Psyllid ID: psy13734

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820
MALLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR
cccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccccHHHHHHHHHcccccEEEEEEccEEEEEEccHHHHHHHHHccccccccccccHHHHccccccccccccccEEEEccHHHHHHHHcccccccccccccccccccccccccccccccEEEcccccHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccEEcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccccccccccEEcccccccccEEEcHHHHccccccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEccHEEccccccccccHHHHHHHHHHHHccEEEEEEccccEEEEEcHHHHHHHHHHcccHccccccccEEEEcccccEEEEEccccccEEcccHHHHHHHHHHHHHHcccccccEEEEcccccHHHccccEEEEcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccEEEccccHHEEEEEEEccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHccccccccEEccccEEEccEEEccccEEEEcHHHHHcccccccccccccHHHHEcccccEcccccccccccHccEEEEccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccHHEEEEEEEccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHccccccccEEccccEEEccEEEccccEEEEEHHHHHcccccccccccccHHHHEcccccEccccccccccccc
MALLLSVMWFEIFLVFVIICILAYldtkkprnfppgpdwipiLGSALAIQKLRNQTGYLYQACAELSkqygpvvglrvgkdrqvvcFGYPAIKEMlskeefdgrprgpfyetrtwgkrqglmegTVTAKVLSSLKRRekedrigesqpfreragikpvtalGYKVDVLLSKagllvtdeQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQhlslpgaiipmrdafsvpVLNTLWSMLagiryspedKELKKIQSLLTELFANIDMVGALfsqfpilryvapemsgyKSFVSIHQKVWKFLRNELdnhketfnpdemRDIMDVYLKTlksedktdtfSESQLLAICMDMFmagsettttlpsrhvnshdMIVCFYLNRyltssmytrSRRSLVQTLPYLEAITYESVRVFMgrtfsiphralrdttlqgyfipkdTMIIANFNGvlmdkefwhdpevfrperflndkgaiqvpdqylpfgagpdrllvTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEvqdggaiipmrdafsvpVLNTLWSMLagiryspedKELKKIQSLLTELFANIDMVGALfsqfpilryvapemsgyKSFVSIHQKVWKFLRNELdnhketfnpdemRDIMDVYLKTlksedktdtfSESQLLAICMDMFmagsettskslGFGFLYLLLHPDVQKKAQAEIDRvvgrdrlpslndrphmpyleaITYESVRVFMgrtfsiphralrdttlqgyfipkdTMIIANFNGvlmdkefwhdpevfrperflndkgaiqvpdqylpfgagr
MALLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKemlskeefdgrprGPFYEtrtwgkrqglmegtvtakvlsslkrrekedrigesqpfreragikpvtaLGYKVDVLLSKAGllvtdeqlwvEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNhketfnpdemrdIMDVYLKTlksedktdTFSESQLLAICMDMFMAGSETTttlpsrhvnsHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTfsiphralrdTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNhketfnpdemrdIMDVYLKTlksedktdtFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRvvgrdrlpslndrphmpyleAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPerflndkgaiqvpdqylpfgagr
MALLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR
**LLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSK********GPFYETRTWGKRQGLMEGTVT*************************AGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLK******TFSESQLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLK******TFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYL******
**LLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIG***********KPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLK**********FS**QLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLT**********LVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLK**********FS**QLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR
MALLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVTAKVLSSL************QPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR
*ALLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGA**
iiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLLSVMWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query820 2.2.26 [Sep-21-2011]
Q9V399503 Probable cytochrome P450 yes N/A 0.521 0.850 0.376 2e-89
P51590502 Cytochrome P450 2J3 OS=Ra yes N/A 0.382 0.625 0.376 1e-53
O54750501 Cytochrome P450 2J6 OS=Mu yes N/A 0.380 0.622 0.352 2e-53
Q9VW43504 Probable cytochrome P450 no N/A 0.517 0.841 0.293 2e-53
P51589502 Cytochrome P450 2J2 OS=Ho yes N/A 0.389 0.635 0.335 2e-49
P52786501 Cytochrome P450 2J1 OS=Or yes N/A 0.387 0.634 0.329 2e-49
O54749501 Cytochrome P450 2J5 OS=Mu no N/A 0.385 0.630 0.345 5e-49
P05180491 Cytochrome P450 2H1 OS=Ga no N/A 0.382 0.639 0.323 3e-47
Q29510489 Cytochrome P450 2C30 OS=O no N/A 0.4 0.670 0.332 1e-46
Q4V8D1530 Cytochrome P450 2U1 OS=Ra no N/A 0.375 0.581 0.356 9e-46
>sp|Q9V399|CP303_DROME Probable cytochrome P450 303a1 OS=Drosophila melanogaster GN=Cyp303a1 PE=2 SV=1 Back     alignment and function desciption
 Score =  330 bits (847), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 193/513 (37%), Positives = 277/513 (53%), Gaps = 85/513 (16%)

Query: 8   MWFEIFLVFVIICI-LAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAEL 66
           M++ +  +F    + + +   +KP+ FPPGP W PI+GSAL + +LR + G   +     
Sbjct: 1   MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVF 60

Query: 67  SKQY-GP--VVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLME 123
           ++QY  P    GL++GKD+ V+ +   AI EM++ E+ DGRP G F              
Sbjct: 61  ARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIF-------------- 106

Query: 124 GTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWV 183
                                                  Y++    S+ G+L+TD ++WV
Sbjct: 107 ---------------------------------------YRLRTFNSRLGVLLTDGEMWV 127

Query: 184 EQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVL 243
           EQRRF+LR L+ FGF +  M  +V  EA  L+Q  K +V         I M D  SV VL
Sbjct: 128 EQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVL 187

Query: 244 NTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFV 303
           NTLW ML+G RY P   E+ ++     ELF NIDMVGALFS FP+LR++AP  SGY  FV
Sbjct: 188 NTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFV 247

Query: 304 SIHQKVWKFLRNELDNHKETF-NPDEMRDIMDVYLKTL-KSEDKTDTFSESQLLAICMDM 361
             H+ ++ F+  E++ H+ T+ N DE RD+MD YL+   +  D+   FS+  LLAIC+DM
Sbjct: 248 ESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLDM 307

Query: 362 FMAGSETTTTLPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQT-------------- 407
           F+AGSETT         +  +  CF ++  L   +  R+ + + +               
Sbjct: 308 FLAGSETT---------NKSLGFCF-MHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRT 357

Query: 408 -LPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHD 466
            LPY EAIT E+VR+FM  TF IPHRA+ DT L GY IPKDTM+IA F G+L++   + D
Sbjct: 358 KLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPD 417

Query: 467 PEVFRPERFLNDKGAIQVPDQYLPFGAGPDRLL 499
           PE F P+R+L D G +++P+ + PFG G  R +
Sbjct: 418 PESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCM 449
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 Back     alignment and function description
>sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 Back     alignment and function description
>sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 Back     alignment and function description
>sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 Back     alignment and function description
>sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 Back     alignment and function description
>sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=2 SV=1 Back     alignment and function description
>sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 Back     alignment and function description
>sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query820
242022460494 cytochrome P-450, putative [Pediculus hu 0.518 0.860 0.560 1e-157
193681039500 PREDICTED: probable cytochrome P450 303a 0.514 0.844 0.568 1e-149
233770157508 cytochrome P450 [Nilaparvata lugens] 0.520 0.840 0.495 1e-137
408724207497 cytochrome P450 CYP303A1, partial [Laode 0.520 0.859 0.499 1e-131
226858987497 P450 [Nilaparvata lugens] 0.463 0.764 0.492 1e-118
189235782493 PREDICTED: similar to cytochrome P450 [T 0.518 0.862 0.431 1e-116
383866063530 PREDICTED: probable cytochrome P450 303a 0.526 0.815 0.429 1e-116
170046190506 cytochrome P450 [Culex quinquefasciatus] 0.515 0.835 0.417 1e-110
357609723501 putative cytochrome P-450 [Danaus plexip 0.542 0.888 0.417 1e-110
158299129530 AGAP010077-PA [Anopheles gambiae str. PE 0.507 0.784 0.433 1e-107
>gi|242022460|ref|XP_002431658.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212516966|gb|EEB18920.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 284/507 (56%), Positives = 348/507 (68%), Gaps = 82/507 (16%)

Query: 8   MWFEIFLVFVIICILAYLDTKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELS 67
           MWF      +I+ +L YLDT+KP+++PPGP W+P+LGSAL +  LR +TGYLY+ CA L+
Sbjct: 1   MWFAAIFFVIILFLLLYLDTRKPKDYPPGPPWLPVLGSALTVHNLRKETGYLYKTCANLA 60

Query: 68  KQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEEFDGRPRGPFYETRTWGKRQGLMEGTVT 127
           K YGPVVGL++GKD+QVVC  Y AIKEML+K++FDGRP+GPFYETRTWG R+        
Sbjct: 61  KIYGPVVGLKIGKDKQVVCCSYEAIKEMLTKDDFDGRPQGPFYETRTWGIRR-------- 112

Query: 128 AKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRR 187
                                                        GLL+TDE+ W+EQR+
Sbjct: 113 ---------------------------------------------GLLLTDEEFWLEQRK 127

Query: 188 FVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPG-AIIPMRDAFSVPVLNTL 246
           FVLR LREFGFG+RTM  LVEEEA+++V+ FK++V    L G  +IPMRD F V VLNTL
Sbjct: 128 FVLRHLREFGFGRRTMGGLVEEEAHEMVKDFKKKV----LEGDNVIPMRDVFGVYVLNTL 183

Query: 247 WSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVAPEMSGYKSFVSIH 306
           WSMLA IRYSPED ELKK+Q+LLTELF NIDMVG  FSQFPILRY+APE SGYK FV IH
Sbjct: 184 WSMLASIRYSPEDLELKKLQNLLTELFINIDMVGCPFSQFPILRYIAPEASGYKQFVQIH 243

Query: 307 QKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGS 366
           QKVW+FL+NELDNHK TF   E RD+MDVYL+ L SE K D+FSESQLLAICMDMFMAGS
Sbjct: 244 QKVWEFLKNELDNHKRTFKDGEPRDLMDVYLQILSSEQKKDSFSESQLLAICMDMFMAGS 303

Query: 367 ETTTT--------------LPSRHVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLE 412
           ETT+               +  +     D++V     R    ++  +S+      +PYLE
Sbjct: 304 ETTSKSLGFEFLYLLRNPEIQKKAQEEIDLVV----GRDRLPTLDDKSK------MPYLE 353

Query: 413 AITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRP 472
           AI+ ESVRVFMGRTF +PHRALRDTTLQGY IPKDTM+ ANF+ VLMD++++ DP  F+P
Sbjct: 354 AISLESVRVFMGRTFGVPHRALRDTTLQGYKIPKDTMLTANFHNVLMDEKYFDDPNEFKP 413

Query: 473 ERFLNDKGAIQVPDQYLPFGAGPDRLL 499
           ERFL+ KG + +PDQYLPFG G  R +
Sbjct: 414 ERFLDSKGNLSIPDQYLPFGWGKHRCM 440

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193681039|ref|XP_001951093.1| PREDICTED: probable cytochrome P450 303a1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|233770157|gb|ACQ91145.1| cytochrome P450 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|408724207|gb|AFU86421.1| cytochrome P450 CYP303A1, partial [Laodelphax striatella] Back     alignment and taxonomy information
>gi|226858987|gb|ACO87994.1| P450 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|189235782|ref|XP_966541.2| PREDICTED: similar to cytochrome P450 [Tribolium castaneum] gi|270004813|gb|EFA01261.1| cytochrome P450 303A1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383866063|ref|XP_003708491.1| PREDICTED: probable cytochrome P450 303a1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|170046190|ref|XP_001850658.1| cytochrome P450 [Culex quinquefasciatus] gi|167869044|gb|EDS32427.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357609723|gb|EHJ66608.1| putative cytochrome P-450 [Danaus plexippus] Back     alignment and taxonomy information
>gi|158299129|ref|XP_319235.4| AGAP010077-PA [Anopheles gambiae str. PEST] gi|157014220|gb|EAA13781.4| AGAP010077-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query820
FB|FBgn0001992503 Cyp303a1 "Cyp303a1" [Drosophil 0.392 0.640 0.510 7.3e-105
FB|FBgn0036910504 Cyp305a1 "Cyp305a1" [Drosophil 0.385 0.626 0.347 9.6e-64
MGI|MGI:1270148501 Cyp2j6 "cytochrome P450, famil 0.382 0.626 0.368 3.5e-63
RGD|631442502 Cyp2j3 "cytochrome P450, famil 0.382 0.625 0.379 6e-62
UNIPROTKB|P51590502 Cyp2j3 "Cytochrome P450 2J3" [ 0.382 0.625 0.379 6e-62
UNIPROTKB|E1BFL1501 CYP2J2 "Uncharacterized protei 0.386 0.632 0.349 1.4e-60
UNIPROTKB|F6Y7G5502 CYP2J2 "Uncharacterized protei 0.382 0.625 0.346 2.2e-59
UNIPROTKB|E2R6Z7445 CYP2J2 "Uncharacterized protei 0.381 0.703 0.347 3.7e-59
MGI|MGI:1270149501 Cyp2j5 "cytochrome P450, famil 0.384 0.628 0.346 5.7e-59
RGD|1563215502 Cyp2j10 "cytochrome P450, fami 0.385 0.629 0.354 6.4e-59
FB|FBgn0001992 Cyp303a1 "Cyp303a1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 830 (297.2 bits), Expect = 7.3e-105, Sum P(2) = 7.3e-105
 Identities = 168/329 (51%), Positives = 228/329 (69%)

Query:   498 LLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEV-QDGG--AIIP 554
             +L+TD ++WVEQRRF+LR L+ FGF +  M  +V  EA  L+Q  K +V + GG    I 
Sbjct:   118 VLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIE 177

Query:   555 MRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYVA 614
             M D  SV VLNTLW ML+G RY P   E+ ++     ELF NIDMVGALFS FP+LR++A
Sbjct:   178 MHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIA 237

Query:   615 PEMSGYKSFVSIHQKVWKFLRNELDNHKETF-NPDEMRDIMDVYLKTL-KSEDKTDTFSE 672
             P  SGY  FV  H+ ++ F+  E++ H+ T+ N DE RD+MD YL+   +  D+   FS+
Sbjct:   238 PNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSD 297

Query:   673 SQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLN-DRP 731
               LLAIC+DMF+AGSETT+KSLGF F++L+L P++Q++A  EI  VVG +R+P  + DR 
Sbjct:   298 QSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRT 357

Query:   732 HMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHD 791
              +PY EAIT E+VR+FM  TF IPHRA+ DT L GY IPKDTM+IA F G+L++   + D
Sbjct:   358 KLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPD 417

Query:   792 PEVFRPERFLNDKGAIQVPDQYLPFGAGR 820
             PE F P+R+L D G +++P+ + PFG GR
Sbjct:   418 PESFNPDRYLFD-GHLKLPEAFNPFGFGR 445
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0007423 "sensory organ development" evidence=IMP
FB|FBgn0036910 Cyp305a1 "Cyp305a1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1270148 Cyp2j6 "cytochrome P450, family 2, subfamily j, polypeptide 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|631442 Cyp2j3 "cytochrome P450, family 2, subfamily j, polypeptide 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P51590 Cyp2j3 "Cytochrome P450 2J3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFL1 CYP2J2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y7G5 CYP2J2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6Z7 CYP2J2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1270149 Cyp2j5 "cytochrome P450, family 2, subfamily j, polypeptide 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563215 Cyp2j10 "cytochrome P450, family 2, subfamily j, polypeptide 10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query820
pfam00067461 pfam00067, p450, Cytochrome P450 1e-69
pfam00067461 pfam00067, p450, Cytochrome P450 2e-52
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-39
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-36
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 5e-32
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-28
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 5e-27
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-26
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-25
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-22
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-21
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-21
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 5e-21
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 9e-21
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 7e-20
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-19
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-15
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-15
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-14
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-14
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 4e-14
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 5e-14
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 5e-14
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 6e-14
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 8e-13
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 1e-12
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 6e-12
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 3e-11
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-10
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 1e-10
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 2e-10
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-09
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-08
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-08
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 1e-08
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 3e-07
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 8e-07
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-06
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-06
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-05
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 2e-05
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 3e-05
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 5e-05
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 6e-05
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-04
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 3e-04
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 4e-04
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 5e-04
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 0.001
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 0.001
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 0.002
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 0.004
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  237 bits (606), Expect = 1e-69
 Identities = 105/356 (29%), Positives = 171/356 (48%), Gaps = 19/356 (5%)

Query: 469 VFRPERFLNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMA 528
             RP+             + + F  GP          W + RRF+        FGK +  
Sbjct: 67  SGRPDEPWFATSRGPFLGKGIVFANGPR---------WRQLRRFLTPTFT--SFGKLSFE 115

Query: 529 QLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSP-EDKELKKIQ 587
             VEEEA  LV+  ++       +I + D      LN + S+L G R+   ED +  ++ 
Sbjct: 116 PRVEEEARDLVEKLRKTA-GEPGVIDITDLLFRAALNVICSILFGERFGSLEDPKFLELV 174

Query: 588 SLLTELFANID-MVGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFN 646
             + EL + +      L   FPIL+Y        +      +K+   L   ++  +ET +
Sbjct: 175 KAVQELSSLLSSPSPQLLDLFPILKYFPGPH--GRKLKRARKKIKDLLDKLIEERRETLD 232

Query: 647 PDE--MRDIMDVYLKTLKSEDKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLH 704
             +   RD +D  L   + ED +   ++ +L A  +++F AG++TTS +L +    L  H
Sbjct: 233 SAKKSPRDFLDALLLAKEEEDGS-KLTDEELRATVLELFFAGTDTTSSTLSWALYELAKH 291

Query: 705 PDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTL 764
           P+VQ+K + EID V+G  R P+ +D  +MPYL+A+  E++R+       +P    +DT +
Sbjct: 292 PEVQEKLREEIDEVIGDKRSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVI 351

Query: 765 QGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR 820
            GY IPK T++I N   +  D E + +PE F PERFL++ G  +    +LPFGAG 
Sbjct: 352 PGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGP 407

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 820
KOG0156|consensus489 100.0
KOG0158|consensus499 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0156|consensus489 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
KOG0159|consensus519 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0157|consensus497 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
KOG0158|consensus499 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
KOG0159|consensus519 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
KOG0157|consensus497 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
KOG0684|consensus486 100.0
KOG0684|consensus486 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>KOG0156|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-66  Score=567.78  Aligned_cols=400  Identities=32%  Similarity=0.554  Sum_probs=316.3

Q ss_pred             ccCCCCCCCCCcccccccchHHHhhhccccchhhHHHHHHHhhcCCeEEEEeCCceEEEecChHHHHHHhhhc--ccCCC
Q psy13734         27 TKKPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKE--EFDGR  104 (820)
Q Consensus        27 ~~~~~~~ppgP~~~PilGn~~~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvi~~~~~~~evl~~~--~~~~~  104 (820)
                      ++++.++||||+++||+||++++...     ..|..+.+|+++|||||++|+|..|+||++|+++++|+|+++  .|++|
T Consensus        21 ~~~~~~lPPGP~~lPiIGnl~~l~~~-----~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~R   95 (489)
T KOG0156|consen   21 YRKRRNLPPGPPPLPIIGNLHQLGSL-----PPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADR   95 (489)
T ss_pred             ccCCCCCCcCCCCCCccccHHHcCCC-----chhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCC
Confidence            34458899999999999999998642     378999999999999999999999999999999999999994  68888


Q ss_pred             CCCccc--ccccccccccccccchhhhhhhhhhhhhhhcccCCCCccccccCCCcccccccchhhhccccceecc-Cchh
Q psy13734        105 PRGPFY--ETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVT-DEQL  181 (820)
Q Consensus       105 ~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~-~g~~  181 (820)
                      +. +..  .....                                                      ++.|++++ +|+.
T Consensus        96 p~-~~~~~~~~~~------------------------------------------------------~~~~i~~a~yG~~  120 (489)
T KOG0156|consen   96 PD-PTATLKYLSY------------------------------------------------------GGKGIVFAPYGDY  120 (489)
T ss_pred             CC-chhhHHHhcC------------------------------------------------------CCCceEeCCCcHH
Confidence            75 211  11111                                                      23578888 8999


Q ss_pred             HHHHHhHHHHHHhhcccChHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccCcchhhhhhHHHHHHHHHhCCCCCCCC-H
Q psy13734        182 WVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPED-K  260 (820)
Q Consensus       182 W~~~R~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~fg~~~~~~~-~  260 (820)
                      ||++||+++..+.+++.++..++.. .++++.+++.+.+  .+   .+.+||+.+.+..++.|+|++++||.+++.++ +
T Consensus       121 Wr~~Rr~~~~~L~~~~~~~~~~~~R-~~E~~~l~~~l~~--~~---~~~~vdl~~~l~~~~~nvI~~~~fG~rf~~~~~~  194 (489)
T KOG0156|consen  121 WREMRRFALTELRSFGRGKSFMEIR-EEEVDELVKKLSK--SK---KGEPVDLSELLDLLVGNVICRMLFGRRFEEEDEE  194 (489)
T ss_pred             HHHHHHHHHHHhcChhhhhhhHHHH-HHHHHHHHHHHHh--cC---CCceeeHHHHHHHHHHHHHHHHHhCCccccCCch
Confidence            9999999999999887766655544 7888888888876  11   12789999999999999999999999998754 4


Q ss_pred             HHHHHHHHHHHHHhhhhhhhhhhhccc-ccccccccccCc-chhHHHHHHHHHHHHHHHHhhhhhcCCCCCCcHHHHHHH
Q psy13734        261 ELKKIQSLLTELFANIDMVGALFSQFP-ILRYVAPEMSGY-KSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLK  338 (820)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~~p-~l~~~~~~~~~~-~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~l~~~l~  338 (820)
                      +...+.+.+.+.+.... ...+.+.+| ++++++ ...+. ++......++..++.+.|+++++..+.++.+|++|.+|+
T Consensus       195 ~~~~~~~l~~~~~~~~~-~~~~~d~~p~~l~~~~-~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~~~~~D~vD~lL~  272 (489)
T KOG0156|consen  195 EFLELKELVEESLELLG-SFNLSDYFPFLLRWLD-GISGLEKRLKKVSKRLDEFLERIIDEHREKIGDEEGRDFVDALLK  272 (489)
T ss_pred             HHHHHHHHHHHHHHHhC-CccHHHHhhHHHHhcc-cccHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCcHHHHHHH
Confidence            55557777766654432 223456777 567765 33333 344455556889999999998765311223899999998


Q ss_pred             HhccCCCCCCcCHHHHHHHHHHHHhccchhhcccccc-------ccccchhHHHHHHHhhhcccccccccccccccChhH
Q psy13734        339 TLKSEDKTDTFSESQLLAICMDMFMAGSETTTTLPSR-------HVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYL  411 (820)
Q Consensus       339 ~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTTa~~l~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lpYl  411 (820)
                      ..++++... +|+++|...++++++||+||||+|+.|       ||++|+++.. +++..+....  ..+++|+.+||||
T Consensus       273 ~~~~~~~~~-~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qe-EId~vvG~~r--~v~e~D~~~lpYL  348 (489)
T KOG0156|consen  273 LMKEEKAEG-LTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQE-EIDEVVGKGR--LVSESDLPKLPYL  348 (489)
T ss_pred             hhcccccCC-CCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHH-HHHHHhCCCC--CCChhhhccCHHH
Confidence            766544333 999999999999999999999999876       4555554332 2333222211  1457889999999


Q ss_pred             HHHHHHHhhcccccccccccccccCceecceeecCCcEEEecccccccCCcCCCCCCCcCCcccccCC-CCccCCCcccc
Q psy13734        412 EAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDK-GAIQVPDQYLP  490 (820)
Q Consensus       412 ~avi~EtlRl~p~~~~~~~r~~~~d~~i~g~~IPkGt~V~~~~~~~~~d~~~~~dp~~F~PeR~~~~~-~~~~~~~~~~~  490 (820)
                      +|||+||+|+||++|+.+||.+++|++++||.|||||.|++|+|++||||++|+||++|+||||++.. ... ....++|
T Consensus       349 ~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~d~~~-~~~~~iP  427 (489)
T KOG0156|consen  349 KAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSNDGKG-LDFKLIP  427 (489)
T ss_pred             HHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCccccC-CceEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999874 333 5678999


Q ss_pred             CCCCCCccc
Q psy13734        491 FGAGPDRLL  499 (820)
Q Consensus       491 Fg~G~r~~~  499 (820)
                      ||.|.|.|.
T Consensus       428 FG~GRR~Cp  436 (489)
T KOG0156|consen  428 FGSGRRICP  436 (489)
T ss_pred             CCCCcCCCC
Confidence            999999997

>KOG0158|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query820
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 1e-45
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-43
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 4e-43
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 5e-43
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 7e-43
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 9e-43
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-42
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-42
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-42
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-42
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-42
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-42
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 3e-42
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-42
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-42
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 5e-42
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-41
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 9e-40
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-39
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-39
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-39
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-39
3pm0_A507 Structural Characterization Of The Complex Between 2e-37
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-36
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-36
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 6e-29
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 6e-24
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-21
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 3e-21
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 4e-21
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 5e-14
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 5e-13
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-09
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 1e-09
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-08
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-08
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-08
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-08
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 4e-08
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 4e-08
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 4e-08
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 4e-08
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 4e-08
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 4e-08
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-08
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-08
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 4e-08
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 4e-08
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-08
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 4e-08
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 4e-08
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 4e-08
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 5e-08
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 5e-08
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 7e-08
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 8e-08
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 8e-08
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-08
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 8e-08
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 9e-08
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-07
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-07
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-07
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-07
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-07
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-07
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-07
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-07
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-07
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-07
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-07
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 1e-06
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-06
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-06
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 1e-06
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-06
4aw3_A417 Structure Of The Mixed-Function P450 Mycg F286v Mut 1e-05
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-05
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-05
3zsn_A417 Structure Of The Mixed-Function P450 Mycg F286a Mut 3e-05
2y46_A417 Structure Of The Mixed-Function P450 Mycg In Comple 3e-05
3a4g_A411 Structure Of Cytochrome P450 Vdh From Pseudonocardi 1e-04
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 3e-04
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 3e-04
3a4z_A411 Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Ob 4e-04
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 5e-04
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 5e-04
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 5e-04
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 5e-04
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 5e-04
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 7e-04
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 187/356 (52%), Gaps = 28/356 (7%)
Query: 476 LNDKGAIQVPDQYLPFGAGPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEA 535
            + +G I + D   PF  G   +     + W   RRF +  +R+FG GKR++ + ++EEA
Sbjct: 76  FSGRGKIAMVD---PFFRGYGVIFANGNR-WKVLRRFSVTTMRDFGMGKRSVEERIQEEA 131
Query: 536 YQLVQLFKQEVQDGGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFA 595
             L++  ++     GA++     F     N + S++ G R+  +D+E  K+ +L  + F+
Sbjct: 132 QCLIEELRK---SKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLNLFYQTFS 188
Query: 596 NIDMV-GALFSQFPILRYVAPEMSGY-KSFVSIHQKVWK-------FLRNELDNHKETFN 646
            I  V G LF  F          SG+ K F   H++V+K       ++ + ++ H+ET +
Sbjct: 189 LISSVFGQLFELF----------SGFLKHFPGAHRQVYKNLQEINAYIGHSVEKHRETLD 238
Query: 647 PDEMRDIMDVYLKTLKSE--DKTDTFSESQLLAICMDMFMAGSETTSKSLGFGFLYLLLH 704
           P   RD++D YL  ++ E  +    FS   L    + +F AG+ETTS +L +GFL +L +
Sbjct: 239 PSAPRDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKY 298
Query: 705 PDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAITYESVRVFMGRTFSIPHRALRDTTL 764
           P V ++   EI++V+G  R P L+DR  MPY EA+ YE  R        +PH   + T+ 
Sbjct: 299 PHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHIVTQHTSF 358
Query: 765 QGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGR 820
           +GY IPKDT +    +  L D  ++  P+ F P+ FL+  GA++  + ++PF  G+
Sbjct: 359 RGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGK 414
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|4AW3|A Chain A, Structure Of The Mixed-Function P450 Mycg F286v Mutant In Complex With Mycinamicin V In P1 Space Group Length = 417 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3ZSN|A Chain A, Structure Of The Mixed-Function P450 Mycg F286a Mutant In Complex With Mycinamicin Iv Length = 417 Back     alignment and structure
>pdb|2Y46|A Chain A, Structure Of The Mixed-Function P450 Mycg In Complex With Mycinamicin Iv In C 2 2 21 Space Group Length = 417 Back     alignment and structure
>pdb|3A4G|A Chain A, Structure Of Cytochrome P450 Vdh From Pseudonocardia Autotrophica (Trigonal Crystal Form) Length = 411 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3A4Z|A Chain A, Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Obtained By Directed Evolution Length = 411 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query820
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-111
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 9e-96
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-110
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-96
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-108
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 8e-93
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-107
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-71
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-17
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-107
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-90
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-106
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 9e-72
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-16
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-106
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-70
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-16
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-105
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-70
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-16
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-105
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 6e-71
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 4e-16
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-100
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-83
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-64
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-49
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-49
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-38
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-46
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 8e-35
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-46
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 4e-32
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-43
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-26
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-05
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 4e-42
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-24
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-06
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-41
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 8e-29
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 6e-38
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 4e-19
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-38
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-25
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 7e-38
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-27
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-37
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-30
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-37
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-26
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-37
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-22
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 9e-34
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 5e-27
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-33
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-18
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-29
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 9e-26
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-26
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 5e-17
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-24
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-13
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 6e-24
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 3e-13
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 4e-07
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-11
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 2e-04
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-11
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 4e-05
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 2e-11
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 1e-04
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 2e-11
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 6e-05
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 3e-11
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 3e-05
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 5e-11
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 3e-05
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 5e-11
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 9e-05
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 6e-11
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 3e-04
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 6e-11
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 2e-05
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 9e-11
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 2e-04
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 2e-10
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 2e-05
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 3e-10
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-04
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 3e-10
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 4e-04
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 4e-10
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 5e-10
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 2e-04
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 8e-10
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 9e-10
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 1e-09
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 1e-04
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-09
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-04
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 1e-09
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 3e-04
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 1e-09
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 1e-09
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-09
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-04
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 3e-09
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 2e-04
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 6e-09
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 4e-04
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 8e-09
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 3e-04
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 1e-08
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 1e-08
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 2e-08
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 8e-04
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 5e-08
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 5e-08
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 2e-04
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 6e-08
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 8e-08
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 1e-07
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 1e-07
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 1e-07
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 1e-07
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 2e-07
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 2e-07
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 2e-07
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 4e-07
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 1e-06
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 3e-05
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-05
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
 Score =  347 bits (892), Expect = e-111
 Identities = 88/323 (27%), Positives = 151/323 (46%), Gaps = 14/323 (4%)

Query: 504 QLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAIIPMRDAFSVPV 563
           + WV+ RR  +   R FG+G+++    + EE        +      G     +   +  V
Sbjct: 105 RGWVDHRRLAVNSFRYFGYGQKSFESKILEETKFFNDAIETY---KGRPFDFKQLITNAV 161

Query: 564 LNTLWSMLAGIRYSPEDKELKKIQSLLTELFANID-MVGALFSQFPILRYVAPEMSGYKS 622
            N    ++ G R++ ED + + +  L +E           L++ FP +  +      ++ 
Sbjct: 162 SNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPF--GKHQQ 219

Query: 623 FVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLKSE--DKTDTFSESQLLAICM 680
                  V+ FL   ++       P   +  +D YL  +     D + TFS+  L+    
Sbjct: 220 LFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVG 279

Query: 681 DMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRPHMPYLEAIT 740
           ++ +AG+ETT+  L +  L++ L+P++Q + Q EID ++G +  PS +D+  MPY EA+ 
Sbjct: 280 ELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVL 339

Query: 741 YESVRVFMGRT---FSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRP 797
           +E +R           I H    D  ++GY IPK T +I N   V  D+++W DPEVF P
Sbjct: 340 HEVLRF---CNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHP 396

Query: 798 ERFLNDKGAIQVPDQYLPFGAGR 820
           ERFL+  G     +  +PF  GR
Sbjct: 397 ERFLDSSGYFAKKEALVPFSLGR 419
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query820
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.97
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.95
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.95
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.9
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=5e-55  Score=494.29  Aligned_cols=424  Identities=26%  Similarity=0.431  Sum_probs=301.6

Q ss_pred             CCCCCCCCCcccccccchHHHhhhccccchhhHHHHHHHhhcCCeEEEEeCCceEEEecChHHHHHHhhhc--ccCCCCC
Q psy13734         29 KPRNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKE--EFDGRPR  106 (820)
Q Consensus        29 ~~~~~ppgP~~~PilGn~~~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvi~~~~~~~evl~~~--~~~~~~~  106 (820)
                      ++.++||||+++||+||++++..     ...+..+.+|+++|||||++++|+.++|+++||+++++||.++  .|++|+.
T Consensus         7 s~~kLPPGP~~lP~iGn~~~~~~-----~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~   81 (479)
T 3tbg_A            7 SKGKLPPGPLPLPGLGNLLHVDF-----QNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPP   81 (479)
T ss_dssp             --CCCCCCSCCBTTTBTGGGCCT-----TSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCC
T ss_pred             CCCCCCCCCCCcCcccchHhhcC-----CCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCc
Confidence            34579999999999999988642     2366788999999999999999999999999999999999874  4555554


Q ss_pred             CcccccccccccccccccchhhhhhhhhhhhhhhcccCCCCccccccCCCcccccccchhhhccccce-eccCchhHHHH
Q psy13734        107 GPFYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGL-LVTDEQLWVEQ  185 (820)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~-~~~~g~~W~~~  185 (820)
                      .+......++.                                                    ...|+ +..+|+.|+++
T Consensus        82 ~~~~~~~~~~~----------------------------------------------------~~~~~~~~~~g~~w~~~  109 (479)
T 3tbg_A           82 VPITQILGFGP----------------------------------------------------RSQGVFLARYGPAWREQ  109 (479)
T ss_dssp             CGGGGGGTCBT----------------------------------------------------TBCCSTTCCSSHHHHHH
T ss_pred             hHHHHHhccCC----------------------------------------------------CCCceeeCCCCHHHHHH
Confidence            33322221110                                                    01234 44569999999


Q ss_pred             HhHHHHHHhhcccChHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccCcchhhhhhHHHHHHHHHhCCCCCCCCHHHHHH
Q psy13734        186 RRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKI  265 (820)
Q Consensus       186 R~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~fg~~~~~~~~~~~~~  265 (820)
                      |+++.+.+.........+...+......+...+...      .+..+|+.+.+..+++|+++.++||.+++..+......
T Consensus       110 R~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~fg~~~~~~~~~~~~~  183 (479)
T 3tbg_A          110 RRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANH------SGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRL  183 (479)
T ss_dssp             HHHHHHHHHHTTSTTCHHHHHHHHHHHHHHHHHHTT------TTCCBCTHHHHHHHHHHHHHHHHHSCCCCTTCHHHHHH
T ss_pred             HHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHHhc------cCCcccHHHHHHHHHHHHHHHhhcCCcccccchhhhhh
Confidence            999999887766655567777777776666655432      35679999999999999999999999998777655544


Q ss_pred             HHHHHHHHhhhhh-hhhhhhcccccccccccccCcchhHHHHHHHHHHHHHHHHhhhhhcCC-CCCCcHHHHHHHHhc--
Q psy13734        266 QSLLTELFANIDM-VGALFSQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNP-DEMRDIMDVYLKTLK--  341 (820)
Q Consensus       266 ~~~~~~~~~~~~~-~~~~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~-~~~~d~l~~~l~~~~--  341 (820)
                      ............. ........|++.+++.   ..++.....+...+.+.+.++...+..+. ...+|.++.++....  
T Consensus       184 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~  260 (479)
T 3tbg_A          184 LDLAQEGLKEESGFLREVLNAVPVLLHIPA---LAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKA  260 (479)
T ss_dssp             HHHHHHHHHTTSSHHHHHHHHSGGGGGSHH---HHHHHTHHHHHHHHHHHHHHHHHHHHCCTTSCCCSHHHHHHHHHHHT
T ss_pred             hhhhhhhhhhhhhhhhhhhcccchhccchh---hHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccchhhhhhhhhhhhc
Confidence            4443332222111 1112223344433321   11222333444555556666555444332 335677776654422  


Q ss_pred             cCCCCCCcCHHHHHHHHHHHHhccchhhcccccc-------ccccchhHHHHHHHhhhcccccccccccccccChhHHHH
Q psy13734        342 SEDKTDTFSESQLLAICMDMFMAGSETTTTLPSR-------HVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAI  414 (820)
Q Consensus       342 ~~~~~~~l~~~~i~~~~~~~~~AG~dTTa~~l~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lpYl~av  414 (820)
                      ..+....++++++.+++.++++||+||||++++|       +|++|+++..+. ......  ......+++++||||+||
T Consensus       261 ~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei-~~~~~~--~~~~~~~~l~~lpyl~av  337 (479)
T 3tbg_A          261 KGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEI-DDVIGQ--VRRPEMGDQAHMPYTTAV  337 (479)
T ss_dssp             TTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH-HHHTCS--SSCCCHHHHTTCHHHHHH
T ss_pred             ccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHH-HHHHhh--ccccchhhhccccccccc
Confidence            2334457999999999999999999999998764       455555543332 211111  112345678999999999


Q ss_pred             HHHHhhcccccccccccccccCceecceeecCCcEEEecccccccCCcCCCCCCCcCCcccccCCCCccCCCccccCCCC
Q psy13734        415 TYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAG  494 (820)
Q Consensus       415 i~EtlRl~p~~~~~~~r~~~~d~~i~g~~IPkGt~V~~~~~~~~~d~~~~~dp~~F~PeR~~~~~~~~~~~~~~~~Fg~G  494 (820)
                      |+||||+||++|...+|.+.+|++++||.|||||.|+++.|++||||++|+||++|+||||++..+....+..|+|||.|
T Consensus       338 i~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G  417 (479)
T 3tbg_A          338 IHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAG  417 (479)
T ss_dssp             HHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCS
T ss_pred             eeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCCCCceecCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999877666677889999999


Q ss_pred             CCccccCCchhHHHHhHHHHHHhhhccc
Q psy13734        495 PDRLLVTDEQLWVEQRRFVLRQLREFGF  522 (820)
Q Consensus       495 ~r~~~~~~~~~w~~~Rr~~~~~l~~~~~  522 (820)
                      +|.|+ +..-++.+++-++...+.+|.+
T Consensus       418 ~R~C~-G~~lA~~e~~~~la~ll~~f~~  444 (479)
T 3tbg_A          418 RRACL-GEPLARMELFLFFTSLLQHFSF  444 (479)
T ss_dssp             TTSCT-THHHHHHHHHHHHHHHHHHEEE
T ss_pred             CcCCh-hHHHHHHHHHHHHHHHHHccEE
Confidence            99998 3445555555555555555543
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 820
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 8e-45
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-44
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-40
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-38
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-33
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-33
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-29
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 8e-22
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 6e-22
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 9e-19
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 9e-16
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-15
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-12
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-11
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-11
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 4e-09
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 7e-10
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 1e-07
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-09
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-09
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-08
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-08
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 8e-08
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 3e-08
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-07
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-08
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-05
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 3e-08
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-07
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 1e-06
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 1e-06
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 1e-05
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 5e-05
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-05
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 3e-05
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 7e-05
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-04
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-04
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 0.002
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 0.003
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 0.004
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 0.003
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  165 bits (419), Expect = 8e-45
 Identities = 94/329 (28%), Positives = 169/329 (51%), Gaps = 6/329 (1%)

Query: 494 GPDRLLVTDEQLWVEQRRFVLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQDGGAII 553
               ++  + + W   RRF L  +R+FG GKR++ + ++EEA  LV+  ++     GA++
Sbjct: 82  QGYGVIFANGERWRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKS---KGALL 138

Query: 554 PMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSLLTELFANIDMVGALFSQFPILRYV 613
                F     N + S++ G R+  +D    ++  L  + F+ I    +         ++
Sbjct: 139 DNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQV-FELFSGFL 197

Query: 614 APEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTLK--SEDKTDTFS 671
                 ++      Q++  F+   ++ H+ T +P   RD +DVYL  ++    D +  F 
Sbjct: 198 KHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFH 257

Query: 672 ESQLLAICMDMFMAGSETTSKSLGFGFLYLLLHPDVQKKAQAEIDRVVGRDRLPSLNDRP 731
              L+   + +F AG+ETTS +L +GFL +L +P V ++ Q EI++V+G  R P+L+DR 
Sbjct: 258 HQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRA 317

Query: 732 HMPYLEAITYESVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHD 791
            MPY +A+ +E  R+     F +PH   +DT  +GY IPK+T +    +  L D  ++  
Sbjct: 318 KMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFET 377

Query: 792 PEVFRPERFLNDKGAIQVPDQYLPFGAGR 820
           P  F P  FL+  GA++  + ++PF  G+
Sbjct: 378 PNTFNPGHFLDANGALKRNEGFMPFSLGK 406
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query820
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.98
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.98
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.97
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.97
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.97
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.97
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.97
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.97
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.97
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.96
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.96
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.96
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.96
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.95
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.95
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.95
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.94
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.94
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.92
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-50  Score=453.57  Aligned_cols=416  Identities=26%  Similarity=0.415  Sum_probs=284.6

Q ss_pred             CCCCCCCcccccccchHHHhhhccccchhhHHHHHHHhhcCCeEEEEeCCceEEEecChHHHHHHhhhcc--cCCCCCCc
Q psy13734         31 RNFPPGPDWIPILGSALAIQKLRNQTGYLYQACAELSKQYGPVVGLRVGKDRQVVCFGYPAIKEMLSKEE--FDGRPRGP  108 (820)
Q Consensus        31 ~~~ppgP~~~PilGn~~~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~g~~~~vvi~~~~~~~evl~~~~--~~~~~~~~  108 (820)
                      .++||||+++||+||++++..     ..++.++.+|+++|||||++++|+.++|+++||+++++|+.++.  |.+++...
T Consensus         2 ~~lPPGP~~~P~lG~~~~l~~-----~~~~~~~~~~~~kyG~i~~~~~g~~~~vvv~dpe~i~~il~~~~~~f~~r~~~~   76 (467)
T d1r9oa_           2 GKLPPGPTPLPVIGNILQIGI-----KDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFP   76 (467)
T ss_dssp             CBCCCCSSSCC-----CCBCH-----HHHHHHHHHHHHHHCSEEEEESSSCEEEEECSHHHHHHHHTTTTTTTCEECCCS
T ss_pred             CCCCcCCCCCCccccHHHhCC-----cCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCCcccCCCCcch
Confidence            468999999999999987632     23778899999999999999999999999999999999998742  32222111


Q ss_pred             ccccccccccccccccchhhhhhhhhhhhhhhcccCCCCccccccCCCcccccccchhhhccccceeccCchhHHHHHhH
Q psy13734        109 FYETRTWGKRQGLMEGTVTAKVLSSLKRREKEDRIGESQPFRERAGIKPVTALGYKVDVLLSKAGLLVTDEQLWVEQRRF  188 (820)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~g~~W~~~R~~  188 (820)
                      ...                                                       ....+.|+++++|+.|+.+|++
T Consensus        77 ~~~-------------------------------------------------------~~~~g~~l~~~~g~~~~~~R~~  101 (467)
T d1r9oa_          77 LAE-------------------------------------------------------RANRGFGIVFSNGKKWKEIRRF  101 (467)
T ss_dssp             CCC-------------------------------------------------------TTTCTTSSTTCCHHHHHHHHHH
T ss_pred             hhh-------------------------------------------------------hcCCCCceeeCCChHHHHHHHH
Confidence            100                                                       0112347899999999999999


Q ss_pred             HHHHHhhcccChHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccCcchhhhhhHHHHHHHHHhCCCCCCCCHHHHHHHHH
Q psy13734        189 VLRQLREFGFGKRTMAQLVEEEAYQLVQLFKQEVQHLSLPGAIIPMRDAFSVPVLNTLWSMLAGIRYSPEDKELKKIQSL  268 (820)
Q Consensus       189 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~fg~~~~~~~~~~~~~~~~  268 (820)
                      +.+.+.........+...+..........+..      ..+.++|+...+..+++++++.+++|.++...+.........
T Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~d~~~~~~~~~~~~i~~~~~g~~~~~~~~~~~~~~~~  175 (467)
T d1r9oa_         102 SLMTLRNFGMGKRSIEDRVQEEARCLVEELRK------TKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEK  175 (467)
T ss_dssp             HHHHHTTSSSCSSCHHHHHHHHHHHHHHHHHT------TTTSCBCTHHHHHHHHHHHHHHHHHSCCCCTTCHHHHHHHHH
T ss_pred             HHHHhhccccchhHHHHHHHHHHHHHHHHHHh------hccccccHHHHHHHHHhhhhhhhcccccchhhhhhHHHHHHH
Confidence            99988765554444555555555554444432      136789999999999999999999999988766544433333


Q ss_pred             HHHHHhhhhhh-hhhh-hcccccccccccccCcchhHHHHHHHHHHHHHHHHhhhhhcCCCCCCcHHHHHHHHh--ccCC
Q psy13734        269 LTELFANIDMV-GALF-SQFPILRYVAPEMSGYKSFVSIHQKVWKFLRNELDNHKETFNPDEMRDIMDVYLKTL--KSED  344 (820)
Q Consensus       269 ~~~~~~~~~~~-~~~~-~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~l~~~l~~~--~~~~  344 (820)
                      ....+...... .... ...|+..+++   ...+...+....+.+++.+.++++.+....+...|.++.+....  ....
T Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~~~~~~~~~~~~~~~  252 (467)
T d1r9oa_         176 LNENIKILSSPWIQICNNFSPIIDYFP---GTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHN  252 (467)
T ss_dssp             HHHHHHHHTCCBC-------CCCSCCT---TCHHHHHHHHHHHHHHHHHHHHHHHHTCCTTCCCSHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHhhchhhhhhhhhhhhhhcCc---hhHHHHHHHHHHHHHHHHHHHHHHHHhhccccchhhhhhhhhhhhhhhcc
Confidence            22222211110 0111 1122222222   11233445566677777777777766555555566666554332  2233


Q ss_pred             CCCCcCHHHHHHHHHHHHhccchhhcccccc-------ccccchhHHHHHHHhhhcccccccccccccccChhHHHHHHH
Q psy13734        345 KTDTFSESQLLAICMDMFMAGSETTTTLPSR-------HVNSHDMIVCFYLNRYLTSSMYTRSRRSLVQTLPYLEAITYE  417 (820)
Q Consensus       345 ~~~~l~~~~i~~~~~~~~~AG~dTTa~~l~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lpYl~avi~E  417 (820)
                      .+..++++++.++++++++||+||||++++|       ++++++++..+. ......  ......+++++||||+|||+|
T Consensus       253 ~~~~~~~~~i~~~~~~~~~Ag~dTTa~~l~~~l~~L~~~p~~~~~l~~Ei-~~~~~~--~~~~~~~~~~~l~yL~a~i~E  329 (467)
T d1r9oa_         253 QPSEFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEI-ERVIGR--NRSPCMQDRSHMPYTDAVVHE  329 (467)
T ss_dssp             CSCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH-HHHTCS--SSCCCGGGGGGCHHHHHHHHH
T ss_pred             CCcccchhHHHHHHHHHHHcccccchhHHHHHHHHhhcCchHHHHHHhhh-hhhcCC--CCCCcHHHhhhhhhhhhhccc
Confidence            4456899999999999999999999997764       444444433321 111111  112345678999999999999


Q ss_pred             HhhcccccccccccccccCceecceeecCCcEEEecccccccCCcCCCCCCCcCCcccccCCCCccCCCccccCCCCCCc
Q psy13734        418 SVRVFMGRTFSIPHRALRDTTLQGYFIPKDTMIIANFNGVLMDKEFWHDPEVFRPERFLNDKGAIQVPDQYLPFGAGPDR  497 (820)
Q Consensus       418 tlRl~p~~~~~~~r~~~~d~~i~g~~IPkGt~V~~~~~~~~~d~~~~~dp~~F~PeR~~~~~~~~~~~~~~~~Fg~G~r~  497 (820)
                      ||||||+++....+.+.+|++++||.|||||.|+++.+++||||++|+||++|+||||+++......+..|+|||.|+|.
T Consensus       330 ~lRl~p~~~~~~r~~~~~~~~~~g~~ip~gt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~pFg~G~r~  409 (467)
T d1r9oa_         330 VQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRI  409 (467)
T ss_dssp             HHHHHTSSTTCSCEECSSCEEETTEEECTTCEEEECSHHHHTCTTTSSSTTSCCGGGGBCTTSCBCCCTTCCTTCCGGGS
T ss_pred             cccccccCCcccccccccccccceeEEecCCccccchhhhcCCcccCcCcceeCccccCCCCCCcCCCCCcccCCCCCcC
Confidence            99999999987666678899999999999999999999999999999999999999999877666677889999999999


Q ss_pred             cccCCchhHHHHhHHHHHHhhh
Q psy13734        498 LLVTDEQLWVEQRRFVLRQLRE  519 (820)
Q Consensus       498 ~~~~~~~~w~~~Rr~~~~~l~~  519 (820)
                      |+. ..-+..+++-++...+..
T Consensus       410 C~G-~~~A~~e~~~~la~ll~~  430 (467)
T d1r9oa_         410 CVG-EALAGMELFLFLTSILQN  430 (467)
T ss_dssp             CTT-HHHHHHHHHHHHHHHHHH
T ss_pred             ChH-HHHHHHHHHHHHHHHHHh
Confidence            982 333333444444433333
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure