Psyllid ID: psy14265


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPGNYLENKPIVENGEGKQRIEDK
cHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccEEEccccEEEccccEEEEccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccEEEccccccccccccccccccHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHccccEccccccccHHHHHHHHHHHHccccccHHHEEHHcHHcHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHHEEccccEEcccccEEEccccEEEEEHHHHHcccccccccccccHHHHccccccEcccccccccccHHHccccHHHHHHHHHHHHHHHHHHEEEEEccccccccEEcccccEEHHHHHHHHHHcccccEEHHHHHHHccccEHccccccEEEccccccccHHHHHHHHHEccccccHHHHHHHHHHccHHHHHHcccEEccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHccc
mfplmetcgRNLETILTTLdynkkhqsiDVKEYLGRYMTDVIGSTVfgleinslenpdcefRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVsyreqnnikrNDFINIMMELKKTDPDITEELITAQCFLFffagfdtsstvLTFSLYELAKNKSIQSKLRNEINDTkakyggeltyesynempLLDKVIKESLrmytplsqlervagrpyqlpntdivvdkgtkmfiplyglhhdpeiypnpdvfdperfapenadnipnyaylpfgegprncIGKRFALLQLKSGLAHSlsnfewdsdhtnemfPLMETCGRNLETILTTLdynkkhqsiDVKEYLGRYMTDVIGSTVfgleinslenpdcefRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVsyreqnnikrNDFINIMMELkktdpgnylenkpivengegkqriedk
mfplmetcGRNLETILttldynkkhqSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVsyreqnnikrndFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSqlervagrpyqlpNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTtldynkkhqSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVsyreqnnikrndFINIMMELKktdpgnylenkpivengegkqriedk
MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRlqiilalillipylRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRlqiilalillipylRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPGNYLENKPIVENGEGKQRIEDK
******TCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELK**************************
MFPLMETCGRNLETILTT*D****HQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIM************************Q*****
MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPGNYLENKPIVENG*********
MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKT************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKTDPGNYLENKPIVENGEGKQRIEDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query489 2.2.26 [Sep-21-2011]
Q9V4U9493 Probable cytochrome P450 yes N/A 0.656 0.651 0.412 4e-71
Q9V4U7509 Probable cytochrome P450 no N/A 0.619 0.595 0.425 1e-66
Q964R0524 Cytochrome P450 6k1 OS=Bl N/A N/A 0.642 0.599 0.387 5e-65
P33270506 Cytochrome P450 6a2 OS=Dr no N/A 0.666 0.644 0.373 4e-64
Q27594504 Cytochrome P450 6a9 OS=Dr no N/A 0.648 0.628 0.386 1e-62
Q964T2533 Cytochrome P450 9e2 OS=Bl N/A N/A 0.646 0.592 0.387 5e-62
Q9V770501 Probable cytochrome P450 no N/A 0.648 0.632 0.373 3e-61
Q9V771502 Probable cytochrome P450 no N/A 0.670 0.653 0.376 4e-61
Q9V773501 Probable cytochrome P450 no N/A 0.670 0.654 0.364 1e-60
Q9VB31507 Probable cytochrome P450 no N/A 0.597 0.575 0.386 7e-60
>sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 Back     alignment and function desciption
 Score =  269 bits (687), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 202/330 (61%), Gaps = 9/330 (2%)

Query: 1   MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCE 60
           MFP M   G  L     T     +   I+ K+   R+ TDVIGS  FGLE NSL++P+ +
Sbjct: 144 MFPNMVEVGEKL-----TQACRLQVGEIEAKDLCARFTTDVIGSCAFGLECNSLQDPESQ 198

Query: 61  FRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQ 120
           FRR+ + +  E   +   ++ A +   P L + + + +   + + FFLD V Q + YR +
Sbjct: 199 FRRMGRSVTQEP--LHSVLVQAFMFAQPELARKLRFRLFRPEVSEFFLDTVRQTLDYRRR 256

Query: 121 NNIKRNDFINIMMELKK--TDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKS 178
            NI RND I ++MEL +      ++ E I AQ  +FF AGFDTSST ++F LYELA N  
Sbjct: 257 ENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPD 316

Query: 179 IQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPN 238
           +Q +LR E+     +   +LTY+S  EMP LD+V+ E+LR Y  L  L R + + YQ+PN
Sbjct: 317 VQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQIPN 376

Query: 239 TDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCI 298
           ++++++ G+K+ IP++ +HHDPE+YP+P+ FDP RF PE       +AYLPFGEGPRNCI
Sbjct: 377 SNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKARHPFAYLPFGEGPRNCI 436

Query: 299 GKRFALLQLKSGLAHSLSNFEWDSDHTNEM 328
           G+RF  LQ+K GL + L +F++      ++
Sbjct: 437 GERFGKLQVKVGLVYLLRDFKFSRSEKTQI 466




May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 Back     alignment and function description
>sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 Back     alignment and function description
>sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 Back     alignment and function description
>sp|Q27594|CP6A9_DROME Cytochrome P450 6a9 OS=Drosophila melanogaster GN=Cyp6a9 PE=2 SV=3 Back     alignment and function description
>sp|Q964T2|CP9E2_BLAGE Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1 Back     alignment and function description
>sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 Back     alignment and function description
>sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 Back     alignment and function description
>sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 Back     alignment and function description
>sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query489
242006242 657 conserved hypothetical protein [Pediculu 0.973 0.724 0.398 5e-97
189241880 845 PREDICTED: similar to cytochrome P450 CY 0.922 0.533 0.363 2e-84
296495590521 cytochrome P450 CYP6BQ9 [Tribolium casta 0.666 0.625 0.417 4e-72
194753037495 GF12366 [Drosophila ananassae] gi|190620 0.609 0.602 0.459 5e-72
9739175497 cytochrome P450 CYP6N3v2 [Aedes albopict 0.593 0.583 0.437 6e-72
91076840514 PREDICTED: similar to cytochrome P450 CY 0.691 0.657 0.393 6e-72
170072411499 cytochrome P450 6a8 [Culex quinquefascia 0.664 0.651 0.406 1e-71
170063829499 cytochrome P450 93A3 [Culex quinquefasci 0.664 0.651 0.409 1e-71
61652897507 cytochrome P450 [Ochlerotatus sollicitan 0.607 0.585 0.442 2e-71
91081149520 PREDICTED: similar to cytochrome P450 [T 0.646 0.607 0.428 3e-71
>gi|242006242|ref|XP_002423962.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507238|gb|EEB11224.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  361 bits (926), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 201/504 (39%), Positives = 296/504 (58%), Gaps = 28/504 (5%)

Query: 1   MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCE 60
           MFPLM  CG  L+  +   D+  +  SI+VKE L R+ TD+I S  FG+E NSL+NPD E
Sbjct: 4   MFPLMVECGNLLKNYME--DHIGQENSIEVKEVLCRFTTDIISSCAFGIESNSLKNPDSE 61

Query: 61  FRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQ 120
           FR+  K++F      R   I+    L+P L   +   ++ +  + FFL+ V + + YR++
Sbjct: 62  FRKYGKKVFDAEGIRRF--IVVFFNLLPELFDILRLRIIQKDVSDFFLNAVQETIEYRQK 119

Query: 121 NNIKRNDFINIMMEL------------KKTDPDITE---ELITAQCFLFFFAGFDTSSTV 165
           NNIKRNDF+ ++++L            K+   DI E   +   AQ F+FF AGF+TSST 
Sbjct: 120 NNIKRNDFLQLLIQLINNGKLDDVDNIKEGGEDINEKNTQSSAAQAFVFFLAGFETSSTT 179

Query: 166 LTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQ 225
           +TF+LYELA+N+ +Q KL +EI+    KY  ++TYE  +EM  LD VI+E+LR Y PL  
Sbjct: 180 MTFALYELARNEDVQEKLIDEIDRILIKYDNKITYEGISEMHYLDWVIRETLRKYPPLPI 239

Query: 226 LERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNY 285
           L R+  + Y++P+TD+V+ KGT +FIP YG+  DP+IYP+P+ FDP R APE      N 
Sbjct: 240 LTRICNKDYKVPDTDVVIKKGTNVFIPAYGIQRDPKIYPDPEKFDPMRHAPEEKSKRENI 299

Query: 286 AYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCGRNLETILTT 345
           + L FGEGPR CIG  F L   K           + S     MFPLM  CG  L+  +  
Sbjct: 300 SALYFGEGPRICIGNLFNLTGAKWRNLRVKLTPTFTSGKMKNMFPLMVECGNLLKNYME- 358

Query: 346 LDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQ 405
            D+  +  S +VKE L R+ TD+I S  FG+E NSL+NPD EFR+  K+ FT + + +  
Sbjct: 359 -DHIGQENSFEVKEVLCRFTTDIISSCAFGIESNSLKNPDSEFRKYGKKFFTSDGSRKFL 417

Query: 406 IILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKT 465
           I+    L  P L   + + ++ +  + FFL+ V + + YRE+N IKRNDF+ ++++L   
Sbjct: 418 IVFFNFL--PKLFNLLRFRIIQKDVSDFFLNAVQETIEYREKNKIKRNDFLQLLIQLINN 475

Query: 466 DPGNYLENKPIVENGEGKQRIEDK 489
              + ++N     N EG + + +K
Sbjct: 476 GKLDDVDN-----NKEGGEDVNEK 494




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189241880|ref|XP_969107.2| PREDICTED: similar to cytochrome P450 CYP6BK17 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|296495590|gb|ADH29767.1| cytochrome P450 CYP6BQ9 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194753037|ref|XP_001958825.1| GF12366 [Drosophila ananassae] gi|190620123|gb|EDV35647.1| GF12366 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|9739175|gb|AAF97937.1| cytochrome P450 CYP6N3v2 [Aedes albopictus] Back     alignment and taxonomy information
>gi|91076840|ref|XP_974742.1| PREDICTED: similar to cytochrome P450 CYP6BK17 [Tribolium castaneum] gi|270002796|gb|EEZ99243.1| cytochrome P450 6BS1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170072411|ref|XP_001870174.1| cytochrome P450 6a8 [Culex quinquefasciatus] gi|167868670|gb|EDS32053.1| cytochrome P450 6a8 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170063829|ref|XP_001867273.1| cytochrome P450 93A3 [Culex quinquefasciatus] gi|167881324|gb|EDS44707.1| cytochrome P450 93A3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|61652897|gb|AAX48013.1| cytochrome P450 [Ochlerotatus sollicitans] Back     alignment and taxonomy information
>gi|91081149|ref|XP_975563.1| PREDICTED: similar to cytochrome P450 [Tribolium castaneum] gi|270006376|gb|EFA02824.1| cytochrome P450 6BQ11 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query489
FB|FBgn0033304493 Cyp6a13 "Cyp6a13" [Drosophila 0.660 0.655 0.417 1.8e-64
FB|FBgn0000473506 Cyp6a2 "Cytochrome P450-6a2" [ 0.670 0.648 0.373 7.3e-59
FB|FBgn0013771504 Cyp6a9 "Cytochrome P450-6a9" [ 0.644 0.625 0.380 3.2e-58
FB|FBgn0013773499 Cyp6a22 "Cyp6a22" [Drosophila 0.648 0.635 0.370 9.6e-57
FB|FBgn0033981504 Cyp6a21 "Cyp6a21" [Drosophila 0.603 0.585 0.390 3.3e-56
FB|FBgn0033980501 Cyp6a20 "Cyp6a20" [Drosophila 0.670 0.654 0.364 3.3e-56
FB|FBgn0015714501 Cyp6a17 "Cytochrome P450-6a17" 0.650 0.634 0.361 5.3e-56
FB|FBgn0033978502 Cyp6a23 "Cyp6a23" [Drosophila 0.670 0.653 0.373 1.1e-55
FB|FBgn0039006515 Cyp6d4 "Cyp6d4" [Drosophila me 0.421 0.4 0.386 2e-53
FB|FBgn0039519507 Cyp6a18 "Cyp6a18" [Drosophila 0.591 0.570 0.380 2.4e-53
FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 657 (236.3 bits), Expect = 1.8e-64, P = 1.8e-64
 Identities = 139/333 (41%), Positives = 201/333 (60%)

Query:     1 MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCE 60
             MFP M   G  L T    L   +    I+ K+   R+ TDVIGS  FGLE NSL++P+ +
Sbjct:   144 MFPNMVEVGEKL-TQACRLQVGE----IEAKDLCARFTTDVIGSCAFGLECNSLQDPESQ 198

Query:    61 FRRISKEMFTENNNMRXXXXXXXXXXXXXXRKFMSYMMLLRKAAYFFLDVVHQNVSYREQ 120
             FRR+ + + T+                   RK + + +   + + FFLD V Q + YR +
Sbjct:   199 FRRMGRSV-TQEPLHSVLVQAFMFAQPELARK-LRFRLFRPEVSEFFLDTVRQTLDYRRR 256

Query:   121 NNIKRNDFINIMMELKKTD-PD-ITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKS 178
              NI RND I ++MEL +    D ++ E I AQ  +FF AGFDTSST ++F LYELA N  
Sbjct:   257 ENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFLAGFDTSSTTMSFCLYELALNPD 316

Query:   179 IQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPN 238
             +Q +LR E+     +   +LTY+S  EMP LD+V+ E+LR Y  L  L R + + YQ+PN
Sbjct:   317 VQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQIPN 376

Query:   239 TDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCI 298
             ++++++ G+K+ IP++ +HHDPE+YP+P+ FDP RF PE       +AYLPFGEGPRNCI
Sbjct:   377 SNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKARHPFAYLPFGEGPRNCI 436

Query:   299 GKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPL 331
             G+RF  LQ+K GL + L +F++      ++ PL
Sbjct:   437 GERFGKLQVKVGLVYLLRDFKFSRSEKTQI-PL 468


GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0042742 "defense response to bacterium" evidence=IMP
FB|FBgn0000473 Cyp6a2 "Cytochrome P450-6a2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013771 Cyp6a9 "Cytochrome P450-6a9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013773 Cyp6a22 "Cyp6a22" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033981 Cyp6a21 "Cyp6a21" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033980 Cyp6a20 "Cyp6a20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015714 Cyp6a17 "Cytochrome P450-6a17" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033978 Cyp6a23 "Cyp6a23" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039006 Cyp6d4 "Cyp6d4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039519 Cyp6a18 "Cyp6a18" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q64481CP3AG_MOUSE1, ., 1, 4, ., 1, 4, ., 10.37920.64410.625yesN/A
P24463CP3AC_CANFA1, ., 1, 4, ., 1, 4, ., 10.34650.63800.6202yesN/A
Q64581CP3AI_RAT1, ., 1, 4, ., 1, 4, ., 10.35950.62570.6156yesN/A
Q64417CP3AE_CAVPO1, ., 1, 4, ., 1, 4, ., 10.34040.63800.6202yesN/A
Q9V4U9C6A13_DROME1, ., 1, 4, ., -, ., -0.41210.65640.6511yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
pfam00067461 pfam00067, p450, Cytochrome P450 6e-84
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-40
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 9e-33
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-26
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-23
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 3e-22
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 8e-22
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-21
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-19
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-18
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-18
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-18
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 8e-18
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-17
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-16
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 7e-16
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 7e-15
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-13
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 2e-13
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 4e-13
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-13
pfam00067 461 pfam00067, p450, Cytochrome P450 3e-11
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 4e-11
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-10
PLN02648480 PLN02648, PLN02648, allene oxide synthase 1e-09
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-09
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 9e-08
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-07
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
 Score =  266 bits (682), Expect = 6e-84
 Identities = 111/344 (32%), Positives = 173/344 (50%), Gaps = 16/344 (4%)

Query: 1   MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENP-DC 59
             P +E   R+L   L       +   ID+ + L R   +VI S +FG    SLE+P   
Sbjct: 114 FEPRVEEEARDLVEKLRKT--AGEPGVIDITDLLFRAALNVICSILFGERFGSLEDPKFL 171

Query: 60  EFRRISKEMFTENNNMRLQIIL----ALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNV 115
           E  +  +E+ +  ++   Q++           P+ RK       ++      ++   + +
Sbjct: 172 ELVKAVQELSSLLSSPSPQLLDLFPILKYFPGPHGRKLKRARKKIKDLLDKLIEERRETL 231

Query: 116 SYREQNNIKRNDFINIMMELKKTDP--DITEELITAQCFLFFFAGFDTSSTVLTFSLYEL 173
                      DF++ ++  K+ +    +T+E + A     FFAG DT+S+ L+++LYEL
Sbjct: 232 DSA---KKSPRDFLDALLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTLSWALYEL 288

Query: 174 AKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPL-SQLERVAGR 232
           AK+  +Q KLR EI D         TY+    MP LD VIKE+LR++  +   L R   +
Sbjct: 289 AKHPEVQEKLREEI-DEVIGDKRSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTK 347

Query: 233 PYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGE 292
              +P   I   KGT + + LY LH DPE++PNP+ FDPERF  EN     ++A+LPFG 
Sbjct: 348 DTVIPGYLI--PKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGA 405

Query: 293 GPRNCIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLMETCG 336
           GPRNC+G+R A +++K  LA  L NFE +     +   + ET G
Sbjct: 406 GPRNCLGERLARMEMKLFLATLLQNFEVELPPGTDPPDIDETPG 449


Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461

>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 489
KOG0158|consensus499 100.0
KOG0156|consensus489 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
KOG0159|consensus519 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0157|consensus497 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0684|consensus486 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
KOG0158|consensus 499 99.5
KOG0156|consensus 489 98.87
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 98.76
KOG0157|consensus 497 98.68
PLN03234 499 cytochrome P450 83B1; Provisional 98.67
PLN02687 517 flavonoid 3'-monooxygenase 98.59
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 98.57
PLN02971 543 tryptophan N-hydroxylase 98.56
PLN02966 502 cytochrome P450 83A1 98.54
PLN02426 502 cytochrome P450, family 94, subfamily C protein 98.54
PLN03112 514 cytochrome P450 family protein; Provisional 98.46
PLN02738 633 carotene beta-ring hydroxylase 98.41
PTZ00404 482 cytochrome P450; Provisional 98.31
PLN03195 516 fatty acid omega-hydroxylase; Provisional 98.31
PLN02936 489 epsilon-ring hydroxylase 98.28
PLN00168 519 Cytochrome P450; Provisional 98.27
PLN02655 466 ent-kaurene oxidase 98.25
PLN02290 516 cytokinin trans-hydroxylase 98.19
PLN03018 534 homomethionine N-hydroxylase 98.16
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 98.16
PLN02183 516 ferulate 5-hydroxylase 98.07
PLN02394 503 trans-cinnamate 4-monooxygenase 98.06
KOG0159|consensus 519 97.45
PLN02774 463 brassinosteroid-6-oxidase 97.42
PLN02500 490 cytochrome P450 90B1 97.41
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 97.23
PLN02196 463 abscisic acid 8'-hydroxylase 97.2
PLN02302 490 ent-kaurenoic acid oxidase 97.01
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 96.38
PLN02987 472 Cytochrome P450, family 90, subfamily A 96.03
PLN02648 480 allene oxide synthase 95.62
KOG0684|consensus 486 90.21
>KOG0158|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-58  Score=445.67  Aligned_cols=319  Identities=43%  Similarity=0.764  Sum_probs=276.7

Q ss_pred             ChhHHHHHHHHHHHHHHhhhcCCCCcceeHHHHHHHHHHHHHHHHHhcccCCCCCCCCchHHHHHHHHhccchhhHHHHH
Q psy14265          1 MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQII   80 (489)
Q Consensus         1 ~~p~i~~~~~~l~~~l~~~~~~~g~~~vdl~~~~~~~~~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (489)
                      |+|+|++++++|++.+++.. ..++ .+++.+.+..+|.|||++++||.+.+++.+....|.......+... .......
T Consensus       145 m~~t~~~~~~~l~~~l~~~~-~~~~-~~~~~dl~~~yT~DVI~~~AfG~~~~s~~d~~~~F~~~~~~~~~~~-~~~~~l~  221 (499)
T KOG0158|consen  145 MFPTMEEVGDELVRHLRRKS-EGGQ-EGEIKDLCARYTTDVIGSCAFGLDANSLRDPKAEFRRMGRRAFFLS-RGLFPLK  221 (499)
T ss_pred             HHHHHHHHHHHHHHHHHHhh-cccC-CccHHHHHHHHHHHHHhHhhcccchhhhcCchHHHHHhhHHHHHHh-hccchHh
Confidence            78999999999999999877 3334 7889999999999999999999999998887777776555443320 1111122


Q ss_pred             HHHHHHhHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHcCCCcchHHHHHHHhhcC---C----CCCCHHHHHHHHhH
Q psy14265         81 LALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIKRNDFINIMMELKKT---D----PDITEELITAQCFL  153 (489)
Q Consensus        81 ~~~~~~~P~l~~~~~~~~~~~~~~~~~~~~i~~~i~~~~~~~~~~~d~l~~ll~~~~~---~----~~l~~~~i~~~~~~  153 (489)
                      ......+|.+................+.+++...++.|..++..+.|+++.|++...+   +    ..+|.++|+++|+.
T Consensus       222 ~~~~~~~p~l~~~l~~~~~~~~~~~~~~~~v~~~v~~R~~~~~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafv  301 (499)
T KOG0158|consen  222 FMLIFLFPKLALPLRVKLFPEDVTDFFRKLVNSRVEQREKENIERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFV  301 (499)
T ss_pred             HhHHHHhHHHHHhhhcccChHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhhcccccccccccccCHHHHHHHHHH
Confidence            2344556666655555555677888899999999999977778899999999998743   1    15999999999999


Q ss_pred             HHhhhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhhhcCCCCChhhhcCChhHHHHHHhhhcCCCCccccccccCCC
Q psy14265        154 FFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRP  233 (489)
Q Consensus       154 ~~~aG~~tts~~l~~~l~~L~~~P~~q~~l~~Ei~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~~~~~~~~r~~~~~  233 (489)
                      +++||.||||++|+.++|+||+||++|+|||+||++++....+ ++++.+.+|+||++||+||||+||+++.+.|.+++|
T Consensus       302 Fl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~-ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~  380 (499)
T KOG0158|consen  302 FLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEG-LTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKD  380 (499)
T ss_pred             HHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCC-CCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCc
Confidence            9999999999999999999999999999999999999876433 999999999999999999999999999999999999


Q ss_pred             cccCCCceEecCCCEEEEcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCCcccCchHHHHHHHHHHHHH
Q psy14265        234 YQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAH  313 (489)
Q Consensus       234 ~~i~~~~~~ip~g~~v~~~~~~~~~~~~~~~~p~~f~p~R~~~~~~~~~~~~~~~~f~~g~~~c~G~~~a~~~~~~~~~~  313 (489)
                      +++++ ++.||||+.|.+++|++||||++||||++|+||||.+++....++..|+|||.|||.|+|++||.+|+|..+++
T Consensus       381 ~~i~~-~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~  459 (499)
T KOG0158|consen  381 YEIPG-GFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAH  459 (499)
T ss_pred             eecCC-CeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHHHHHHHHHHHH
Confidence            99994 49999999999999999999999999999999999987765667889999999999999999999999999999


Q ss_pred             HhhccccccCC
Q psy14265        314 SLSNFEWDSDH  324 (489)
Q Consensus       314 ~~~~~~f~~~~  324 (489)
                      ++++|.|+...
T Consensus       460 lL~~f~~~~~~  470 (499)
T KOG0158|consen  460 LLRNFSFEVCP  470 (499)
T ss_pred             HHhhCEEecCC
Confidence            99999999987



>KOG0156|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 7e-41
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 7e-41
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 7e-41
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 6e-24
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-20
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-19
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-19
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-19
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-19
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-19
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 2e-19
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 2e-19
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-19
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-19
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 2e-19
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-19
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-19
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-19
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-19
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-19
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 3e-19
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 5e-19
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 6e-19
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 6e-19
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 6e-19
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-19
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 6e-19
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 6e-19
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-19
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 7e-19
1fah_A471 Structure Of Cytochrome P450 Length = 471 7e-19
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 9e-19
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-18
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-18
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-18
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-18
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-18
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 1e-18
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-18
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-18
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-18
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-18
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-18
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-18
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-18
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-18
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 3e-18
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-18
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 6e-18
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 6e-18
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 7e-18
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 9e-18
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 1e-17
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-17
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-17
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 1e-17
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 4e-17
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-16
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-15
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-15
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 2e-15
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 2e-15
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 2e-15
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-15
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 2e-15
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 5e-15
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 8e-15
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-14
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-14
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-13
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-13
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-13
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-13
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 5e-13
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 5e-13
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-13
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-13
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 1e-12
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 1e-12
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-12
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 3e-12
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 6e-12
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 7e-12
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-11
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-11
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-11
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 3e-11
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 3e-11
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 4e-11
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 7e-11
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-10
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 1e-10
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-10
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 5e-10
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 6e-10
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 4e-09
3rwl_A426 Structure Of P450pyr Hydroxylase Length = 426 2e-07
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 2e-07
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 3e-07
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 8e-07
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 9e-07
3pm0_A507 Structural Characterization Of The Complex Between 2e-06
3tkt_A450 Crystal Structure Of Cyp108d1 From Novosphingobium 2e-06
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 3e-06
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 8e-06
2whw_A436 Selective Oxidation Of Carbolide C-H Bonds By Engin 1e-05
2vz7_A436 Crystal Structure Of The Yc-17-Bound Pikc D50n Muta 1e-05
2bvj_A436 Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp1 1e-05
3dam_A473 Crystal Structure Of Allene Oxide Synthase Length = 2e-05
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 2e-05
3nc3_A441 Cyp134a1 Structure With A Closed Substrate Binding 3e-05
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 3e-05
2rch_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 3e-05
2rcm_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 3e-05
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 3e-05
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 4e-05
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 5e-05
3cy1_A396 Crystal Structure Of The Cytochrome P450 Cyp121 S27 5e-05
1n40_A396 Atomic Structure Of Cyp121, A Mycobacterial P450 Le 6e-05
4g1x_A395 Crystal Structure Of Mycobacterium Tuberculosis Cyp 6e-05
3cxz_A396 Crystal Structure Of Cytochrome P450 Cyp121 R386l M 7e-05
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 7e-05
3cxy_A396 Crystal Structure Of The Cytochrome P450 Cyp121 P34 7e-05
2iag_A482 Crystal Structure Of Human Prostacyclin Synthase Le 8e-05
3b6h_A498 Crystal Structure Of Human Prostacyclin Synthase In 8e-05
3cy0_A396 Crystal Structure Of Cytochrome P450 Cyp121 S237a M 8e-05
3cxv_A396 Crystal Structure Of The Cytochrome P450 Cyp121 A23 1e-04
3cxx_A396 Crystal Structure Of Cytochrome P450 Cyp121 F338h F 4e-04
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure

Iteration: 1

Score = 165 bits (417), Expect = 7e-41, Method: Compositional matrix adjust. Identities = 104/321 (32%), Positives = 169/321 (52%), Gaps = 10/321 (3%) Query: 26 QSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRXXXXXXXXX 85 + + +K+ G Y DVI ST FG+ I+SL NP F +K++ + Sbjct: 146 KPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFP 205 Query: 86 XXXXXRKFMSYMMLLRKAAYFFLDVVHQNVSYREQNNIK-RNDFINIMMELK-----KTD 139 + ++ + R+ F V + R ++ K R DF+ +M++ + ++ Sbjct: 206 FLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESH 265 Query: 140 PDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELT 199 +++ + AQ +F FAG++T+S+VL+F +YELA + +Q KL+ EI D T Sbjct: 266 KALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEI-DAVLPNKAPPT 324 Query: 200 YESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQLPNTDIVVDKGTKMFIPLYGLHHD 259 Y++ +M LD V+ E+LR++ +LERV + ++ + + KG + IP Y LH D Sbjct: 325 YDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEI--NGMFIPKGVVVMIPSYALHRD 382 Query: 260 PEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGLAHSLSNFE 319 P+ + P+ F PERF+ +N DNI Y Y PFG GPRNCIG RFAL+ +K L L NF Sbjct: 383 PKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFS 442 Query: 320 WDSDHTNEMFPLMETCGRNLE 340 + ++ PL + G L+ Sbjct: 443 FKPCKETQI-PLKLSLGGLLQ 462
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|3RWL|A Chain A, Structure Of P450pyr Hydroxylase Length = 426 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|2WHW|A Chain A, Selective Oxidation Of Carbolide C-H Bonds By Engineered Macrolide P450 Monooxygenase Length = 436 Back     alignment and structure
>pdb|2VZ7|A Chain A, Crystal Structure Of The Yc-17-Bound Pikc D50n Mutant Length = 436 Back     alignment and structure
>pdb|2BVJ|A Chain A, Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp107l1) Length = 436 Back     alignment and structure
>pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase Length = 473 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|3NC3|A Chain A, Cyp134a1 Structure With A Closed Substrate Binding Loop Length = 441 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 13(S)-Hod At 1.85 A Resolution Length = 495 Back     alignment and structure
>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 74a) At 1.73 A Resolution Length = 495 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|3CY1|A Chain A, Crystal Structure Of The Cytochrome P450 Cyp121 S279a Mutant From M. Tuberculosis Length = 396 Back     alignment and structure
>pdb|1N40|A Chain A, Atomic Structure Of Cyp121, A Mycobacterial P450 Length = 396 Back     alignment and structure
>pdb|4G1X|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp121 In Complex With 4-(1h-1,2,4-Triazol-1-Yl)quinolin-6-Amine Length = 395 Back     alignment and structure
>pdb|3CXZ|A Chain A, Crystal Structure Of Cytochrome P450 Cyp121 R386l Mutant From M. Tuberculosis Length = 396 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|3CXY|A Chain A, Crystal Structure Of The Cytochrome P450 Cyp121 P346l Mutant From M. Tuberculosis Length = 396 Back     alignment and structure
>pdb|2IAG|A Chain A, Crystal Structure Of Human Prostacyclin Synthase Length = 482 Back     alignment and structure
>pdb|3B6H|A Chain A, Crystal Structure Of Human Prostacyclin Synthase In Complex With Inhibitor Minoxidil Length = 498 Back     alignment and structure
>pdb|3CY0|A Chain A, Crystal Structure Of Cytochrome P450 Cyp121 S237a Mutant From Mycobacterium Tuberculosis Length = 396 Back     alignment and structure
>pdb|3CXV|A Chain A, Crystal Structure Of The Cytochrome P450 Cyp121 A233g Mutant From Mycobacterium Tuberculosis Length = 396 Back     alignment and structure
>pdb|3CXX|A Chain A, Crystal Structure Of Cytochrome P450 Cyp121 F338h From M. Tuberculosis Length = 396 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query489
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-146
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 7e-39
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-85
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-09
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 4e-85
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-11
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-84
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-07
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-79
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-04
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-76
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-10
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-76
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 6e-04
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-76
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-08
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-72
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-71
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-05
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-69
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-04
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-69
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-05
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-68
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-68
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 7e-04
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 8e-65
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 4e-54
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-54
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-49
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-46
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-32
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-32
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-32
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-31
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-31
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-30
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-30
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 8e-30
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-29
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-29
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 7e-14
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 9e-14
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 1e-13
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 1e-13
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 4e-13
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 4e-13
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 5e-13
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 6e-13
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 7e-13
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 7e-13
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 1e-12
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 1e-12
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 2e-12
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 2e-12
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-12
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 3e-12
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 4e-12
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 1e-11
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-11
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-11
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 2e-11
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 2e-11
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 2e-11
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 3e-11
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 4e-11
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 5e-11
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 6e-11
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 7e-11
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 8e-11
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 9e-11
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 2e-10
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 2e-10
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 3e-10
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-10
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 3e-10
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 3e-10
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 3e-10
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 3e-10
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-10
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 4e-10
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 6e-10
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 1e-09
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-09
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 1e-08
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 8e-07
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
 Score =  426 bits (1097), Expect = e-146
 Identities = 104/325 (32%), Positives = 170/325 (52%), Gaps = 11/325 (3%)

Query: 1   MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCE 60
           M P++   G  L   L      +  + + +K+  G Y  DVI ST FG+ I+SL NP   
Sbjct: 123 MVPIIAQYGDVLVRNLR--REAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDP 180

Query: 61  FRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMMLLRKAAYFFLDVVHQNVSYR-E 119
           F   +K++   +      + + +   +  + + ++  +  R+   F    V +    R E
Sbjct: 181 FVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLE 240

Query: 120 QNNIKRNDFINIMMELKKTDPD-----ITEELITAQCFLFFFAGFDTSSTVLTFSLYELA 174
                R DF+ +M++ + +        +++  + AQ  +F FAG++T+S+VL+F +YELA
Sbjct: 241 DTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELA 300

Query: 175 KNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPY 234
            +  +Q KL+ EI+          TY++  +M  LD V+ E+LR++    +LERV  +  
Sbjct: 301 THPDVQQKLQEEIDAVLPN-KAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDV 359

Query: 235 QLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGP 294
           ++    + + KG  + IP Y LH DP+ +  P+ F PERF+ +N DNI  Y Y PFG GP
Sbjct: 360 EIN--GMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGP 417

Query: 295 RNCIGKRFALLQLKSGLAHSLSNFE 319
           RNCIG RFAL+ +K  L   L NF 
Sbjct: 418 RNCIGMRFALMNMKLALIRVLQNFS 442


>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query489
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.97
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 98.7
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 98.63
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 98.45
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 98.42
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 98.4
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 98.36
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 98.36
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 98.25
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 98.25
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 98.21
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 98.2
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 98.18
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 98.09
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 98.09
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 98.07
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 98.03
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 98.03
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 98.02
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.01
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 97.95
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 97.89
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 97.78
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 97.76
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 97.68
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 97.61
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 97.55
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 97.51
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 97.48
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 97.48
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 97.43
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 97.38
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 97.36
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 97.35
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 97.34
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 97.34
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 97.32
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 97.32
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 97.32
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 97.29
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 97.26
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 97.22
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 97.21
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 97.19
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 97.15
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 97.15
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 97.14
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 97.14
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 97.12
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 97.11
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 97.01
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 96.97
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 96.92
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 96.83
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 96.7
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 96.64
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 96.61
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 96.61
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 96.59
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 96.58
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 96.52
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 96.45
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 96.44
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 96.42
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 96.29
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 96.14
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 95.45
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 95.22
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 95.14
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 94.84
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 94.82
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 94.52
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 94.31
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 94.22
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 92.71
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 92.2
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 84.63
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-52  Score=421.35  Aligned_cols=317  Identities=33%  Similarity=0.627  Sum_probs=257.6

Q ss_pred             ChhHHHHHHHHHHHHHHhhhcCCCCcceeHHHHHHHHHHHHHHHHHhcccCCCCCCCCchHHHHHHHHhccchhhHHHHH
Q psy14265          1 MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQII   80 (489)
Q Consensus         1 ~~p~i~~~~~~l~~~l~~~~~~~g~~~vdl~~~~~~~~~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (489)
                      |.|.+++.++.+++.|.+.. .+|+ ++|+..++..+++|+|+.++||.+++.+++....+......++..  ... ...
T Consensus       123 ~~~~i~~~~~~l~~~l~~~~-~~g~-~~d~~~~~~~~~~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~--~~~-~~~  197 (485)
T 3nxu_A          123 MVPIIAQYGDVLVRNLRREA-ETGK-PVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRF--DFL-DPF  197 (485)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH-HHTC-CEEHHHHHHHHHHHHHHHHHHSCCCCGGGCTTCHHHHHHTTSCCC--CTT-SHH
T ss_pred             HHHHHHHHHHHHHHHHHHHh-ccCC-cCcHHHHHHHHHHHHHHHHHcCCccccccCCCcHHHHHHHHHhch--hhH-HHH
Confidence            46889999999999998765 4577 899999999999999999999999988766666666665554432  110 011


Q ss_pred             HHHHHHhHHHHHHHHHH---HhHHHHHHHHHHHHHHHHHHHHHc-CCCcchHHHHHHHhhcC-----CCCCCHHHHHHHH
Q psy14265         81 LALILLIPYLRKFMSYM---MLLRKAAYFFLDVVHQNVSYREQN-NIKRNDFINIMMELKKT-----DPDITEELITAQC  151 (489)
Q Consensus        81 ~~~~~~~P~l~~~~~~~---~~~~~~~~~~~~~i~~~i~~~~~~-~~~~~d~l~~ll~~~~~-----~~~l~~~~i~~~~  151 (489)
                      ......+|++.......   ...+.....+...+++.++.+.+. .....|+++.|++...+     +..++++++.+++
T Consensus       198 ~~~~~~~p~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~l~~~ei~~~~  277 (485)
T 3nxu_A          198 FLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQS  277 (485)
T ss_dssp             HHHHHHCTTHHHHHHHTTCCSSCHHHHHHHHHHHHHHHHHHHHCC---CCCHHHHHHHHHC--------CCCHHHHHHHH
T ss_pred             HHHHHHhhhhHHHHHHhhhhhchHHHHHHHHHHHHHHHHHHHhccCCCcccHHHHHHHhhhccccccccCCCHHHHHHHH
Confidence            12334556544333221   112344555666666666655443 23457999999986532     2458999999999


Q ss_pred             hHHHhhhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhhhcCCCCChhhhcCChhHHHHHHhhhcCCCCccccccccC
Q psy14265        152 FLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAG  231 (489)
Q Consensus       152 ~~~~~aG~~tts~~l~~~l~~L~~~P~~q~~l~~Ei~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~~~~~~~~r~~~  231 (489)
                      +++++||+|||+++++|++++|++||++|++|++|++++++. ++.++++++.++|||+|||+|+||++|+++.++|.+.
T Consensus       278 ~~l~~AG~dTTa~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~-~~~~~~~~~~~lpyl~a~i~E~lRl~p~~~~~~R~~~  356 (485)
T 3nxu_A          278 IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-KAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCK  356 (485)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSTT-TCCCCHHHHHHCHHHHHHHHHHHHHSCSCSCEEEECC
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHhcc-CCCCCHHHHhcChHHHHHHHHHHhcCCCccCcceeeC
Confidence            999999999999999999999999999999999999999987 4679999999999999999999999999999999999


Q ss_pred             CCcccCCCceEecCCCEEEEcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCCcccCchHHHHHHHHHHH
Q psy14265        232 RPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGL  311 (489)
Q Consensus       232 ~~~~i~~~~~~ip~g~~v~~~~~~~~~~~~~~~~p~~f~p~R~~~~~~~~~~~~~~~~f~~g~~~c~G~~~a~~~~~~~~  311 (489)
                      +|++++|  +.||||+.|.++.|++||||++|+||++|+|+||++++........++|||.|+|.|+|+++|..|++.++
T Consensus       357 ~d~~i~g--~~Ip~Gt~V~~~~~~~~~d~~~~~dp~~F~PeR~l~~~~~~~~~~~~~pFg~G~r~C~G~~lA~~e~~~~l  434 (485)
T 3nxu_A          357 KDVEING--MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAL  434 (485)
T ss_dssp             SCEEETT--EEECTTCEEEECHHHHHTCTTTCSSTTSCCGGGGSHHHHTTSCTTTCCTTCCSTTSCTTHHHHHHHHHHHH
T ss_pred             CCeeECC--EEECCCCEEEEchHHhcCChhhcCCccCcCccccCCCccccCCCCCccCCCCCCcCCchHHHHHHHHHHHH
Confidence            9999988  99999999999999999999999999999999999765443456678999999999999999999999999


Q ss_pred             HHHhhccccccCCC
Q psy14265        312 AHSLSNFEWDSDHT  325 (489)
Q Consensus       312 ~~~~~~~~f~~~~~  325 (489)
                      +.++++|+|+....
T Consensus       435 ~~ll~~f~~~~~~~  448 (485)
T 3nxu_A          435 IRVLQNFSFKPCKE  448 (485)
T ss_dssp             HHHHTTEEEECCTT
T ss_pred             HHHHHhcEEEeCCC
Confidence            99999999987643



>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 489
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-47
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 6e-47
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-43
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-34
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-32
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 9e-22
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 4e-21
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 5e-21
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 5e-20
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-20
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-19
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-19
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 5e-18
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-17
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 5e-17
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 7e-17
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-16
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 4e-16
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 6e-15
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 8e-15
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-14
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score =  169 bits (427), Expect = 1e-47
 Identities = 61/337 (18%), Positives = 116/337 (34%), Gaps = 6/337 (1%)

Query: 1   MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCE 60
               +E   +     L       K   +D         +++I S VFG   +  +     
Sbjct: 111 GKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLR 170

Query: 61  FRRISKEMFTENNNMRLQIILALILLIPYLRKFMSYMM-LLRKAAYFFLDVVHQNVSYRE 119
              +  + F+  ++   Q+       + +       +   L++   F    V ++ +  +
Sbjct: 171 LLDLFFQSFSLISSFSSQVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD 230

Query: 120 QNNIKRND---FINIMMELKKTDPDITEELITAQCFLFFFAGFDTSSTVLTFSLYELAKN 176
            +N +       + +  +      +   + +       FFAG +T+ST L +    + K 
Sbjct: 231 PSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKY 290

Query: 177 KSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAGRPYQL 236
             +  +++ EI +           +   +MP  D VI E  R+   +             
Sbjct: 291 PHVTERVQKEI-EQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQ 349

Query: 237 PNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRN 296
                V+ K T++F  L    HDP  +  P+ F+P  F   N     N  ++PF  G R 
Sbjct: 350 FR-GYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALKRNEGFMPFSLGKRI 408

Query: 297 CIGKRFALLQLKSGLAHSLSNFEWDSDHTNEMFPLME 333
           C+G+  A  +L       L NF   S    E   L  
Sbjct: 409 CLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTP 445


>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query489
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.97
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.97
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.97
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.96
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 98.71
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 98.12
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 97.96
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 95.69
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 95.47
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 94.69
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 93.96
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 93.59
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 93.37
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 92.51
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 89.69
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 88.69
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 86.15
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 86.1
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 82.3
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2e-49  Score=397.46  Aligned_cols=317  Identities=33%  Similarity=0.614  Sum_probs=252.8

Q ss_pred             ChhHHHHHHHHHHHHHHhhhcCCCCcceeHHHHHHHHHHHHHHHHHhcccCCCCCCCCchHHHHHHHHhccchhhHHHHH
Q psy14265          1 MFPLMETCGRNLETILTTLDYNKKHQSIDVKEYLGRYMTDVIGSTVFGLEINSLENPDCEFRRISKEMFTENNNMRLQII   80 (489)
Q Consensus         1 ~~p~i~~~~~~l~~~l~~~~~~~g~~~vdl~~~~~~~~~dvi~~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (489)
                      +.|.+++.++.+++.|.+.. ..++ ++|+.+.+.++++++++.++||.+++.++.....+......+........   .
T Consensus       118 ~~~~~~~~~~~~~~~l~~~~-~~~~-~~dl~~~~~~~~~~v~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~  192 (472)
T d1tqna_         118 MVPIIAQYGDVLVRNLRREA-ETGK-PVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDP---F  192 (472)
T ss_dssp             THHHHHHHHHHHHHHHHHHH-HHSS-CEEHHHHHHHHHHHHHHHTSSCCCCCGGGCTTCHHHHHHTTCCCCCTTSH---H
T ss_pred             ccchhhhhhhcccccccccc-cccc-cchhhhhhhccchhhhhheecccccccccccchhhhHHHHHHhhhhhccc---h
Confidence            56899999999999998876 4677 89999999999999999999999998877766667666655443211111   1


Q ss_pred             HHHHHHhHHHHHHHHHHH---hHHHHHHHHHHHHHHHHHHHHHc-CCCcchHHHHHHHhhc-----CCCCCCHHHHHHHH
Q psy14265         81 LALILLIPYLRKFMSYMM---LLRKAAYFFLDVVHQNVSYREQN-NIKRNDFINIMMELKK-----TDPDITEELITAQC  151 (489)
Q Consensus        81 ~~~~~~~P~l~~~~~~~~---~~~~~~~~~~~~i~~~i~~~~~~-~~~~~d~l~~ll~~~~-----~~~~l~~~~i~~~~  151 (489)
                      ......+|++........   ..+.+.+.+...+....+...+. .....+..+.++....     ....++++++++++
T Consensus       193 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~~ei~~~~  272 (472)
T d1tqna_         193 FLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQS  272 (472)
T ss_dssp             HHHHHHCGGGHHHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCCCHHHHHHHHHCC----CCCCCCHHHHHHHH
T ss_pred             hcccccccccccccccccccccchhhhHHHHHHHHHhhhcccccccccccchhhhhhhcccccccccccchhhhHHHhhh
Confidence            122334454433322211   12233333333333332222211 1234566666665432     12579999999999


Q ss_pred             hHHHhhhhhhHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhhhcCCCCChhhhcCChhHHHHHHhhhcCCCCccccccccC
Q psy14265        152 FLFFFAGFDTSSTVLTFSLYELAKNKSIQSKLRNEINDTKAKYGGELTYESYNEMPLLDKVIKESLRMYTPLSQLERVAG  231 (489)
Q Consensus       152 ~~~~~aG~~tts~~l~~~l~~L~~~P~~q~~l~~Ei~~~~~~~~~~~~~~~~~~~~~l~a~i~E~lRl~~~~~~~~r~~~  231 (489)
                      +.+++||++||+++++|++++|++||++|+++|+||++++|. ...++.+++.++|||+|||+||+|++|+++.++|.+.
T Consensus       273 l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~-~~~~~~~~l~~~~~l~a~i~E~lRl~p~~~~~~r~~~  351 (472)
T d1tqna_         273 IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPN-KAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCK  351 (472)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTT-TCCCCHHHHHHCHHHHHHHHHHHHHCCTTCCEEEECC
T ss_pred             hhhhhcccccccccceeeccccccCccccccccceeheeccc-cccchHHHhhccccccceeeeccccCCcccccccccc
Confidence            999999999999999999999999999999999999999987 4678889999999999999999999999999999999


Q ss_pred             CCcccCCCceEecCCCEEEEcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCCcccCchHHHHHHHHHHH
Q psy14265        232 RPYQLPNTDIVVDKGTKMFIPLYGLHHDPEIYPNPDVFDPERFAPENADNIPNYAYLPFGEGPRNCIGKRFALLQLKSGL  311 (489)
Q Consensus       232 ~~~~i~~~~~~ip~g~~v~~~~~~~~~~~~~~~~p~~f~p~R~~~~~~~~~~~~~~~~f~~g~~~c~G~~~a~~~~~~~~  311 (489)
                      +|+.++|  |.||||+.|+++.+++|+||++|+||++|+||||++.+.....+..++|||.|+|.|||+++|..+++.++
T Consensus       352 ~d~~~~g--~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~l  429 (472)
T d1tqna_         352 KDVEING--MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAL  429 (472)
T ss_dssp             SCEEETT--EEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHHHHHHHH
T ss_pred             cCccccC--ceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCccChhHHHHHHHHHHHH
Confidence            9999988  99999999999999999999999999999999999876655567789999999999999999999999999


Q ss_pred             HHHhhccccccCCC
Q psy14265        312 AHSLSNFEWDSDHT  325 (489)
Q Consensus       312 ~~~~~~~~f~~~~~  325 (489)
                      +.++++|+|+....
T Consensus       430 a~ll~~f~~~~~~~  443 (472)
T d1tqna_         430 IRVLQNFSFKPCKE  443 (472)
T ss_dssp             HHHHTTEEEECCTT
T ss_pred             HHHHHhCEEEeCCC
Confidence            99999999997654



>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure