3e-13
 Identities = 13/50 (26%), Positives = 30/50 (60%)

Query: 72  YVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRI 121
             C  C Y+ + +  ++ H + H  ++P+KC++C ++T +  +L +HM+ 
Sbjct: 10  EKCSECSYSCSSKAALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKK 59


>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.95
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.95
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.94
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.94
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.89
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.87
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.86
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.85
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.84
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.83
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.82
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.82
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.79
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.77
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.75
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.74
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.71
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.7
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.69
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.67
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.67
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.67
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.66
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.66
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.63
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.58
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.58
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.58
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.57
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.57
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.56
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.54
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.48
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.48
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.47
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.43
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.42
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.42
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.42
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.42
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.4
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.4
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.4
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.4
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.39
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.39
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.39
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.38
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.38
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.38
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.38
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.38
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.38
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.38
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.37
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.37
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.37
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.36
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.35
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.33
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.33
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.28
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.28
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.27
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.27
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.26
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.25
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.23
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.22
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.21
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.21
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.19
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.19
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.17
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.16
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.1
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.02
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.0
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.99
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.98
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.97
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.97
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.95
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.95
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.95
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.94
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.93
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.92
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.89
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.87
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.86
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.85
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.84
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.83
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.83
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.82
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.8
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.78
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.77
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.77
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.77
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.75
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.74
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.19
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.72
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.68
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.65
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.63
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.63
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.57
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.53
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.91
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.5
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.49
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.48
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.47
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.42
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.42
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.42
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.41
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.39
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.38
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.38
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.36
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.35
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.35
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.33
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.32
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.64
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.29
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.56
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.23
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.54
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.21
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.2
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.02
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.94
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.89
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.52
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.18
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.13
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.74
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.88
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.78
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.6
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.44
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.66
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.22
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 91.68
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 91.25
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 91.22
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.94
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 89.89
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 89.4
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 88.59
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 87.02
2k5c_A95 Uncharacterized protein PF0385; structural genomic 85.86
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 85.74
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 84.23
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 83.54
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 82.94
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 82.68
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 82.56
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 81.13
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 80.05
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=2.3e-29  Score=156.11  Aligned_cols=115  Identities=27%  Similarity=0.489  Sum_probs=75.5

Q ss_pred             CcccccccccccCCcHHHHHHHHhhhcccCCCCCcccCccccccccCchhhHHHHHhhcccccCCCCccccccCCCCCcC
Q psy13444          2 KDVFCYHCNLTLPSSTEALILHSKICSAVNRPDNKLKCYHCKQVLSSSMDDLLFHSRKCAVVWRPGKSFNYVCCLCDYNV   81 (129)
Q Consensus         2 k~~~c~~c~~~f~~~~~~l~~h~~~~~~~~~~~~~~~c~~c~~~f~~~~~~l~~h~~~c~~~~~~~~~~~~~c~~c~~~~   81 (129)
                      ++|.|+.|++.|.. ...|..|+..|.    ++++|.|+.|++.|.+.. .|..|++.+.      ...+|.|+.|++.|
T Consensus        76 ~~~~C~~C~~~f~~-~~~l~~H~~~h~----~~~~~~C~~C~~~f~~~~-~l~~H~~~h~------~~~~~~C~~C~~~f  143 (190)
T 2i13_A           76 KPYKCPECGKSFSQ-RANLRAHQRTHT----GEKPYACPECGKSFSQLA-HLRAHQRTHT------GEKPYKCPECGKSF  143 (190)
T ss_dssp             CCEECTTTCCEESC-HHHHHHHHHHHH----TCCCEECTTTCCEESSHH-HHHHHHHHHH------CCCCEECTTTCCEE
T ss_pred             CCccCcccCCccCC-HHHHHHHHHhcC----CCCCCcCCCCCCccCCHH-HHHHHHHHhC------CCCCeECCCCCccc
Confidence            34555555555555 555555555555    455555555555555554 5555555421      23458888888888


Q ss_pred             CChhhHHHHhhhccCCCcccCCCCCccccCchhHHHHHHhhhcccCC
Q psy13444         82 NGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIKHKIVGK  128 (129)
Q Consensus        82 ~~~~~l~~h~~~h~~~k~~~c~~C~k~f~~~~~l~~h~~~~~~~~~~  128 (129)
                      .....|..|+++|.+++||.|..|++.|...+.|..|+++|+|++||
T Consensus       144 ~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          144 SREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             SCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             CCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            88888888888888888888888888888888888888888888886



>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.003
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.7 bits (109), Expect = 8e-09
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 94  HTGEKPYKCSHCGYETLRSHDLKRHMRI 121
           H+GEKPY C  CG    RS  L +H R+
Sbjct: 2   HSGEKPYGCVECGKAFSRSSILVQHQRV 29


>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.77
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.71
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.62
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.6
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.54
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.52
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.45
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.44
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.41
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.41
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.37
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.32
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.16
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.16
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.15
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.15
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.12
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.08
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.07
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.03
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.96
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.95
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.92
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.9
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.84
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.81
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.79
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.76
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.73
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.7
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.67
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.63
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.57
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.52
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.49
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.43
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.42
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.31
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.24
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.23
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.19
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.16
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.15
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.08
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.06
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.04
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.03
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.93
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.84
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.81
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.81
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.68
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.68
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.67
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.64
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.63
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.48
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.44
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.43
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.41
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.25
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.25
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.18
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.16
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.12
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.1
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.97
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.96
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.95
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.88
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.84
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.84
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.8
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.6
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.56
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.45
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.3
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.26
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.94
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.89
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.83
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.72
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.64
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.5
d1y0jb136 U-shaped transcription factor, different fingers { 95.39
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.62
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.61
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.54
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.46
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.88
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.01
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.0
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 91.86
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.3
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.15
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.52
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.4
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 90.28
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.19
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.91
d1fu9a_36 U-shaped transcription factor, different fingers { 87.71
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 85.07
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.23
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 83.42
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 83.25
d1wjpa142 Zinc finger protein 295, ZNF295 {Human (Homo sapie 82.88
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 82.78
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 82.3
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=1.6e-19  Score=88.49  Aligned_cols=52  Identities=33%  Similarity=0.694  Sum_probs=49.7

Q ss_pred             cccccCCCCCcCCChhhHHHHhhhccCCCcccCCCCCccccCchhHHHHHHhh
Q psy13444         70 FNYVCCLCDYNVNGRTDMKRHLQTHTGEKPYKCSHCGYETLRSHDLKRHMRIK  122 (129)
Q Consensus        70 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~k~~~c~~C~k~f~~~~~l~~h~~~~  122 (129)
                      ++|.| .||+.|....+|..|+++|+|++||.|..||++|...+.|..|+++|
T Consensus         2 K~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            47999 59999999999999999999999999999999999999999999986



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa1 g.37.1.1 (A:1-42) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure