Psyllid ID: psy13737


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------139
IRWTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNK
cccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHHcccccHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccc
cHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHcHcccHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccEcccccEHHHHHHHcccHHHHHHHHHcccccccccc
irwthywklhkvTKYSQKVINTinpfgshfqhnitpLHVAAKWGKANMVTLLLSrganidnktrdgLTALHCAARSGHEAVIEMLLEqgapissktkvrgFYILRSGHEAVIEMLLEqgapisskTKVAAVLLEngasltsttkkgftplhltgkyGHIKVAKLLlqkdapvdfqgkapvddvTVDYLTALHVAAHCGHARVAKTLldkkadpnaralngftplhiaCKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHgasieattevrepmlhiACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRlatcdvlpqcetrlnfsnlrvreqqtPLHIASRLGNVDIVMLLLQhgaavdstTKDLYTALHIAAKEGQEEVAAVLLENgasltsttkkgftplhltgkyGHIKVAKLLlqkdapvdfqgkngvtplhvasHYDHQNVALLLLEKGASMDIATTLLEygakpnaesvagftplhlsasegHADMSAMLLEHGadvshaakngltplhlcaqEDRVGVAELLLKnnaqvdtptkkgftplhiaCHYGQISMARLLLDqsanvtvpknfpsrpigilfilfpfiigytnttdqgftplhhsaqQGHSTIVALLLdrgaspnatnkgftplhhsaqQGHSTIVALLLdrgaspnatnktrgftplhiACHYGQISMARLLLDqsanvscttdqgftplhhsaqQGHSTIVALLLdrgaspnatnk
irwthywklhkvtkYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEqgapissktkVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGasltsttkkgftplhLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALngftplhiacKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhiACKKNRIKVVELLLKHGAsieattevrepmlhIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGasltsttkkgftplhLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNK
IRWTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRpigilfilfpfiigYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNK
**WTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLH************MLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDR*********************HSTIVALLLDRGA***ATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLL***********
IRWTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGASP*****
IRWTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRG********
IRWTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGA*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IRWTHYWKLHKVTKYSQKVINTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHEAVIEMLLEQGAPISSKTKVRGFYILRSGHEAVIEMLLEQGAPISSKTKVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKAPVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNKGFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1388 2.2.26 [Sep-21-2011]
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.539 0.189 0.406 1e-141
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.528 0.374 0.394 1e-140
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.529 0.167 0.396 1e-140
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.539 0.192 0.403 1e-139
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.528 0.390 0.367 1e-124
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.528 0.394 0.365 1e-121
Q4UMH61179 Putative ankyrin repeat p yes N/A 0.386 0.454 0.320 2e-77
Q5ZLC81073 Serine/threonine-protein no N/A 0.672 0.870 0.273 4e-70
Q9H2K2 1166 Tankyrase-2 OS=Homo sapie no N/A 0.505 0.602 0.303 1e-69
Q502K31071 Serine/threonine-protein no N/A 0.648 0.840 0.268 3e-68
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function desciption
 Score =  503 bits (1296), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 333/820 (40%), Positives = 463/820 (56%), Gaps = 71/820 (8%)

Query: 520  MLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEAT 579
             L  A   N  KVVE L K G  I    +     LH+A K+  + +V+ LL  G+S+++ 
Sbjct: 35   FLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSA 93

Query: 580  TEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHG 639
            T+     LHIA    + +VV++L+K GA+I A ++     L++A ++N I VV+ LL++G
Sbjct: 94   TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENG 153

Query: 640  ASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVE 699
            A+    TE     L +A ++   + V +LL++    +   +VR P LHIA +K+  K   
Sbjct: 154  ANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAA 209

Query: 700  LLLK--HGASIEA------TTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPM 751
            LLL+  H A +++      TTE     LHIA     + V  LLL  GA+++ T       
Sbjct: 210  LLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 269

Query: 752  LHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATT 811
            LH+A K+    +V+LLL  G  I+A T      LH A +    +VVELLL+ GA + A T
Sbjct: 270  LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLART 329

Query: 812  EVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGA 871
            +     LH+A + + ++ V+ LL+H A ++  T      LH+A      +V +LLL   A
Sbjct: 330  KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRA 389

Query: 872  SIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVEL 931
            +  A        LHIACKKNRIKV+ELL+K+GASI+A TE     +H+A     + +V L
Sbjct: 390  NPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLL 449

Query: 932  LLKHGASSHVVSCYSNVKVHVSLNKIQ-DVSSSILRLATCDVLPQCETRLNFSNLRVREQ 990
            LL++GAS  V +      +H++    Q +V   +LR                 + R RE+
Sbjct: 450  LLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGA------------LVDARAREE 497

Query: 991  QTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLT 1050
            QTPLHIASRLG  +IV LLLQH A  D+ T + YT LHI+A+EGQ +VA+VLLE GA+ +
Sbjct: 498  QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHS 557

Query: 1051 STTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLE 1110
              TKKGFTPLH+  KYG + VAKLLLQ+ A  D  GKNG+TPLHVA+HYD+Q VALLLLE
Sbjct: 558  LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLE 617

Query: 1111 KGAS--------------------MDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADM 1150
            KGAS                    M IA+TLL YGA+ N  +  G TPLHL++ EGH DM
Sbjct: 618  KGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDM 677

Query: 1151 SAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACH 1210
              +LL+ GA++  + K+GLT LHL AQED+V VA++L K+ A  D  TK G+TPL +ACH
Sbjct: 678  VTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACH 737

Query: 1211 YGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGH 1270
            YG + M   LL Q ANV                           T  G+TPLH +AQQGH
Sbjct: 738  YGNVKMVNFLLKQGANVNA------------------------KTKNGYTPLHQAAQQGH 773

Query: 1271 STIVALLLDRGASPNATN-KGFTPLHHSAQQGHSTIVALL 1309
            + I+ +LL  GA PNAT   G T L  + + G+ ++V  L
Sbjct: 774  THIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813




Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes. Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.
Homo sapiens (taxid: 9606)
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1388
123507472 1489 ankyrin repeat protein [Trichomonas vagi 0.930 0.867 0.318 0.0
189235951 1719 PREDICTED: similar to ankyrin 2,3/unc44 0.499 0.403 0.470 1e-172
3227788091346 hypothetical protein SINV_06859 [Solenop 0.537 0.554 0.456 1e-172
383847150874 PREDICTED: ankyrin-2 [Megachile rotundat 0.528 0.839 0.457 1e-172
350425715 4893 PREDICTED: hypothetical protein LOC10074 0.532 0.151 0.457 1e-171
270004488 1582 hypothetical protein TcasGA2_TC003843 [T 0.535 0.469 0.447 1e-169
189235752 2692 PREDICTED: similar to ankyrin 2,3/unc44 0.535 0.276 0.447 1e-169
270004596 7005 hypothetical protein TcasGA2_TC003960 [T 0.498 0.098 0.470 1e-168
195442774 1516 GK24225 [Drosophila willistoni] gi|19416 0.515 0.472 0.465 1e-168
195019882 1546 GH16856 [Drosophila grimshawi] gi|193898 0.549 0.493 0.446 1e-167
>gi|123507472|ref|XP_001329422.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121912377|gb|EAY17199.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1395 (31%), Positives = 666/1395 (47%), Gaps = 103/1395 (7%)

Query: 20   INTINPFGSHFQHNITPLHVAAKWGKANMVTLLLSRGANIDNKTRDGLTALHCAARSGHE 79
            IN  + +G+      T L +AA+      V LL+S GANI+ K  DG TALH AARS  +
Sbjct: 150  INEKDKYGA------TALRIAAENNSKETVELLISHGANINEKDNDGQTALHYAARSNSK 203

Query: 80   AVIEMLLEQGAPISSKTKVRG---FYILRSGHEAVIEMLLEQGAPISSKTKVAA------ 130
              IE L+  GA I+ K         Y  RS  +  +E+L+  GA I+ K K  A      
Sbjct: 204  EYIEFLISHGANINEKDNDGATVLHYAARSNRKETVELLISHGANINEKDKNGATVLHYA 263

Query: 131  ----------VLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPV---DFQGK 177
                      +L+ +GA++      G T L    +    +  +LL+   A +   D  G+
Sbjct: 264  ASNNRKETVELLISHGANINEKDNDGQTVLPYAARSNSKETVELLISHGANINEKDNNGQ 323

Query: 178  APVDDVTVDYLTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVE 237
                       TALH AA        + L+   A+ N +  NG T LHIA + N  + +E
Sbjct: 324  -----------TALHYAARSNSKEYIEFLISHGANINEKDNNGATALHIAARSNSKEYIE 372

Query: 238  LLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKN 297
             L+ HGA+I       + +LH A + N  + VELL+ HGA+I    +     L  A   N
Sbjct: 373  FLISHGANINEKDNDGQTVLHYAAENNSKETVELLISHGANINEKDKYGTTALPYAASNN 432

Query: 298  RIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLH 357
            R + VELL+ HGA+I    +    +LH A + N  + +E L+ HGA+I       + +LH
Sbjct: 433  RKETVELLISHGANINEKDKNGATVLHYAAEYNSKEYIEFLISHGANINEKDNDGQTVLH 492

Query: 358  IACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEV 417
             A   NR + VELL+ HGA+I    +     LH A + N  + VELL+ HGA+I      
Sbjct: 493  YATSNNRKETVELLISHGANINEKDKYGTTALHYAAENNSKETVELLISHGANINEKDND 552

Query: 418  REPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASI 477
             + +L  A + NR + VELL+ HGA+I    +    +LH A + N  + +E L+ HGA+I
Sbjct: 553  GQTVLPYAARSNRKETVELLISHGANINEKDKNGATVLHYAAEYNSKEYIEFLISHGANI 612

Query: 478  EATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLL 537
                      L IA + N  + VELL+ HGA+I    +    +LH A   NR + VELL+
Sbjct: 613  NEKDNNGATALRIAARSNSKETVELLISHGANINEKNKNGTTVLHYAASNNRKETVELLI 672

Query: 538  KHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIK 597
             HGA+I          L IA + N  + VELL+ HGA+I    +    +LH A   NR +
Sbjct: 673  SHGANINEKDNNGATALRIAARSNSKETVELLISHGANINEKDKYGTTVLHYAASNNRKE 732

Query: 598  VVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIAC 657
             V LL+ HGA+I       +  LH A + N  + VELL+ HGA+I       +  LH A 
Sbjct: 733  TVALLISHGANINEKDNDGQTALHYAAENNSKETVELLISHGANINEKDNDGQTALHYAA 792

Query: 658  KKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREP 717
            + N  + VELL+ HGA+I       +  LH A + N  + VELL+ HGA+I    +    
Sbjct: 793  ENNSKETVELLISHGANINEKDNDGQTALHYAARANSKETVELLISHGANINEKDKNGAT 852

Query: 718  MLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEAT 777
            +LH A   NR + VELL+ HGA+I    +    +LH A + NR + VELL+ HGA+I   
Sbjct: 853  VLHYAASNNRKETVELLISHGANINEKDKNGATVLHYAARSNRKETVELLISHGANINEK 912

Query: 778  TEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHG 837
             +     L IA + N  + VELL+ HGA+I    E  +  LH A + NR + VELL+ HG
Sbjct: 913  DKYGATALRIAAENNSKETVELLISHGANINEKDEYGQTALHYAARSNRKETVELLISHG 972

Query: 838  ASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVE 897
            A+I       + +LH A +    +  E L+ HGA+I       +  LH A + N  + VE
Sbjct: 973  ANINEKDNDGQTVLHYATRFKSKETAEFLISHGANINEKDNDGQTALHYAAENNSKETVE 1032

Query: 898  LLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKI 957
            LL+ HGA+I    E  + +LH A + N  + VELL+ HGA+               +N+ 
Sbjct: 1033 LLISHGANINEKDEYGQTVLHYAAENNSKETVELLISHGAN---------------INEK 1077

Query: 958  QDVSSSILRLA-------TCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLL 1010
             +   ++L  A       T ++L      +N    +    QT LH A+R  + + +  L+
Sbjct: 1078 DEYGQTVLPYAARSNSKETVELLISHGANIN---EKDNNGQTALHYAARSNSKEYIEFLI 1134

Query: 1011 QHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIK 1070
             HGA ++    +  TAL IAA+   +E    L+ +GA++    K G T LH   +    +
Sbjct: 1135 SHGANINEKDNNGATALRIAARSNSKEYIEFLISHGANINEKDKYGTTALHYAAENNSKE 1194

Query: 1071 VAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNA 1130
              +LL+   A ++ + KNG T LH A+  + +    LL+  GA++             N 
Sbjct: 1195 TVELLISHGANINEKNKNGTTVLHYAASNNRKETVELLISHGANI-------------NE 1241

Query: 1131 ESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKN 1190
            ++  G T LH +AS    +   +L+ HGA+++    +G T LH  A  +     ELL+ +
Sbjct: 1242 KNKNGATILHYAASNNSKETVELLISHGANINEKDNDGATVLHYAASNNSKETVELLISH 1301

Query: 1191 NAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRPIGILFILFPFIIG 1250
             A ++     G T LH A    +     LL+   AN+    N                  
Sbjct: 1302 GANINEKDNDGQTALHYAAENNRKETVELLISHGANINEKDN------------------ 1343

Query: 1251 YTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNA-TNKGFTPLHHSAQQGHSTIVALL 1309
                   G T LH++A+      V LL+  GA+ N   N G T LH++A+      +  L
Sbjct: 1344 ------DGQTALHYAAENNRKETVELLISHGANINEKDNDGQTALHYAARSNSKEYIEFL 1397

Query: 1310 LDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGH 1369
            +  GA+ N  +   G T LHIA           L+   AN++   + G T LH++A+   
Sbjct: 1398 ISHGANINEKD-NNGATALHIAARSNSKEYIEFLISHGANINEKDNDGQTVLHYAAENNS 1456

Query: 1370 STIVALLLDRGASPN 1384
               V LL+  GA+ N
Sbjct: 1457 KETVELLISHGANIN 1471




Source: Trichomonas vaginalis G3

Species: Trichomonas vaginalis

Genus: Trichomonas

Family: Trichomonadidae

Order: Trichomonadida

Class:

Phylum:

Superkingdom: Eukaryota

>gi|189235951|ref|XP_001809144.1| PREDICTED: similar to ankyrin 2,3/unc44 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322778809|gb|EFZ09225.1| hypothetical protein SINV_06859 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383847150|ref|XP_003699218.1| PREDICTED: ankyrin-2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350425715|ref|XP_003494210.1| PREDICTED: hypothetical protein LOC100742486, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|270004488|gb|EFA00936.1| hypothetical protein TcasGA2_TC003843 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189235752|ref|XP_001807645.1| PREDICTED: similar to ankyrin 2,3/unc44 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270004596|gb|EFA01044.1| hypothetical protein TcasGA2_TC003960 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195442774|ref|XP_002069121.1| GK24225 [Drosophila willistoni] gi|194165206|gb|EDW80107.1| GK24225 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195019882|ref|XP_001985075.1| GH16856 [Drosophila grimshawi] gi|193898557|gb|EDV97423.1| GH16856 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1388
UNIPROTKB|F1NNX8 1737 ANK3 "Uncharacterized protein" 0.535 0.427 0.377 7.4e-124
UNIPROTKB|F1NNX6 1824 ANK3 "Uncharacterized protein" 0.535 0.407 0.377 1.5e-123
UNIPROTKB|F1NNX7 1915 ANK3 "Uncharacterized protein" 0.535 0.387 0.377 2.4e-123
UNIPROTKB|F1NA51 2890 ANK3 "Uncharacterized protein" 0.535 0.257 0.377 1.1e-122
UNIPROTKB|F1PJ90 1782 ANK3 "Uncharacterized protein" 0.536 0.418 0.372 4e-122
UNIPROTKB|K7GLA8 1847 ANK3 "Uncharacterized protein" 0.536 0.403 0.372 5.8e-122
ZFIN|ZDB-GENE-060621-2 3888 ank3b "ankyrin 3b" [Danio reri 0.551 0.196 0.378 1.1e-121
UNIPROTKB|J9NTH2 2063 ANK2 "Uncharacterized protein" 0.559 0.376 0.379 1.9e-121
UNIPROTKB|F1M9N9 3898 Ank2 "Protein Ank2" [Rattus no 0.559 0.199 0.380 2.8e-121
UNIPROTKB|F1LM42 3927 Ank2 "Protein Ank2" [Rattus no 0.559 0.197 0.380 2.9e-121
UNIPROTKB|F1NNX8 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1221 (434.9 bits), Expect = 7.4e-124, P = 7.4e-124
 Identities = 296/785 (37%), Positives = 443/785 (56%)

Query:   537 LKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRI 596
             LK G  I  + +     LH+A K+  ++VV  L++ GAS++A T+     LHIA    + 
Sbjct:    19 LKSGVDINISNQNGLNALHLASKEGHVEVVSELIQRGASVDAATKKGNTALHIASLAGQA 78

Query:   597 KVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIA 656
             +VV++L+ + A++ A ++     L++A ++N ++VV+ LL +GAS    TE     L +A
Sbjct:    79 EVVKVLVTNRANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA 138

Query:   657 CKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLK--HGASIEATTEV 714
              ++   +VV LLL++    +   +VR P LHIA +K+  K   LLL+  H A +E+ +  
Sbjct:   139 LQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGF 194

Query:   715 REPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASI 774
               P LHIA     I V  LLL  GA+++ T       LH+A K+    +V+LLL  GA I
Sbjct:   195 T-P-LHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKI 252

Query:   775 EATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLL 834
             +A T      LH   +    +VVE+LL  GA I + T+     LH+A + + +  V+LL+
Sbjct:   253 DAKTRDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLI 312

Query:   835 KHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIK 894
             +H   ++  T      LH+A      KV ++LL   A+  A        LHIACKKNRIK
Sbjct:   313 QHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIK 372

Query:   895 VVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSL 954
             V+ELLLKHGASI+A TE     +H+A     + +V  L+ HGAS +  +      +H++ 
Sbjct:   373 VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAA 432

Query:   955 NKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGA 1014
                Q   + ++R      L Q   ++     + ++ QTPLHI++RLG  DIV  LLQ GA
Sbjct:   433 RAGQ---TEVVRY-----LVQNGAQVE---AKAKDDQTPLHISARLGKADIVQQLLQQGA 481

Query:  1015 AVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKL 1074
             + ++ T   YT LH++A+EG E+VA+VLLE+GASL   TKKGFTPLH+  KYG I+VA L
Sbjct:   482 SPNAATTSGYTPLHLSAREGHEDVASVLLEHGASLAIITKKGFTPLHVAAKYGKIEVANL 541

Query:  1075 LLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVA 1134
             LLQK+A  D  GK+G+TPLHVA+HYD+Q VALLLL++GAS             P+A +  
Sbjct:   542 LLQKNASPDASGKSGLTPLHVAAHYDNQKVALLLLDQGAS-------------PHASAKN 588

Query:  1135 GFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQV 1194
             G+TPLH++A +   D++  LLE+GAD +   + G+ P+HL +Q+  V +  LLL  NA V
Sbjct:   589 GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIAPVHLASQDGHVDMVSLLLTRNANV 648

Query:  1195 DTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNF---PSRXXXXXXXXXXXXXXY 1251
             +   K G TPLH+A    ++++A +L++Q A V         P                 
Sbjct:   649 NLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAAVDAQTKMGYTPLHVGCHYGNIKIVNFLL 708

Query:  1252 TNT------TDQGFTPLHHSAQQGHSTIVALLLDRGASPNA-TNKGFTPLHHSAQQGHST 1304
              ++      T  G+TPLH +AQQGH+ I+ +LL  GA+PN  T  G T L  + + G+ +
Sbjct:   709 QHSAKINAKTKNGYTPLHQAAQQGHTHIINVLLQHGAAPNELTVNGNTALAIAKRLGYIS 768

Query:  1305 IVALL 1309
             +V  L
Sbjct:   769 VVDTL 773


GO:0007165 "signal transduction" evidence=IEA
UNIPROTKB|F1NNX6 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX7 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA51 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJ90 ANK3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLA8 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060621-2 ank3b "ankyrin 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTH2 ANK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9N9 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM42 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1388
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-35
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-34
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-34
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-30
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-30
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-28
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-28
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-28
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-27
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-27
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-27
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-27
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-27
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 9e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-26
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-26
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-26
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-26
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-25
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-25
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-24
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-24
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-24
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-24
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-24
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-24
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-24
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-24
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-24
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-23
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-22
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-22
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-22
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-22
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-22
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-22
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-21
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-21
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-20
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-19
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-19
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-19
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-19
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-19
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-19
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-19
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-18
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-18
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-18
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-18
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-18
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-17
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-17
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-16
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-16
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-16
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-15
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-15
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-15
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-15
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-14
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-14
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-13
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-13
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-13
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-13
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-11
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 6e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-09
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-08
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 5e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 4e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-07
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 7e-07
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 7e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 2e-06
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 2e-06
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 2e-06
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 2e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 3e-06
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 4e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 4e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 4e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 4e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 6e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-06
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 6e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 7e-06
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 8e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-06
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 8e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
smart0024830 smart00248, ANK, ankyrin repeats 1e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 2e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 5e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 5e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 5e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 5e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 7e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 8e-05
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 8e-05
PHA02791284 PHA02791, PHA02791, ankyrin-like protein; Provisio 8e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 9e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-04
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-04
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 1e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 2e-04
PHA02884 300 PHA02884, PHA02884, ankyrin repeat protein; Provis 2e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 4e-04
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 6e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 0.002
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.002
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.003
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.004
smart0024830 smart00248, ANK, ankyrin repeats 0.004
smart0024830 smart00248, ANK, ankyrin repeats 0.004
smart0024830 smart00248, ANK, ankyrin repeats 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  129 bits (325), Expect = 9e-35
 Identities = 58/123 (47%), Positives = 77/123 (62%), Gaps = 2/123 (1%)

Query: 1256 DQGFTPLHHSAQQGHSTIVALLLDRGASPNATNK-GFTPLHHSAQQGHSTIVALLLDRGA 1314
            + G TPLH +A  GH  +V LLL+ GA  NA +  G TPLH +A+ GH  IV LLL++GA
Sbjct: 5    EDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGA 64

Query: 1315 SPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVA 1374
              NA +K  G TPLH+A   G + + +LLL   A+V+     G TPLH +A+ GH  +V 
Sbjct: 65   DVNARDK-DGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVK 123

Query: 1375 LLL 1377
            LLL
Sbjct: 124  LLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1388
KOG4177|consensus 1143 100.0
KOG4177|consensus1143 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG4369|consensus 2131 100.0
KOG0508|consensus615 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG4369|consensus 2131 100.0
KOG4412|consensus226 100.0
KOG4412|consensus226 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG0509|consensus 600 100.0
KOG0509|consensus 600 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
KOG0502|consensus296 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG0502|consensus296 99.94
KOG0507|consensus 854 99.92
KOG0507|consensus 854 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0505|consensus527 99.89
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG0505|consensus 527 99.88
KOG0514|consensus452 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0514|consensus452 99.85
PHA02736154 Viral ankyrin protein; Provisional 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02741169 hypothetical protein; Provisional 99.83
PHA02884 300 ankyrin repeat protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.8
KOG0512|consensus228 99.8
PHA02741169 hypothetical protein; Provisional 99.79
KOG0512|consensus228 99.78
KOG0195|consensus 448 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
KOG3676|consensus 782 99.71
KOG0195|consensus 448 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.65
KOG3676|consensus 782 99.65
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.57
KOG4214|consensus117 99.56
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.55
KOG4214|consensus117 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.44
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.39
KOG1710|consensus 396 99.39
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.37
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.33
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.32
KOG1710|consensus 396 99.3
KOG0515|consensus752 99.29
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.28
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.26
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.22
KOG0515|consensus752 99.17
KOG0818|consensus 669 98.91
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.83
PF1360630 Ank_3: Ankyrin repeat 98.81
KOG0506|consensus622 98.75
PF1360630 Ank_3: Ankyrin repeat 98.68
KOG0818|consensus 669 98.65
KOG0783|consensus 1267 98.64
KOG0705|consensus749 98.62
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.62
KOG0506|consensus622 98.54
KOG0783|consensus 1267 98.49
KOG0511|consensus516 98.42
KOG0782|consensus1004 98.42
KOG0522|consensus 560 98.32
KOG0782|consensus1004 98.3
KOG0705|consensus749 98.15
KOG0522|consensus 560 98.13
KOG0511|consensus516 98.06
KOG3609|consensus 822 97.96
KOG3609|consensus 822 97.94
KOG2384|consensus223 97.92
KOG0520|consensus 975 97.85
KOG0521|consensus785 97.84
KOG2384|consensus223 97.83
KOG0521|consensus785 97.82
KOG0520|consensus 975 97.73
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.65
KOG2505|consensus591 96.6
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.6
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.18
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.08
KOG2505|consensus591 95.93
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.49
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.2
PLN03077857 Protein ECB2; Provisional 93.84
PLN03077857 Protein ECB2; Provisional 93.4
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.93
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.02
PLN032181060 maturation of RBCL 1; Provisional 89.66
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 88.78
PLN032181060 maturation of RBCL 1; Provisional 88.73
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=2.9e-70  Score=652.28  Aligned_cols=741  Identities=35%  Similarity=0.470  Sum_probs=631.5

Q ss_pred             CCCHHHHHHHcChHHHHHHHHhcCCCcccccCCCCCHHHHHHhcCCHHHHHHHHhCCCCcccccCCCccHHHHHHhcChH
Q psy13737        418 REPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRI  497 (1388)
Q Consensus       418 ~~~~l~~A~~~~~~~iv~~L~~~g~~~~~~~~~~~~~l~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~  497 (1388)
                      ...+|+.|+++|+.+.++.|+++....+.....+.+|+|+|+-.|+.++.++|++.|+.++.....+.+++|.|+..++.
T Consensus        21 ~~~~l~~a~r~~~~~~~~~l~~~e~~~~~~sk~~~~pl~~aa~~~~~~v~~~ll~~~a~v~~~~~~~~~plh~a~~~~~a  100 (1143)
T KOG4177|consen   21 RLPALHIAARNDDTNAAKLLLQNEHNADVDSKSGFTPLHIAAHYGNENVAELLLNRGAIVNATARNGITPLHVASKRGDA  100 (1143)
T ss_pred             cchHHHHHHhccchhhcccccccccccchhcccccCHHHHHhhhhhhhhhhhhhccccccCcccccCccHHHHHHhhcch
Confidence            34567777777777777777776555555555677888888888888888888888888888887788888888888888


Q ss_pred             HHHHHHHhcCCCcccccccCcchhHHHHhhCcHHHHHHHHHcCCcccccCCCCCcHHHHHHHcCcHHHHHHHHhcCCCcc
Q psy13737        498 KVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIE  577 (1388)
Q Consensus       498 ~iv~~Ll~~~~~~~~~~~~~~~~l~~A~~~g~~~~v~~L~~~g~~~~~~~~~~~~~L~~A~~~g~~~iv~~Ll~~g~~~~  577 (1388)
                      ++++.|+..|+.++..+..+.||||.|+..|+.+++++|+..+++++.+++.|.+|+++|+.   ..-+.++.++..   
T Consensus       101 ~~v~~ll~~ga~~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~~~k~~~g~t~l~~a~~---~~~~~ll~~~~~---  174 (1143)
T KOG4177|consen  101 EMVKLLLCRGAQIDARDRDGLTPLHCAARKGHVQVIELLLQHGAPINIKTKNGLSPLHMAAQ---VACARLLLEYKA---  174 (1143)
T ss_pred             hHHHHHHhccCchhhcccCCCcchhhhcccccHHHHHHHHHccCCCcccccCCCCchhhhcc---hhhhHHhhhccc---
Confidence            88888888888888899999999999999999999999999999999999999999999888   677777777644   


Q ss_pred             ccCCCCccHHHHHHHhCCHHHHHHHHhCCCCccccCCCCCChHHHHHhcCcHHHHHHHHHcCCCccccCCCCCCHHHHHH
Q psy13737        578 ATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIAC  657 (1388)
Q Consensus       578 ~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~~~L~~A~  657 (1388)
                         .+-. +++.+...++.++++.++...++.+..+..+.||+|.|+..+.++++++++.+|+++...+..+-+|||.|+
T Consensus       175 ---~d~l-~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~nri~~~eLll~~gadv~a~d~~gl~~lh~a~  250 (1143)
T KOG4177|consen  175 ---PDYL-RLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKKNRIKVVELLLKHGADVSAKDESGLTPLHVAA  250 (1143)
T ss_pred             ---chhh-hhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccccccceeeeeeeccCcCCcccccCccHHHHHH
Confidence               2223 678899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCcHHHHHHHHhcCCCccCCCCCCccHHHHHHHcCChHHHHHHHHcCCCccccccCCccHHHHHHhcChHHHHHHHHHc
Q psy13737        658 KKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKH  737 (1388)
Q Consensus       658 ~~g~~~~~~~Ll~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~  737 (1388)
                      ..|+.+++.+++.+|+.++..+..+.||+|.|+..+..++.++|++.|+++...+....||+|.|...|..++++++++.
T Consensus       251 ~~g~~~i~~~l~~~ga~~~~~~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~~~~~kt~l~~a~~~g~~~i~~~~l~~  330 (1143)
T KOG4177|consen  251 FMGHLDIVKLLLQHGASVNVSTVRGETPLHMAARAGQVEVCKLLLQNGADVLAKARDDQTPLHIASRLGHEEIVHLLLQA  330 (1143)
T ss_pred             hccchhHHHHHHhcccccCcccccccCcchhhhccchhhhHhhhhccCcccccccccccChhhhhcccchHHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccccCCCCccHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCcHHHHHHHcCChhHHHHHHhcCCCccccCCCCCCH
Q psy13737        738 GASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPM  817 (1388)
Q Consensus       738 g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~  817 (1388)
                      ++.++..+..+.+|+|+++..++.++..+|...+..-...+..+.+|+|.|+..|..+++++++.+|++++.....|.||
T Consensus       331 ~~~~~aar~~g~t~lHlaa~~~~~~~~~~l~~~~~~~~~a~~k~~~pl~la~~~g~~~~v~Lll~~ga~~~~~gk~gvTp  410 (1143)
T KOG4177|consen  331 GATPNAARTAGYTPLHLAAKEGQVEVAGALLEHGAQRRQAEEKGFTPLHLAVKSGRVSVVELLLEAGADPNSAGKNGVTP  410 (1143)
T ss_pred             cCCccccCcCCcccccHhhhhhhHHHHHHhhccccccCcccccCCcchhhhcccCchhHHHhhhhccCCcccCCCCCcce
Confidence            99999999999999999999999999999998888888888999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCChHHHHHHHhCCCCcccCCCCChhHHHHHHHcC-CHHHHHHHHHcCCCcccccCCCCChhhHHHhcCcHHHH
Q psy13737        818 LHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKN-RIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVV  896 (1388)
Q Consensus       818 L~~A~~~~~~~iv~~Ll~~ga~~~~~~~~~~t~L~~A~~~~-~~~~v~~Ll~~ga~~~~~~~~~~t~L~~A~~~~~~~~v  896 (1388)
                      ||.|+..++.++|+.++++|++++..+..|.|++|+|+..| ..++...+++.|++++.....|.||||+|+..|+.+++
T Consensus       411 lh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~g~~~n~~s~~G~T~Lhlaaq~Gh~~~~  490 (1143)
T KOG4177|consen  411 LHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQYGADPNAVSKQGFTPLHLAAQEGHTEVV  490 (1143)
T ss_pred             eeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhhHhhcCCCcchhccccCcchhhhhccCCchHH
Confidence            99999999999999999999999999999999999999999 88999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCCccCCCCCCChhhHHHhcChHHHHHHHHhCCCCCCccccccccchhhcccccccchhhhHhhhhcccCccc
Q psy13737        897 ELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQC  976 (1388)
Q Consensus       897 ~~Ll~~g~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~ga~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  976 (1388)
                      +.|++.++..+.....+-+++|.|...+...+++.++++|++.                                     
T Consensus       491 ~llle~~~~~~~~~~~~l~~lhla~~~~~v~~~~~l~~~ga~v-------------------------------------  533 (1143)
T KOG4177|consen  491 QLLLEGGANDNLDAKKGLTPLHLAADEDTVKVAKILLEHGANV-------------------------------------  533 (1143)
T ss_pred             HHhhhcCCccCccchhccchhhhhhhhhhHHHHHHHhhcCCce-------------------------------------
Confidence            9999999999998999999999999999999999999999987                                     


Q ss_pred             cccccccccccCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHhChHHHHHHHHHCCCCCCccCCCC
Q psy13737        977 ETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKG 1056 (1388)
Q Consensus       977 ~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g 1056 (1388)
                             +.+...|.||||.|+..|++++|++|+++|++++.+++.|+||||.|+..|+.+++.+|+++|+++|..|.+|
T Consensus       534 -------~~~~~r~~TpLh~A~~~g~v~~VkfLLe~gAdv~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~GA~vna~d~~g  606 (1143)
T KOG4177|consen  534 -------DLRTGRGYTPLHVAVHYGNVDLVKFLLEHGADVNAKDKLGYTPLHQAAQQGHNDIAELLLKHGASVNAADLDG  606 (1143)
T ss_pred             -------ehhcccccchHHHHHhcCCchHHHHhhhCCccccccCCCCCChhhHHHHcChHHHHHHHHHcCCCCCcccccC
Confidence                   5566789999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHhHHHhcCcHHHHHHHHhCCCC-----CCCCCCCCCcHHHHHhhcCcHHHHHHHHHcCCChHHH----HHHHhcCCC
Q psy13737       1057 FTPLHLTGKYGHIKVAKLLLQKDAP-----VDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIA----TTLLEYGAK 1127 (1388)
Q Consensus      1057 ~tpL~~A~~~~~~~~~~~Ll~~~~~-----~~~~~~~g~t~L~~A~~~~~~~~~~~ll~~~~~~~~~----~~l~~~g~~ 1127 (1388)
                      .||||.|++.|+++++++|...++.     .......|.+|...+-......-- ++.......+..    +.....+..
T Consensus       607 ~TpL~iA~~lg~~~~~k~l~~~~~~~~~~~~~~e~~~g~~p~~v~e~~~~~~~~-~i~~~~~rL~~~~~~~~~~~~~~~~  685 (1143)
T KOG4177|consen  607 FTPLHIAVRLGYLSVVKLLKVVTATPAATDPVKENRKGAVPEDVAEELDTDRQD-LIRGKLQRLDARPKPEEAVGLDLIP  685 (1143)
T ss_pred             cchhHHHHHhcccchhhHHHhccCccccccchhhhhcccChhhHHHHhhhhhhh-hhccchHHhhccchhhhhhcccCCC
Confidence            9999999999999999999999888     666678899998776543322210 111110000110    111111222


Q ss_pred             C--CCCC--CCCCcHHHHHHhcCCHHHHHHHHhCCCCccccccCCCcH-HHHHHhcCcHHHHHHHHhCCCCCCCCCCCCC
Q psy13737       1128 P--NAES--VAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTP-LHLCAQEDRVGVAELLLKNNAQVDTPTKKGF 1202 (1388)
Q Consensus      1128 ~--~~~~--~~g~t~L~~A~~~~~~~~v~~Ll~~g~d~~~~~~~g~t~-Lh~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~ 1202 (1388)
                      +  +...  ....++++........+....|++.|.++...|+.+..+ +|.+ ..++..+....+....-....+....
T Consensus       686 ~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~l~~~g~~v~~~dn~~~~~~~h~g-f~~~~~vda~~i~~r~~~~~~~~~~~  764 (1143)
T KOG4177|consen  686 PQINTRLLQGRESTPLALELGLNSPEVAEHLLEEGADVQLGDNVGLLDPIHSG-FLGSFMVDARGGAMRGCRHAGDRIII  764 (1143)
T ss_pred             CcccccccccccccchhhhhcCchHHHHHHhhcchhhhccccccccccccccc-chhhHHHHhhccccceeecccceeec
Confidence            2  1111  122356777777777788888999999988887777666 5555 23333444444444444455566667


Q ss_pred             cHHHHHHHhCCH
Q psy13737       1203 TPLHIACHYGQI 1214 (1388)
Q Consensus      1203 tpL~~A~~~g~~ 1214 (1388)
                      +|++.++..+..
T Consensus       765 ~~~~e~~~~~~t  776 (1143)
T KOG4177|consen  765 PPLAEAAPKRIT  776 (1143)
T ss_pred             cchhhhccccee
Confidence            777777655543



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1388
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-73
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 8e-70
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 8e-37
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-25
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-21
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-25
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-17
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 4e-17
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-13
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-24
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-14
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-24
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-21
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-24
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-23
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-24
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 4e-23
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-18
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 5e-23
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-18
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-23
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-21
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-22
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-18
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-22
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-17
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-22
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-22
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-22
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-19
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-18
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-22
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-19
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-21
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-19
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 7e-17
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-21
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-21
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-18
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-18
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-21
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-19
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-21
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-16
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-15
1uoh_A226 Human Gankyrin Length = 226 4e-21
1uoh_A226 Human Gankyrin Length = 226 1e-15
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-21
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-21
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-19
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-19
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-21
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-17
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-16
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-20
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-16
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-16
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-20
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-17
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-16
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-20
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-15
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-15
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-20
1wdy_A 285 Crystal Structure Of Ribonuclease Length = 285 3e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-20
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-17
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-20
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-14
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-19
4g8k_A 337 Intact Sensor Domain Of Human Rnase L In The Inacti 8e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-19
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-18
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-16
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-18
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-16
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 6e-17
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-13
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-13
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-13
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-13
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-13
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-11
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 8e-10
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 8e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-16
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-16
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-15
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-15
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-15
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 4e-15
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-11
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-15
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 4e-15
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 5e-15
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 4e-14
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-13
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-11
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-14
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-11
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-10
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-14
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-12
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 8e-12
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-14
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-13
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 6e-09
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-14
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-14
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 7e-14
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-11
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-14
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 7e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-10
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 7e-09
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-14
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 9e-14
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-12
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-13
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-10
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-13
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-13
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 6e-08
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-13
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-09
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-13
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-13
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-13
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-13
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-09
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-07
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-13
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 7e-10
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-07
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 7e-13
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-10
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-12
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 9e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 8e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 9e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-10
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-12
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 4e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 6e-12
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 8e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 6e-12
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 8e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 8e-12
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 4e-11
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 8e-07
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 4e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-10
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-10
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-10
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 8e-10
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-09
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 6e-09
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-09
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-09
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 6e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 8e-09
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 9e-07
2xen_A91 Structural Determinants For Improved Thermal Stabil 6e-06
2xen_A91 Structural Determinants For Improved Thermal Stabil 5e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 3e-08
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-07
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-07
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 4e-08
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 6e-06
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 4e-08
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 6e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 4e-08
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-07
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 5e-08
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 1e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-07
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-07
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 6e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-07
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-06
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 5e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 5e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 6e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 4e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-07
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-07
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 3e-07
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 1e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 2e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 3e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 5e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 2e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 2e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-04
1ycs_B239 P53-53bp2 Complex Length = 239 2e-05
1ycs_B239 P53-53bp2 Complex Length = 239 3e-04
1ycs_B239 P53-53bp2 Complex Length = 239 3e-04
1ycs_B239 P53-53bp2 Complex Length = 239 4e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 4e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 8e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-04
1d9s_A136 Tumor Suppressor P15(Ink4b) Structure By Comparativ 2e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 5e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 5e-04
1bi7_B156 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 5e-04
3kea_A285 Structure Function Studies Of Vaccinia Virus Host-R 6e-04
2etc_A274 Crystal Structure Of The Ankyrin Repeat Domain Of T 9e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 273 bits (699), Expect = 4e-73, Method: Compositional matrix adjust. Identities = 167/414 (40%), Positives = 240/414 (57%), Gaps = 56/414 (13%) Query: 917 LHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQC 976 LH+A + +V+ LL+ GAS +V SNVKV L+ +++ L Q Sbjct: 18 LHVASFMGHLPIVKNLLQRGASPNV----SNVKVETPLH----MAARAGHTEVAKYLLQN 69 Query: 977 ETRLNFSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQE 1036 + ++N + ++ QTPLH A+R+G+ ++V LLL++ A + T +T LHIAA+EG Sbjct: 70 KAKVN---AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHV 126 Query: 1037 EVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVA 1096 E LLE AS TKKGFTPLH+ KYG ++VA+LLL++DA + GKNG+TPLHVA Sbjct: 127 ETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVA 186 Query: 1097 SHYDHQNVALLLLEKGAS--------------------MDIATTLLEYGAKPNAESVAGF 1136 H+++ ++ LLL +G S +++A +LL+YG NAESV G Sbjct: 187 VHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGV 246 Query: 1137 TPLHLSASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDT 1196 TPLHL+A EGHA+M A+LL A+ + K+GLTPLHL AQE V VA++L+K+ VD Sbjct: 247 TPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA 306 Query: 1197 PTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFPSRXXXXXXXXXXXXXXYTNTTD 1256 T+ G+TPLH+A HYG I + + LL A+V T Sbjct: 307 TTRMGYTPLHVASHYGNIKLVKFLLQHQADVNA------------------------KTK 342 Query: 1257 QGFTPLHHSAQQGHSTIVALLLDRGASPN-ATNKGFTPLHHSAQQGHSTIVALL 1309 G++PLH +AQQGH+ IV LLL GASPN ++ G TPL + + G+ ++ +L Sbjct: 343 LGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 396
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 Back     alignment and structure
>pdb|3KEA|A Chain A, Structure Function Studies Of Vaccinia Virus Host-Range Protein K1 Reveal A Novel Ankyrin Repeat Interaction Surface For K1s Function Length = 285 Back     alignment and structure
>pdb|2ETC|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Trpv2 Length = 274 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1388
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-134
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-123
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-123
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-123
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-123
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-121
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-120
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-119
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-119
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-119
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-119
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-119
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-118
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-109
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-28
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-90
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-89
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-86
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-86
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-86
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-86
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-83
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-81
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-80
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-78
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-65
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-63
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-47
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-35
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-88
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-87
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-87
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-85
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-84
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-84
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-83
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-82
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-71
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-70
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-80
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-79
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-79
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-79
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-78
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-75
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-74
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-74
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-73
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-71
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-71
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-70
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-70
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-64
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-79
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-78
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-77
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-75
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-75
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-75
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-75
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-74
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-72
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-70
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-70
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-70
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-66
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-79
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-71
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-70
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-70
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-69
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-67
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-66
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-66
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-65
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-64
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-61
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-73
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-71
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-71
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-71
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-71
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-70
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-70
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-70
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-68
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-68
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-67
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-66
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-64
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-73
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-70
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-70
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-66
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-66
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-65
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-64
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-63
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-63
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-62
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-72
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-70
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-69
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-69
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-67
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-66
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-65
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-65
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-65
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-51
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-71
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-70
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-70
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-69
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-67
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-67
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-67
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-63
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-58
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-69
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-67
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-65
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-63
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-61
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-59
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-58
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-54
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-45
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-69
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-66
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-66
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-64
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-63
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-62
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-62
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-61
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-55
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-44
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-33
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-68
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-64
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-64
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-63
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-62
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-59
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-58
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-56
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-55
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-47
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-65
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-64
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-63
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-61
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-60
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-60
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-59
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-58
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-56
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-55
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-49
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-61
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-61
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-60
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-58
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-58
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-57
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-57
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-56
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-55
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-54
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-52
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-45
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-20
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 3e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-58
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-58
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-57
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-55
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-54
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-53
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-52
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-51
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-50
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-50
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-37
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-57
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-55
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-55
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-55
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-54
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-53
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-53
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-53
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-52
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-50
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-50
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-50
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-48
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-46
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-41
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-53
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-52
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-52
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-50
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-49
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-49
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-49
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-47
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-45
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-44
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-41
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-39
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-53
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-52
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-51
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-48
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-47
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-47
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-46
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-45
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-45
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-44
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-44
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-43
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-40
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-32
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-52
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-50
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-50
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-48
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-46
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-46
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-45
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-45
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-40
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-34
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-52
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-51
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-50
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-50
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-47
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-46
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-45
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-44
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-41
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-16
2rfa_A232 Transient receptor potential cation channel subfa 2e-50
2rfa_A232 Transient receptor potential cation channel subfa 1e-49
2rfa_A232 Transient receptor potential cation channel subfa 3e-49
2rfa_A232 Transient receptor potential cation channel subfa 4e-49
2rfa_A232 Transient receptor potential cation channel subfa 7e-49
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 6e-47
2rfa_A232 Transient receptor potential cation channel subfa 1e-46
2rfa_A232 Transient receptor potential cation channel subfa 3e-46
2rfa_A232 Transient receptor potential cation channel subfa 4e-46
2rfa_A232 Transient receptor potential cation channel subfa 8e-46
2rfa_A232 Transient receptor potential cation channel subfa 9e-46
2rfa_A232 Transient receptor potential cation channel subfa 7e-42
2rfa_A232 Transient receptor potential cation channel subfa 3e-40
2rfa_A232 Transient receptor potential cation channel subfa 6e-34
2rfa_A232 Transient receptor potential cation channel subfa 8e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-50
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-48
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-48
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-47
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-46
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-45
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-45
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-45
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-42
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-42
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-39
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-29
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-50
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-49
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-47
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-47
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-46
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-45
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-44
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-44
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-44
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-43
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-43
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-39
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-39
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-48
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-47
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-46
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-44
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-43
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-43
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-42
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-24
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-49
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-49
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-47
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-45
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-45
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-45
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-38
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-25
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-49
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-47
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-46
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-43
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-42
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-41
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-41
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-38
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-37
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-34
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-47
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-44
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-41
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-41
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-40
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-39
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-38
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-38
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-36
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-35
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-46
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-42
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-38
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-37
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-37
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-36
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-35
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-35
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-44
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-42
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-42
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-41
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-39
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-39
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-39
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-38
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-34
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-44
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-44
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-43
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-40
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-39
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-39
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-39
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-38
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-37
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-35
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-34
2pnn_A273 Transient receptor potential cation channel subfa 3e-44
2pnn_A273 Transient receptor potential cation channel subfa 1e-43
2pnn_A273 Transient receptor potential cation channel subfa 1e-40
2pnn_A273 Transient receptor potential cation channel subfa 3e-37
2pnn_A273 Transient receptor potential cation channel subfa 5e-37
2pnn_A273 Transient receptor potential cation channel subfa 7e-32
2pnn_A273 Transient receptor potential cation channel subfa 9e-29
2pnn_A273 Transient receptor potential cation channel subfa 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 1e-23
2pnn_A 273 Transient receptor potential cation channel subfa 1e-17
2pnn_A273 Transient receptor potential cation channel subfa 4e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-44
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-43
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-42
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-40
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-38
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-36
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-35
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-34
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-25
2etb_A256 Transient receptor potential cation channel subfam 1e-43
2etb_A256 Transient receptor potential cation channel subfam 5e-40
2etb_A256 Transient receptor potential cation channel subfam 1e-39
2etb_A256 Transient receptor potential cation channel subfam 3e-39
2etb_A256 Transient receptor potential cation channel subfam 4e-36
2etb_A256 Transient receptor potential cation channel subfam 1e-35
2etb_A256 Transient receptor potential cation channel subfam 4e-35
2etb_A256 Transient receptor potential cation channel subfam 6e-30
2etb_A256 Transient receptor potential cation channel subfam 6e-30
2etb_A256 Transient receptor potential cation channel subfam 6e-30
2etb_A256 Transient receptor potential cation channel subfam 6e-30
2etb_A256 Transient receptor potential cation channel subfam 2e-18
2etb_A256 Transient receptor potential cation channel subfam 4e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-42
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-41
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-41
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-40
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-38
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-38
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-34
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-32
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-31
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-30
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-42
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-40
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-39
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-39
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-38
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-38
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-37
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-32
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-32
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-29
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-41
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-38
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-38
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-33
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-33
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-30
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-30
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-40
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-40
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-38
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-37
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-37
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-36
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-36
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-35
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-40
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-38
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-37
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-36
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-32
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-32
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-31
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-39
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-37
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-36
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-35
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-31
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-31
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-29
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-26
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-25
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
3t8k_A 186 Uncharacterized protein; structural genomics, PSI- 2e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-39
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-38
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-37
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-36
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-36
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-34
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-34
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-32
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-39
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-37
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-37
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-34
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-32
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-35
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-34
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-33
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-30
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-29
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-29
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-25
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-35
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-33
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-32
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-32
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-31
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-30
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-25
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-31
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-33
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-32
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-31
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-30
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-27
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-27
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-26
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-25
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-24
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 7e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-32
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-30
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-27
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-28
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-18
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-25
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-16
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-16
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-15
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-14
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-12
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-10
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  418 bits (1076), Expect = e-134
 Identities = 166/524 (31%), Positives = 247/524 (47%), Gaps = 97/524 (18%)

Query: 869  HGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKV 928
             G S     E     LH+A     + +V+ LL+ GAS   +    E  LH+A +    +V
Sbjct: 3    PGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEV 62

Query: 929  VELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVR 988
             + LL++ A                                  V           N + +
Sbjct: 63   AKYLLQNKA---------------------------------KV-----------NAKAK 78

Query: 989  EQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGAS 1048
            + QTPLH A+R+G+ ++V LLL++ A  +  T   +T LHIAA+EG  E    LLE  AS
Sbjct: 79   DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 138

Query: 1049 LTSTTKKGFTPLHLTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLL 1108
                TKKGFTPLH+  KYG ++VA+LLL++DA  +  GKNG+TPLHVA H+++ ++  LL
Sbjct: 139  QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 198

Query: 1109 LEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKNG 1168
            L +G S             P++ +  G+TPLH++A +   +++  LL++G   +  +  G
Sbjct: 199  LPRGGS-------------PHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQG 245

Query: 1169 LTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVT 1228
            +TPLHL AQE    +  LLL   A  +   K G TPLH+    G + +A +L+     V 
Sbjct: 246  VTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMV- 304

Query: 1229 VPKNFPSRPIGILFILFPFIIGYTNTTDQ-GFTPLHHSAQQGHSTIVALLLDRGASPNAT 1287
                                    + T + G+TPLH ++  G+  +V  LL   A  NA 
Sbjct: 305  ------------------------DATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAK 340

Query: 1288 NK-GFTPLHHSAQQGHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLL--- 1343
             K G++PLH +AQQGH+ IV LLL  GASPN  +   G TPL IA   G IS+  +L   
Sbjct: 341  TKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSD-GTTPLAIAKRLGYISVTDVLKVV 399

Query: 1344 LDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNATN 1387
             D+++ V  +     +             V  +LD         
Sbjct: 400  TDETSFVLVSDKHRMSFPE---------TVDEILDVSEDEGEEL 434


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1388
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2rfa_A232 Transient receptor potential cation channel subfa 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.62
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.4e-61  Score=581.86  Aligned_cols=397  Identities=37%  Similarity=0.564  Sum_probs=329.7

Q ss_pred             CCCCCccCCCCCCChhhHHHhcChHHHHHHHHhCCCCCCccccccccchhhcccccccchhhhHhhhhcccCcccccccc
Q psy13737        902 HGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLN  981 (1388)
Q Consensus       902 ~g~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~ga~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  981 (1388)
                      .|++++..+..|.||||+|+..|+.++|++|+++|+++                                          
T Consensus         3 ~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~------------------------------------------   40 (437)
T 1n11_A            3 PGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASP------------------------------------------   40 (437)
T ss_dssp             ------------CCHHHHHHHHTCHHHHHHHHHTTCCS------------------------------------------
T ss_pred             CCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCC------------------------------------------
Confidence            46777777777777777777777777777777777765                                          


Q ss_pred             ccccccCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHhChHHHHHHHHHCCCCCCccCCCCchHHh
Q psy13737        982 FSNLRVREQQTPLHIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLH 1061 (1388)
Q Consensus       982 ~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~tpL~ 1061 (1388)
                        +..+..|.||||+|+..|+.+++++|+++|++++.++.+|+||||+|+..|+.+++++|+++|++++..+..|.||||
T Consensus        41 --~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~  118 (437)
T 1n11_A           41 --NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLH  118 (437)
T ss_dssp             --CCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHH
T ss_pred             --CCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHH
Confidence              334456778888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HHHhcCcHHHHHHHHhCCCCCCCCCCCCCcHHHHHhhcCcHHHHHHHHHcCCChHHHHHHHhcCCCCCCCCCCCCcHHHH
Q psy13737       1062 LTGKYGHIKVAKLLLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHL 1141 (1388)
Q Consensus      1062 ~A~~~~~~~~~~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~ll~~~~~~~~~~~l~~~g~~~~~~~~~g~t~L~~ 1141 (1388)
                      +|+..|+.+++++|++.+++++..+..|.||||+|+..++.+++++|+             +.|++++..+..|.||||+
T Consensus       119 ~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll-------------~~g~~~~~~~~~g~t~L~~  185 (437)
T 1n11_A          119 IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLL-------------ERDAHPNAAGKNGLTPLHV  185 (437)
T ss_dssp             HHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHH-------------HTTCCTTCCCSSCCCHHHH
T ss_pred             HHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHH-------------hCCCCCCCCCCCCCCHHHH
Confidence            888888888888888888888778888888888888777766655554             3466777888888899999


Q ss_pred             HHhcCCHHHHHHHHhCCCCccccccCCCcHHHHHHhcCcHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHhCCHHHHHHHH
Q psy13737       1142 SASEGHADMSAMLLEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLL 1221 (1388)
Q Consensus      1142 A~~~~~~~~v~~Ll~~g~d~~~~~~~g~t~Lh~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll 1221 (1388)
                      |+..|+.+++++|+++|++++..+..|.||||+|+..++.+++++|++.|++++.++..|+||||+|+..|+.+++++|+
T Consensus       186 A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll  265 (437)
T 1n11_A          186 AVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLL  265 (437)
T ss_dssp             HHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHH
Confidence            99999999999999999999988889999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCCcccCCCCCCCCcchhhhccccccccccCCCCCCChHHHHHHcCCHHHHHHHHHcCCCCCC-CCCCCcHHHHHHhc
Q psy13737       1222 DQSANVTVPKNFPSRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNA-TNKGFTPLHHSAQQ 1300 (1388)
Q Consensus      1222 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~-~~~g~tpL~~A~~~ 1300 (1388)
                      +++++++.                        .+..|+||||+|+..|+.+++++|+++|++++. +..|+||||+|+..
T Consensus       266 ~~~~~~~~------------------------~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~  321 (437)
T 1n11_A          266 SKQANGNL------------------------GNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHY  321 (437)
T ss_dssp             TTTCCTTC------------------------CCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHS
T ss_pred             hcCCCCCC------------------------CCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHc
Confidence            99988765                        667899999999999999999999999999987 55799999999999


Q ss_pred             CcHHHHHHHHHcCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHhCcHHHHHHHHHCC
Q psy13737       1301 GHSTIVALLLDRGASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALLLDRG 1380 (1388)
Q Consensus      1301 g~~~iv~~Ll~~g~~~~~~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~ga~~~~~d~~G~tpL~~A~~~g~~~~v~~Ll~~g 1380 (1388)
                      |+.++|++|+++|++++.++. .|+||||+|+..|+.++|++|+++|++++.+|.+|+|||++|++.|+.+++++|....
T Consensus       322 g~~~~v~~Ll~~gad~n~~~~-~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l~~~~  400 (437)
T 1n11_A          322 GNIKLVKFLLQHQADVNAKTK-LGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVT  400 (437)
T ss_dssp             SCSHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHC
T ss_pred             CcHHHHHHHHhcCCCCCCCCC-CCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcc
Confidence            999999999999999998775 6999999999999999999999999999999999999999999999999999987543



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1388
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-71
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-70
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-68
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-67
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-66
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-64
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-63
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-63
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-60
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-41
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-36
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-32
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-38
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-37
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-37
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-36
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-35
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-33
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-30
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-28
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-23
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-35
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-34
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-28
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-24
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-22
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-19
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-29
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-29
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-29
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-27
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-27
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-26
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-26
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-25
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-25
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-22
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-18
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-15
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-10
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-29
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-28
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-28
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-27
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-26
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-25
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-25
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-24
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-24
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-26
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-23
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-23
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-23
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-21
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-20
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-18
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-16
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-10
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-08
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-25
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-23
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-22
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-21
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-16
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-08
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-24
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-23
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-22
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-19
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-18
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-23
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-22
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-21
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-20
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-20
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-21
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-21
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-19
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-18
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-18
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-19
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-19
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-19
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-19
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-19
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-17
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-16
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-12
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-06
d1awcb_ 153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.004
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-05
d1ihba_ 156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-11
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 6e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-09
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 5e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  241 bits (615), Expect = 8e-71
 Identities = 123/382 (32%), Positives = 198/382 (51%)

Query: 188 LTALHVAAHCGHARVAKTLLDKKADPNARALNGFTPLHIACKKNRIKVVELLLKHGASIE 247
           LT LHVA+  GH  + K LL + A PN   +   TPLH+A +    +V + LL++ A + 
Sbjct: 1   LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN 60

Query: 248 ATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLK 307
           A  +  +  LH A +     +V+LLL++ A+    T      LHIA ++  ++ V  LL+
Sbjct: 61  AKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLE 120

Query: 308 HGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKV 367
             AS    T+     LH+A K  +++V ELLL+  A   A  +     LH+A   N + +
Sbjct: 121 KEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDI 180

Query: 368 VELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACK 427
           V+LLL  G S  +        LHIA K+N+++V   LL++G S  A +      LH+A +
Sbjct: 181 VKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQ 240

Query: 428 KNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATTEVREPM 487
           +   ++V LLL   A+     +     LH+  ++  + V ++L+KHG  ++ATT +    
Sbjct: 241 EGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTP 300

Query: 488 LHIACKKNRIKVVELLLKHGASIEATTEVREPMLHIACKKNRIKVVELLLKHGASIEATT 547
           LH+A     IK+V+ LL+H A + A T++    LH A ++    +V LLLK+GAS    +
Sbjct: 301 LHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVS 360

Query: 548 EVREPMLHIACKKNRIKVVELL 569
                 L IA +   I V ++L
Sbjct: 361 SDGTTPLAIAKRLGYISVTDVL 382


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1388
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.98
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.86
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.85
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2e-49  Score=470.55  Aligned_cols=391  Identities=37%  Similarity=0.580  Sum_probs=361.7

Q ss_pred             ChhhHHHhcChHHHHHHHHhCCCCCCccccccccchhhcccccccchhhhHhhhhcccCccccccccccccccCCCCcHH
Q psy13737        915 PMLHIACKKNRIKVVELLLKHGASSHVVSCYSNVKVHVSLNKIQDVSSSILRLATCDVLPQCETRLNFSNLRVREQQTPL  994 (1388)
Q Consensus       915 t~L~~A~~~~~~~~v~~Ll~~ga~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L  994 (1388)
                      ||||+|+..|+.++|++|+++|+++                                            +..+..|.|||
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~g~~i--------------------------------------------n~~d~~g~TpL   37 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQRGASP--------------------------------------------NVSNVKVETPL   37 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCS--------------------------------------------CCSSSCCCCHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHCCCCC--------------------------------------------CCCCCCCCCHH
Confidence            8999999999999999999999987                                            55667899999


Q ss_pred             HHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHhChHHHHHHHHHCCCCCCccCCCCchHHhHHHhcCcHHHHHH
Q psy13737        995 HIASRLGNVDIVMLLLQHGAAVDSTTKDLYTALHIAAKEGQEEVAAVLLENGASLTSTTKKGFTPLHLTGKYGHIKVAKL 1074 (1388)
Q Consensus       995 ~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~tpL~~A~~~~~~~~~~~ 1074 (1388)
                      |+|+..|+.+++++|+++|++++.++.+|+||||+|+..|+.+++++|+..+.+.........+|+..+...+.......
T Consensus        38 ~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  117 (408)
T d1n11a_          38 HMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLA  117 (408)
T ss_dssp             HHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHH
T ss_pred             HHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccc
Confidence            99999999999999999999999999999999999999999999999999999988888889999999999999999888


Q ss_pred             HHhCCCCCCCCCCCCCcHHHHHhhcCcHHHHHHHHHcCCChHHHHHHHhcCCCCCCCCCCCCcHHHHHHhcCCHHHHHHH
Q psy13737       1075 LLQKDAPVDFQGKNGVTPLHVASHYDHQNVALLLLEKGASMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAML 1154 (1388)
Q Consensus      1075 Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~ll~~~~~~~~~~~l~~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~L 1154 (1388)
                      ....+...+..+..+.++++.|+..++.++++.|+             ++|++++..+..|.+|||+|+..|+.+++++|
T Consensus       118 ~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll-------------~~~~~~~~~~~~~~~~L~~A~~~~~~~~~~~L  184 (408)
T d1n11a_         118 LLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLL-------------ERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL  184 (408)
T ss_dssp             HHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHH-------------HTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHH
T ss_pred             cccccccccccccccchHHHHHHHcCCHHHHHHHH-------------HcCCCCCcCCCcCchHHHHHHHcCCHHHHHHH
Confidence            88899999999999999999999888776665554             56778889999999999999999999999999


Q ss_pred             HhCCCCccccccCCCcHHHHHHhcCcHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHhCCHHHHHHHHhCCCCcccCCCCC
Q psy13737       1155 LEHGADVSHAAKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKKGFTPLHIACHYGQISMARLLLDQSANVTVPKNFP 1234 (1388)
Q Consensus      1155 l~~g~d~~~~~~~g~t~Lh~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~ 1234 (1388)
                      +++|++++..+..|.||+|+++...+.+....|+..+......+..|.|||++|+..+..++++.+++.+...+.     
T Consensus       185 l~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~~~-----  259 (408)
T d1n11a_         185 LPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL-----  259 (408)
T ss_dssp             GGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTC-----
T ss_pred             HhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcHhHhhhhhcccccccc-----
Confidence            999999999999999999999999999999999999999999999999999999999999999999998877654     


Q ss_pred             CCCcchhhhccccccccccCCCCCCChHHHHHHcCCHHHHHHHHHcCCCCCC-CCCCCcHHHHHHhcCcHHHHHHHHHcC
Q psy13737       1235 SRPIGILFILFPFIIGYTNTTDQGFTPLHHSAQQGHSTIVALLLDRGASPNA-TNKGFTPLHHSAQQGHSTIVALLLDRG 1313 (1388)
Q Consensus      1235 ~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~-~~~g~tpL~~A~~~g~~~iv~~Ll~~g 1313 (1388)
                                         .+..|.|||+.|++.++.+++++|+++|++++. ...+.||||.|+..++.++++.+++.|
T Consensus       260 -------------------~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~~~~~~~~~ll~~g  320 (408)
T d1n11a_         260 -------------------GNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ  320 (408)
T ss_dssp             -------------------CCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHHHHHHHHTT
T ss_pred             -------------------ccCCCCChhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhcccCcceeeeeecccc
Confidence                               577899999999999999999999999999987 557999999999999999999999999


Q ss_pred             CCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHhCcHHHHHHH---HHCCCCCCCCC
Q psy13737       1314 ASPNATNKTRGFTPLHIACHYGQISMARLLLDQSANVSCTTDQGFTPLHHSAQQGHSTIVALL---LDRGASPNATN 1387 (1388)
Q Consensus      1314 ~~~~~~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~ga~~~~~d~~G~tpL~~A~~~g~~~~v~~L---l~~ga~~~~~~ 1387 (1388)
                      ++++.++. +|+||||+|+++|+.++|++|+++|||++.+|.+|+||||+|+++|+.++|++|   +++|++....|
T Consensus       321 ~~in~~d~-~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv~~L~~~~~~~~~~~~~~  396 (408)
T d1n11a_         321 ADVNAKTK-LGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSD  396 (408)
T ss_dssp             CCTTCCCT-TSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHCCCCSSCC---
T ss_pred             ccccccCC-CCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHHHhccccccccc
Confidence            99998875 799999999999999999999999999999999999999999999999999855   45666666554



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure