Psyllid ID: psy14325
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 359326585 | 204 | glutathione S transferase class sigma [B | 0.951 | 0.480 | 0.673 | 6e-34 | |
| 307196533 | 204 | Glutathione S-transferase [Harpegnathos | 0.980 | 0.495 | 0.633 | 1e-33 | |
| 6225491 | 204 | RecName: Full=Glutathione S-transferase; | 0.951 | 0.480 | 0.663 | 9e-33 | |
| 332030940 | 1068 | Glutathione S-transferase [Acromyrmex ec | 0.961 | 0.092 | 0.636 | 1e-32 | |
| 157361557 | 203 | glutathione s-transferase-like protein [ | 0.980 | 0.497 | 0.603 | 1e-32 | |
| 312382196 | 203 | hypothetical protein AND_05218 [Anophele | 0.980 | 0.497 | 0.613 | 1e-32 | |
| 157674467 | 203 | putative glutathione s-transferase [Lutz | 0.980 | 0.497 | 0.594 | 2e-32 | |
| 157130284 | 237 | glutathione s-transferase [Aedes aegypti | 0.980 | 0.426 | 0.613 | 3e-32 | |
| 296937144 | 203 | putative glutathione-S-transferase sigma | 0.980 | 0.497 | 0.584 | 3e-32 | |
| 157130282 | 203 | glutathione s-transferase [Aedes aegypti | 0.980 | 0.497 | 0.623 | 3e-32 |
| >gi|359326585|gb|AEV23881.1| glutathione S transferase class sigma [Blattella germanica] | Back alignment and taxonomy information |
|---|
Score = 147 bits (372), Expect = 6e-34, Method: Compositional matrix adjust.
Identities = 66/98 (67%), Positives = 79/98 (80%)
Query: 2 PSYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPALKPKMPFGKMPVLEVDGKQL 61
PSYKL YFP+K L EPIRF+LSY E+DFED R ++ +WP LKP MPFGK PVLE+DGKQ
Sbjct: 3 PSYKLTYFPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPKLKPSMPFGKTPVLEIDGKQT 62
Query: 62 HQSAAICRYLAKQCGLNGKDAWEDLQIDIAFETFNDFR 99
HQS AI RYL KQ GL+GKD WE+L+ID+ +T +DFR
Sbjct: 63 HQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFR 100
|
Source: Blattella germanica Species: Blattella germanica Genus: Blattella Family: Ectobiidae Order: Blattodea Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307196533|gb|EFN78063.1| Glutathione S-transferase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|6225491|sp|O18598.3|GST1_BLAGE RecName: Full=Glutathione S-transferase; AltName: Full=GST class-sigma; AltName: Full=Major allergen Bla g 5; AltName: Allergen=Bla g 5 | Back alignment and taxonomy information |
|---|
| >gi|332030940|gb|EGI70566.1| Glutathione S-transferase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|157361557|gb|ABV44736.1| glutathione s-transferase-like protein [Phlebotomus papatasi] | Back alignment and taxonomy information |
|---|
| >gi|312382196|gb|EFR27737.1| hypothetical protein AND_05218 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|157674467|gb|ABV60329.1| putative glutathione s-transferase [Lutzomyia longipalpis] | Back alignment and taxonomy information |
|---|
| >gi|157130284|ref|XP_001661870.1| glutathione s-transferase [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|296937144|gb|ADH94602.1| putative glutathione-S-transferase sigma [Phlebotomus perniciosus] | Back alignment and taxonomy information |
|---|
| >gi|157130282|ref|XP_001661869.1| glutathione s-transferase [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| FB|FBgn0010226 | 249 | GstS1 "Glutathione S transfera | 0.941 | 0.389 | 0.597 | 1.4e-30 | |
| UNIPROTKB|P91253 | 206 | gst-7 "Probable glutathione S- | 0.951 | 0.475 | 0.571 | 1.9e-26 | |
| UNIPROTKB|F1RWW2 | 201 | HPGDS "Uncharacterized protein | 0.951 | 0.487 | 0.540 | 5.9e-25 | |
| UNIPROTKB|P46436 | 206 | GST1 "Glutathione S-transferas | 0.951 | 0.475 | 0.551 | 1.6e-24 | |
| RGD|69251 | 199 | Hpgds "hematopoietic prostagla | 0.951 | 0.492 | 0.530 | 2e-24 | |
| MGI|MGI:1859384 | 199 | Hpgds "hematopoietic prostagla | 0.951 | 0.492 | 0.530 | 2.6e-24 | |
| UNIPROTKB|F1MGZ9 | 201 | HPGDS "Uncharacterized protein | 0.980 | 0.502 | 0.504 | 5.3e-24 | |
| UNIPROTKB|P91254 | 206 | gst-8 "Probable glutathione S- | 0.961 | 0.480 | 0.535 | 5.3e-24 | |
| UNIPROTKB|O60760 | 199 | HPGDS "Hematopoietic prostagla | 0.951 | 0.492 | 0.5 | 7.8e-23 | |
| WB|WBGene00001757 | 206 | gst-9 [Caenorhabditis elegans | 0.961 | 0.480 | 0.484 | 7e-22 |
| FB|FBgn0010226 GstS1 "Glutathione S transferase S1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
Identities = 58/97 (59%), Positives = 76/97 (78%)
Query: 3 SYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPALKPKMPFGKMPVLEVDGKQLH 62
SY L+YF +K LAEP+R++ +Y Q++ED+R+ +D WPALKP MP G+MPVLEVDGK++H
Sbjct: 49 SYTLFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVH 108
Query: 63 QSAAICRYLAKQCGLNGKDAWEDLQIDIAFETFNDFR 99
QS ++ R+LAK GL G WEDLQIDI +T NDFR
Sbjct: 109 QSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFR 145
|
|
| UNIPROTKB|P91253 gst-7 "Probable glutathione S-transferase 7" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWW2 HPGDS "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P46436 GST1 "Glutathione S-transferase 1" [Ascaris suum (taxid:6253)] | Back alignment and assigned GO terms |
|---|
| RGD|69251 Hpgds "hematopoietic prostaglandin D synthase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1859384 Hpgds "hematopoietic prostaglandin D synthase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MGZ9 HPGDS "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P91254 gst-8 "Probable glutathione S-transferase 8" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60760 HPGDS "Hematopoietic prostaglandin D synthase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001757 gst-9 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| cd03039 | 72 | cd03039, GST_N_Sigma_like, GST_N family, Class Sig | 2e-34 | |
| cd03076 | 73 | cd03076, GST_N_Pi, GST_N family, Class Pi subfamil | 8e-25 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 3e-21 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 3e-17 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 1e-11 | |
| cd03075 | 82 | cd03075, GST_N_Mu, GST_N family, Class Mu subfamil | 2e-11 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 3e-10 | |
| PTZ00057 | 205 | PTZ00057, PTZ00057, glutathione s-transferase; Pro | 4e-10 | |
| pfam13409 | 68 | pfam13409, GST_N_2, Glutathione S-transferase, N-t | 8e-09 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 8e-09 | |
| cd03077 | 79 | cd03077, GST_N_Alpha, GST_N family, Class Alpha su | 6e-08 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 8e-08 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 2e-06 | |
| cd03057 | 77 | cd03057, GST_N_Beta, GST_N family, Class Beta subf | 6e-06 | |
| PLN02473 | 214 | PLN02473, PLN02473, glutathione S-transferase | 7e-06 | |
| cd03055 | 89 | cd03055, GST_N_Omega, GST_N family, Class Omega su | 3e-05 | |
| cd03051 | 74 | cd03051, GST_N_GTT2_like, GST_N family, Saccharomy | 1e-04 | |
| cd03044 | 75 | cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu | 2e-04 | |
| cd03042 | 73 | cd03042, GST_N_Zeta, GST_N family, Class Zeta subf | 2e-04 | |
| cd03049 | 73 | cd03049, GST_N_3, GST_N family, unknown subfamily | 2e-04 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 3e-04 | |
| cd03078 | 73 | cd03078, GST_N_Metaxin1_like, GST_N family, Metaxi | 0.003 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 0.003 | |
| cd03054 | 72 | cd03054, GST_N_Metaxin, GST_N family, Metaxin subf | 0.003 |
| >gnl|CDD|239337 cd03039, GST_N_Sigma_like, GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
Score = 112 bits (283), Expect = 2e-34
Identities = 40/72 (55%), Positives = 53/72 (73%), Gaps = 2/72 (2%)
Query: 4 YKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPA--LKPKMPFGKMPVLEVDGKQL 61
YKL YF I+G EPIR +L+ ++ED+RI + WP LKP +PFG++PVLE+DGK+L
Sbjct: 1 YKLTYFNIRGRGEPIRLLLADAGVEYEDVRITYEEWPELDLKPTLPFGQLPVLEIDGKKL 60
Query: 62 HQSAAICRYLAK 73
QS AI RYLA+
Sbjct: 61 TQSNAILRYLAR 72
|
GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. Vertebrate class Sigma GSTs are characterized as GSH-dependent hematopoietic prostaglandin (PG) D synthases and are responsible for the production of PGD2 by catalyzing the isomerization of PGH2. The functions of PGD2 include the maintenance of body temperature, inhibition of platelet aggregation, bronchoconstriction, vasodilation and mediation of allergy and inflammation. Other class Sigma members include the class II insect GSTs, S-crystallins from cephalopods and 28-kDa GSTs from parasitic flatworms. Drosophila GST2 is associated with indirect flight muscle and exhibits preference for catalyzing GSH conjugation to lipid peroxidation products, indicating an anti-oxidant role. S-crystallin constitutes the major lens protein in cephalopod eyes and is responsible for lens transparency and proper refractive index. The 28-kDa GST from Schistosoma is a multifunctional enzyme, exhibiting GSH transferase, GSH peroxidase and PGD2 synthase activities, and may play an important role in host-parasite interactions. Also members are novel GSTs from the fungus Cunninghamella elegans, designated as class Gamma, and from the protozoan Blepharisma japonicum, described as a light-inducible GST. Length = 72 |
| >gnl|CDD|239374 cd03076, GST_N_Pi, GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239373 cd03075, GST_N_Mu, GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173353 PTZ00057, PTZ00057, glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239375 cd03077, GST_N_Alpha, GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|239353 cd03055, GST_N_Omega, GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239347 cd03049, GST_N_3, GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239376 cd03078, GST_N_Metaxin1_like, GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239352 cd03054, GST_N_Metaxin, GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.94 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.94 | |
| KOG1695|consensus | 206 | 99.93 | ||
| PLN02473 | 214 | glutathione S-transferase | 99.93 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.92 | |
| PLN02395 | 215 | glutathione S-transferase | 99.91 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.9 | |
| KOG0406|consensus | 231 | 99.9 | ||
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 99.9 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.9 | |
| KOG0868|consensus | 217 | 99.9 | ||
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 99.9 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.9 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 99.89 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 99.89 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 99.89 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.89 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 99.89 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 99.89 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.88 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.88 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 99.88 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 99.88 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 99.88 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 99.88 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 99.88 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 99.88 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 99.88 | |
| KOG0867|consensus | 226 | 99.88 | ||
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.87 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 99.87 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 99.87 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 99.87 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 99.87 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 99.86 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 99.86 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 99.86 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.86 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 99.86 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 99.86 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 99.85 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 99.85 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 99.85 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 99.85 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 99.84 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 99.82 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.82 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 99.81 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.79 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 99.79 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 99.79 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.78 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 99.77 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 99.64 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 99.62 | |
| KOG4420|consensus | 325 | 99.59 | ||
| PLN02907 | 722 | glutamate-tRNA ligase | 99.55 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.47 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.44 | |
| KOG3029|consensus | 370 | 99.37 | ||
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 99.36 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.33 | |
| KOG4244|consensus | 281 | 99.24 | ||
| KOG1422|consensus | 221 | 99.23 | ||
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.21 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.2 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.12 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 99.11 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 99.11 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.05 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.04 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 98.98 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 98.98 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 98.97 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.89 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.89 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 98.8 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 98.8 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 98.74 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 98.69 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 98.68 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 98.54 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 98.49 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 98.45 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 98.33 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 98.25 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 98.07 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.0 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 97.95 | |
| KOG3027|consensus | 257 | 97.89 | ||
| PRK10026 | 141 | arsenate reductase; Provisional | 97.79 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 97.76 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 97.74 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 97.74 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 97.72 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 97.64 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 97.54 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 97.53 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 97.49 | |
| KOG1752|consensus | 104 | 97.42 | ||
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 97.42 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 97.38 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 97.34 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 97.33 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 97.33 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 97.32 | |
| PRK10853 | 118 | putative reductase; Provisional | 97.16 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 97.1 | |
| PHA02125 | 75 | thioredoxin-like protein | 97.08 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 97.05 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 96.91 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 96.9 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 96.73 | |
| KOG3028|consensus | 313 | 96.45 | ||
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 96.42 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 96.18 | |
| KOG2903|consensus | 319 | 96.16 | ||
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 96.16 | |
| PF11287 | 112 | DUF3088: Protein of unknown function (DUF3088); In | 96.06 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 95.99 | |
| PF09635 | 122 | MetRS-N: MetRS-N binding domain; InterPro: IPR0182 | 95.78 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 95.76 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 95.22 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 94.6 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 94.09 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 93.61 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 93.44 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 92.75 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 92.17 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 91.95 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 91.73 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 91.47 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 91.44 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 91.21 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 90.82 | |
| KOG0911|consensus | 227 | 88.46 | ||
| PRK09381 | 109 | trxA thioredoxin; Provisional | 88.07 | |
| KOG2824|consensus | 281 | 87.45 | ||
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 87.2 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 87.14 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 87.09 | |
| PHA02278 | 103 | thioredoxin-like protein | 85.04 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 84.8 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 84.42 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 82.73 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 82.59 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 82.35 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 82.27 | |
| TIGR02681 | 108 | phage_pRha phage regulatory protein, rha family. M | 81.29 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 80.2 |
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
Probab=99.94 E-value=2.1e-26 Score=147.03 Aligned_cols=95 Identities=20% Similarity=0.198 Sum_probs=87.1
Q ss_pred ccEEEeeCCCCCcHHHHHHHHhcCCCcEEEEecCCC-ccccCCCCCCCCCceEEECCEEEeehHHHHHHHHHhcC---CC
Q psy14325 3 SYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDN-WPALKPKMPFGKMPVLEVDGKQLHQSAAICRYLAKQCG---LN 78 (103)
Q Consensus 3 ~~~Ly~~~~~~~~~~vr~~l~~~gi~~~~~~v~~~~-~~~~~~~~p~~~vP~l~~~~~~l~eS~aI~~yL~~~~~---l~ 78 (103)
++|||+++.|++|++||++|+++|++|+.+.++..+ .++|++.||.|+||+|+++|.+|+||.||++||+++++ +.
T Consensus 10 ~~~Ly~~~~s~~~~rv~~~L~e~gl~~e~~~v~~~~~~~~~~~~nP~g~VPvL~~~g~~l~ES~AIl~YL~~~~~~~~l~ 89 (211)
T PRK09481 10 VMTLFSGPTDIYSHQVRIVLAEKGVSVEIEQVEKDNLPQDLIDLNPYQSVPTLVDRELTLYESRIIMEYLDERFPHPPLM 89 (211)
T ss_pred eeEEeCCCCChhHHHHHHHHHHCCCCCEEEeCCcccCCHHHHHhCCCCCCCEEEECCEEeeCHHHHHHHHHHhCCCCCCC
Confidence 589999999999999999999999999999999865 45899999999999999999999999999999999985 78
Q ss_pred CCCHHHHHHHHHHHHHHHH
Q psy14325 79 GKDAWEDLQIDIAFETFND 97 (103)
Q Consensus 79 ~~~~~~~~~~~~~~~~~~~ 97 (103)
|.++.++++++.|+.++..
T Consensus 90 p~~~~~ra~~~~~~~~~~~ 108 (211)
T PRK09481 90 PVYPVARGESRLMMHRIEK 108 (211)
T ss_pred CCCHHHHHHHHHHHHHHHH
Confidence 8889999999999877653
|
|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >KOG1752|consensus | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11287 DUF3088: Protein of unknown function (DUF3088); InterPro: IPR021439 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >KOG0911|consensus | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG2824|consensus | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >TIGR02681 phage_pRha phage regulatory protein, rha family | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 103 | ||||
| 1m0u_A | 249 | Crystal Structure Of The Drosophila Glutathione S-T | 8e-34 | ||
| 1pd2_1 | 199 | Crystal Structure Of Hematopoietic Prostaglandin D | 2e-26 | ||
| 3kxo_A | 202 | An Orally Active Inhibitor Bound At The Active Site | 9e-25 | ||
| 2vcq_A | 199 | Complex Structure Of Prostaglandin D2 Synthase At 1 | 1e-24 | ||
| 4ec0_A | 200 | Crystal Structure Of Hh-Pgds With Water Displacing | 1e-24 | ||
| 3ee2_A | 199 | Structure Of Human Prostaglandin D-Synthase (Hgsts1 | 1e-24 | ||
| 2ws2_A | 204 | The 2 Angstrom Structure Of A Nu-Class Gst From Hae | 2e-24 | ||
| 2on7_A | 206 | Structure Of Nagst-1 Length = 206 | 3e-24 | ||
| 4edz_A | 199 | Crystal Structure Of Hh-Pgds With Water Displacing | 4e-24 | ||
| 4ee0_A | 199 | Crystal Structure Of Hh-Pgds With Water Displacing | 4e-24 | ||
| 1iyh_A | 198 | Crystal Structure Of Hematopoietic Prostaglandin D | 4e-24 | ||
| 1zl9_A | 207 | Crystal Structure Of A Major Nematode C.Elegans Spe | 1e-21 | ||
| 2on5_A | 206 | Structure Of Nagst-2 Length = 206 | 3e-21 | ||
| 1tw9_A | 206 | Glutathione Transferase-2, Apo Form, From The Nemat | 6e-20 | ||
| 1gsq_A | 202 | Three-Dimensional Structure, Catalytic Properties A | 9e-19 | ||
| 3t2u_A | 208 | Structure Of Wuchereria Bancrofti Pi-Class Glutathi | 4e-18 | ||
| 1yq1_A | 208 | Structural Genomics Of Caenorhabditis Elegans: Glut | 6e-17 | ||
| 1tu7_A | 208 | Structure Of Onchocerca Volvulus Pi-Class Glutathio | 4e-16 | ||
| 2wb9_A | 211 | Fasciola Hepatica Sigma Class Gst Length = 211 | 4e-13 | ||
| 2gsr_A | 207 | Structure Of Porcine Class Pi Glutathione S-Transfe | 8e-13 | ||
| 2oa7_A | 209 | Mouse C14a Glutathione-s-transferase Mutant In Comp | 2e-12 | ||
| 2hnl_A | 225 | Structure Of The Prostaglandin D Synthase From The | 5e-12 | ||
| 3o76_A | 209 | 1.8 Angstroms Molecular Structure Of Mouse Liver Gl | 5e-12 | ||
| 1gti_A | 209 | Modified Glutathione S-Transferase (Pi) Complexed W | 5e-12 | ||
| 2oad_A | 209 | Structure Of Glutathione-S-Transferase C169a Mutant | 6e-12 | ||
| 1glp_A | 209 | 1.8 Angstroms Molecular Structure Of Mouse Liver Cl | 6e-12 | ||
| 22gs_A | 210 | Human Glutathione S-Transferase P1-1 Y49f Mutant Le | 2e-10 | ||
| 17gs_A | 210 | Glutathione S-Transferase P1-1 Length = 210 | 2e-10 | ||
| 1u3i_A | 211 | Crystal Structure Of Glutathione S-Tranferase From | 3e-10 | ||
| 4pgt_A | 210 | Crystal Structure Of Hgstp1-1[v104] Complexed With | 4e-10 | ||
| 12gs_A | 210 | Glutathione S-transferase Complexed With S-nonyl-gl | 5e-10 | ||
| 2pgt_A | 210 | Crystal Structure Of Human Glutathione S-Transferas | 5e-10 | ||
| 2j9h_A | 209 | Crystal Structure Of Human Glutathione-S-Transferas | 8e-10 | ||
| 1oe7_A | 211 | 28kda Glutathione S-Transferase From Schistosoma Ha | 1e-09 | ||
| 1guk_A | 222 | Crystal Structure Of Murine Alpha-Class Gsta4-4 Len | 2e-09 | ||
| 1b48_A | 221 | Crystal Structure Of Mgsta4-4 In Complex With Gsh C | 2e-09 | ||
| 1px6_A | 209 | A Folding Mutant Of Human Class Pi Glutathione Tran | 2e-09 | ||
| 1px7_A | 209 | A Folding Mutant Of Human Class Pi Glutathione Tran | 2e-09 | ||
| 1gss_A | 209 | Three-Dimensional Structure Of Class Pi Glutathione | 2e-09 | ||
| 1kbn_A | 209 | Glutathione Transferase Mutant Length = 209 | 2e-09 | ||
| 1md3_A | 209 | A Folding Mutant Of Human Class Pi Glutathione Tran | 2e-09 | ||
| 3csi_A | 209 | Crystal Structure Of The Glutathione Transferase Pi | 2e-09 | ||
| 1eoh_A | 209 | Glutathione Transferase P1-1 Length = 209 | 2e-09 | ||
| 3hjm_A | 209 | Crystal Structure Of Human Glutathione Transferase | 2e-09 | ||
| 3km6_A | 209 | Crystal Structure Of The Human Gst Pi C47sY108V DOU | 2e-09 | ||
| 4gss_A | 209 | Human Glutathione S-Transferase P1-1 Y108f Mutant L | 2e-09 | ||
| 3ie3_A | 209 | Structural Basis For The Binding Of The Anti-Cancer | 2e-09 | ||
| 1md4_A | 209 | A Folding Mutant Of Human Class Pi Glutathione Tran | 2e-09 | ||
| 1lbk_A | 208 | Crystal Structure Of A Recombinant Glutathione Tran | 3e-09 | ||
| 2f8f_A | 211 | Crystal Structure Of The Y10f Mutant Of The Gluathi | 5e-09 | ||
| 2c8u_A | 211 | Structure Of R21q Mutant Of Sh28gst Length = 211 | 6e-09 | ||
| 1eog_A | 208 | Crystal Structure Of Pi Class Glutathione Transfera | 1e-08 | ||
| 2cai_A | 211 | Structure Of Glutathione-S-Transferase Mutant, R21l | 1e-08 | ||
| 1tdi_A | 222 | Crystal Structure Of Hgsta3-3 In Complex With Gluta | 3e-08 | ||
| 2aaw_A | 222 | Studies On Ligand Binding And Enzyme Inhibition Of | 4e-08 | ||
| 1okt_A | 211 | X-Ray Structure Of Glutathione S-Transferase From T | 4e-08 | ||
| 3fr6_A | 211 | Tetramerization And Cooperativity In Plasmodium Fal | 5e-08 | ||
| 3fr3_A | 208 | Tetramerization And Cooperativity In Plasmodium Fal | 5e-08 | ||
| 2r3x_A | 222 | Crystal Structure Of An R15l Hgsta1-1 Mutant Comple | 9e-08 | ||
| 1vf1_A | 229 | Cgsta1-1 In Complex With Glutathione Length = 229 | 1e-07 | ||
| 4acs_A | 222 | Crystal Structure Of Mutant Gst A2-2 With Enhanced | 1e-07 | ||
| 1ev4_A | 221 | Rat Glutathione S-transferase A1-1: Mutant W21f/f22 | 1e-07 | ||
| 1ev9_A | 221 | Rat Glutathione S-Transferase A1-1 Mutant W21f With | 1e-07 | ||
| 2vct_A | 222 | Glutathione Transferase A2-2 In Complex With Delta- | 2e-07 | ||
| 1f3b_A | 222 | Crystal Structure Of Mgsta1-1 In Complex With Gluta | 4e-07 | ||
| 1f3a_A | 222 | Crystal Structure Of Mgsta1-1 In Complex With Gsh L | 4e-07 | ||
| 1pkw_A | 222 | Crystal Structure Of Human Glutathione Transferase | 4e-07 | ||
| 1ydk_A | 222 | Crystal Structure Of The I219a Mutant Of Human Glut | 4e-07 | ||
| 1usb_A | 225 | Rational Design Of A Novel Enzyme - Efficient Thioe | 4e-07 | ||
| 3gtu_B | 224 | Ligand-Free Heterodimeric Human Glutathione S-Trans | 4e-07 | ||
| 1guh_A | 221 | Structure Determination And Refinement Of Human Alp | 4e-07 | ||
| 1ml6_A | 221 | Crystal Structure Of Mgsta2-2 In Complex With The G | 5e-07 | ||
| 1gse_A | 221 | Glutathione Transferase A1-1 Complexed With An Etha | 5e-07 | ||
| 6gsu_A | 217 | First-Sphere And Second-Sphere Electrostatic Effect | 6e-07 | ||
| 2r6k_A | 222 | Crystal Structure Of An I71v Hgsta1-1 Mutant In Com | 6e-07 | ||
| 3l0h_B | 222 | Crystal Structure Analysis Of W21a Mutant Of Human | 7e-07 | ||
| 1pl2_A | 222 | Crystal Structure Of Human Glutathione Transferase | 8e-07 | ||
| 1xwg_A | 221 | Human Gst A1-1 T68e Mutant Length = 221 | 8e-07 | ||
| 3zfl_A | 222 | Crystal Structure Of The V58a Mutant Of Human Class | 9e-07 | ||
| 3i69_A | 222 | Apo Glutathione Transferase A1-1 Gimf-Helix Mutant | 9e-07 | ||
| 1b4p_A | 217 | Crystal Structures Of Class Mu Chimeric Gst Isoenzy | 1e-06 | ||
| 3zfb_A | 222 | Crystal Structure Of The I75a Mutant Of Human Class | 1e-06 | ||
| 6gsv_A | 217 | First-Sphere And Second-Sphere Electrostatic Effect | 1e-06 | ||
| 1gsb_A | 217 | New Crystal Forms Of A Mu Class Glutathione S-Trans | 2e-06 | ||
| 1mtc_A | 217 | Glutathione Transferase Mutant Y115f Length = 217 | 2e-06 | ||
| 5fwg_A | 217 | Tetra-(5-Fluorotryptophanyl)-Glutathione Transferas | 2e-06 | ||
| 6gsw_A | 217 | First-Sphere And Second-Sphere Electrostatic Effect | 2e-06 | ||
| 2fhe_A | 216 | Fasciola Hepatica Glutathione S-Transferase Isoform | 2e-06 | ||
| 3q74_A | 221 | Crystal Structure Analysis Of The L7a Mutant Of The | 2e-06 | ||
| 3ktl_A | 221 | Crystal Structure Of An I71a Human Gsta1-1 Mutant I | 2e-06 | ||
| 3u6v_A | 222 | Crystal Structure Analysis Of L23a Mutant Of Human | 2e-06 | ||
| 2dc5_A | 231 | Crystal Structure Of Mouse Glutathione S-Transferas | 3e-06 | ||
| 1ags_A | 221 | A Surface Mutant (G82r) Of A Human Alpha-Glutathion | 3e-06 | ||
| 6gsx_A | 217 | First-sphere And Second-sphere Electrostatic Effect | 5e-06 | ||
| 1gsu_A | 219 | An Avian Class-Mu Glutathione S-Transferase, Cgstm1 | 5e-06 | ||
| 1c72_A | 219 | Tyr115, Gln165 And Trp209 Contribute To The 1,2-Epo | 6e-06 | ||
| 1hnb_A | 217 | Crystal Structure Of Human Class Mu Glutathione Tra | 7e-06 | ||
| 2gtu_A | 217 | Ligand-Free Human Glutathione S-Transferase M2-2 (E | 7e-06 | ||
| 2c4j_A | 218 | Human Glutathione-S-Transferase M2-2 T210s Mutant I | 7e-06 | ||
| 4gtu_A | 217 | Ligand-Free Homodimeric Human Glutathione S-Transfe | 3e-05 | ||
| 1gtu_A | 217 | Ligand-Free Human Glutathione S-Transferase M1a-1a | 6e-05 | ||
| 1yj6_A | 218 | Crystal Structure Of Human Glutathione S-Transferas | 6e-05 | ||
| 3iso_A | 218 | Crystal Structure Of 26 Kda Gst Of Clonorchis Sinen | 1e-04 | ||
| 1gul_A | 222 | Human Glutathione Transferase A4-4 Complex With Iod | 1e-04 | ||
| 3ubk_A | 242 | Crystal Structure Of Glutathione Transferase (Targe | 7e-04 |
| >pdb|1M0U|A Chain A, Crystal Structure Of The Drosophila Glutathione S-Transferase-2 In Complex With Glutathione Length = 249 | Back alignment and structure |
|
| >pdb|1PD2|1 Chain 1, Crystal Structure Of Hematopoietic Prostaglandin D Synthase Complex With Glutathione Length = 199 | Back alignment and structure |
| >pdb|3KXO|A Chain A, An Orally Active Inhibitor Bound At The Active Site Of Hpgds Length = 202 | Back alignment and structure |
| >pdb|2VCQ|A Chain A, Complex Structure Of Prostaglandin D2 Synthase At 1.95a. Length = 199 | Back alignment and structure |
| >pdb|4EC0|A Chain A, Crystal Structure Of Hh-Pgds With Water Displacing Inhibitor Length = 200 | Back alignment and structure |
| >pdb|3EE2|A Chain A, Structure Of Human Prostaglandin D-Synthase (Hgsts1-1) In Complex With Nocodazole Length = 199 | Back alignment and structure |
| >pdb|2WS2|A Chain A, The 2 Angstrom Structure Of A Nu-Class Gst From Haemonchus Contortus Length = 204 | Back alignment and structure |
| >pdb|2ON7|A Chain A, Structure Of Nagst-1 Length = 206 | Back alignment and structure |
| >pdb|4EDZ|A Chain A, Crystal Structure Of Hh-Pgds With Water Displacing Inhibitor Length = 199 | Back alignment and structure |
| >pdb|4EE0|A Chain A, Crystal Structure Of Hh-Pgds With Water Displacing Inhibitor Length = 199 | Back alignment and structure |
| >pdb|1IYH|A Chain A, Crystal Structure Of Hematopoietic Prostaglandin D Synthase Length = 198 | Back alignment and structure |
| >pdb|1ZL9|A Chain A, Crystal Structure Of A Major Nematode C.Elegans Specific Gst (Ce01613) Length = 207 | Back alignment and structure |
| >pdb|2ON5|A Chain A, Structure Of Nagst-2 Length = 206 | Back alignment and structure |
| >pdb|1TW9|A Chain A, Glutathione Transferase-2, Apo Form, From The Nematode Heligmosomoides Polygyrus Length = 206 | Back alignment and structure |
| >pdb|1GSQ|A Chain A, Three-Dimensional Structure, Catalytic Properties And Evolution Of A Sigma Class Glutathione Transferase From Squid, A Progenitor Of The Lens-Crystallins Of Cephalopods Length = 202 | Back alignment and structure |
| >pdb|3T2U|A Chain A, Structure Of Wuchereria Bancrofti Pi-Class Glutathione S-Transferase Length = 208 | Back alignment and structure |
| >pdb|1YQ1|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Glutathione S-Transferase Length = 208 | Back alignment and structure |
| >pdb|1TU7|A Chain A, Structure Of Onchocerca Volvulus Pi-Class Glutathione S-Transferase Length = 208 | Back alignment and structure |
| >pdb|2WB9|A Chain A, Fasciola Hepatica Sigma Class Gst Length = 211 | Back alignment and structure |
| >pdb|2GSR|A Chain A, Structure Of Porcine Class Pi Glutathione S-Transferase Length = 207 | Back alignment and structure |
| >pdb|2OA7|A Chain A, Mouse C14a Glutathione-s-transferase Mutant In Complex With S-hexyl Glutathione Length = 209 | Back alignment and structure |
| >pdb|2HNL|A Chain A, Structure Of The Prostaglandin D Synthase From The Parasitic Nematode Onchocerca Volvulus Length = 225 | Back alignment and structure |
| >pdb|3O76|A Chain A, 1.8 Angstroms Molecular Structure Of Mouse Liver Glutathione S- Transferase Mutant C47a Complexed With S-(P-Nitrobenzyl)glutathione Length = 209 | Back alignment and structure |
| >pdb|1GTI|A Chain A, Modified Glutathione S-Transferase (Pi) Complexed With S (P- Nitrobenzyl)glutathione Length = 209 | Back alignment and structure |
| >pdb|2OAD|A Chain A, Structure Of Glutathione-S-Transferase C169a Mutant Length = 209 | Back alignment and structure |
| >pdb|1GLP|A Chain A, 1.8 Angstroms Molecular Structure Of Mouse Liver Class Pi Glutathione S-Transferase Complexed With S-(P-Nitrobenzyl) Glutathione And Other Inhibitors Length = 209 | Back alignment and structure |
| >pdb|22GS|A Chain A, Human Glutathione S-Transferase P1-1 Y49f Mutant Length = 210 | Back alignment and structure |
| >pdb|17GS|A Chain A, Glutathione S-Transferase P1-1 Length = 210 | Back alignment and structure |
| >pdb|1U3I|A Chain A, Crystal Structure Of Glutathione S-Tranferase From Schistosoma Mansoni Length = 211 | Back alignment and structure |
| >pdb|4PGT|A Chain A, Crystal Structure Of Hgstp1-1[v104] Complexed With The Gsh Conjugate Of (+)-Anti-Bpde Length = 210 | Back alignment and structure |
| >pdb|12GS|A Chain A, Glutathione S-transferase Complexed With S-nonyl-glutathione Length = 210 | Back alignment and structure |
| >pdb|2PGT|A Chain A, Crystal Structure Of Human Glutathione S-Transferase P1- 1[v104] Complexed With (9r,10r)-9-(S-Glutathionyl)-10- Hydroxy-9,10-Dihydrophenanthrene Length = 210 | Back alignment and structure |
| >pdb|2J9H|A Chain A, Crystal Structure Of Human Glutathione-S-Transferase P1-1 Cys-Free Mutant In Complex With S-Hexylglutathione At 2.4 A Resolution Length = 209 | Back alignment and structure |
| >pdb|1OE7|A Chain A, 28kda Glutathione S-Transferase From Schistosoma Haematobium Length = 211 | Back alignment and structure |
| >pdb|1GUK|A Chain A, Crystal Structure Of Murine Alpha-Class Gsta4-4 Length = 222 | Back alignment and structure |
| >pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In Complex With Gsh Conjugate Of 4-Hydroxynonenal In One Subunit And Gsh In The Other: Evidence Of Signaling Across Dimer Interface In Mgsta4-4 Length = 221 | Back alignment and structure |
| >pdb|1PX6|A Chain A, A Folding Mutant Of Human Class Pi Glutathione Transferase, Created By Mutating Aspartate 153 Of The Wild-Type Protein To Asparagine Length = 209 | Back alignment and structure |
| >pdb|1PX7|A Chain A, A Folding Mutant Of Human Class Pi Glutathione Transferase, Created By Mutating Aspartate 153 Of The Wild-Type Protein To Glutamate Length = 209 | Back alignment and structure |
| >pdb|1GSS|A Chain A, Three-Dimensional Structure Of Class Pi Glutathione S-Transferase From Human Placenta In Complex With S-Hexylglutathione At 2.8 Angstroms Resolution Length = 209 | Back alignment and structure |
| >pdb|1KBN|A Chain A, Glutathione Transferase Mutant Length = 209 | Back alignment and structure |
| >pdb|1MD3|A Chain A, A Folding Mutant Of Human Class Pi Glutathione Transferase, Created By Mutating Glycine 146 Of The Wild-Type Protein To Alanine Length = 209 | Back alignment and structure |
| >pdb|3CSI|A Chain A, Crystal Structure Of The Glutathione Transferase Pi Allelic VariantC, I104vA113V, IN COMPLEX WITH THE CHLORAMBUCIL-Glutathione Conjugate Length = 209 | Back alignment and structure |
| >pdb|1EOH|A Chain A, Glutathione Transferase P1-1 Length = 209 | Back alignment and structure |
| >pdb|3HJM|A Chain A, Crystal Structure Of Human Glutathione Transferase Pi Y108v Mutant Length = 209 | Back alignment and structure |
| >pdb|3KM6|A Chain A, Crystal Structure Of The Human Gst Pi C47sY108V DOUBLE MUTANT IN Complex With The Ethacrynic Acid-Glutathione Conjugate Length = 209 | Back alignment and structure |
| >pdb|4GSS|A Chain A, Human Glutathione S-Transferase P1-1 Y108f Mutant Length = 209 | Back alignment and structure |
| >pdb|3IE3|A Chain A, Structural Basis For The Binding Of The Anti-Cancer Compound 6-(7- Nitro-2,1,3-Benzoxadiazol-4-Ylthio)hexanol (Nbdhex) To Human Glutathione S-Transferases Length = 209 | Back alignment and structure |
| >pdb|1MD4|A Chain A, A Folding Mutant Of Human Class Pi Glutathione Transferase, Created By Mutating Glycine 146 Of The Wild-Type Protein To Valine Length = 209 | Back alignment and structure |
| >pdb|1LBK|A Chain A, Crystal Structure Of A Recombinant Glutathione Transferase, Created By Replacing The Last Seven Residues Of Each Subunit Of The Human Class Pi Isoenzyme With The Additional C-Terminal Helix Of Human Class Alpha Isoenzyme Length = 208 | Back alignment and structure |
| >pdb|2F8F|A Chain A, Crystal Structure Of The Y10f Mutant Of The Gluathione S-Transferase From Schistosoma Haematobium Length = 211 | Back alignment and structure |
| >pdb|2C8U|A Chain A, Structure Of R21q Mutant Of Sh28gst Length = 211 | Back alignment and structure |
| >pdb|1EOG|A Chain A, Crystal Structure Of Pi Class Glutathione Transferase Length = 208 | Back alignment and structure |
| >pdb|2CAI|A Chain A, Structure Of Glutathione-S-Transferase Mutant, R21l, From Schistosoma Haematobium Length = 211 | Back alignment and structure |
| >pdb|1TDI|A Chain A, Crystal Structure Of Hgsta3-3 In Complex With Glutathione Length = 222 | Back alignment and structure |
| >pdb|2AAW|A Chain A, Studies On Ligand Binding And Enzyme Inhibition Of Plasmodium Falciparum Glutathione S-Transferase Length = 222 | Back alignment and structure |
| >pdb|1OKT|A Chain A, X-Ray Structure Of Glutathione S-Transferase From The Malarial Parasite Plasmodium Falciparum Length = 211 | Back alignment and structure |
| >pdb|3FR6|A Chain A, Tetramerization And Cooperativity In Plasmodium Falciparum Glutathione Transferase Are Mediated By The Atypic Loop 113-118 Length = 211 | Back alignment and structure |
| >pdb|3FR3|A Chain A, Tetramerization And Cooperativity In Plasmodium Falciparum Glutathione Transferase Are Mediated By The Atypic Loop 113-118 Length = 208 | Back alignment and structure |
| >pdb|2R3X|A Chain A, Crystal Structure Of An R15l Hgsta1-1 Mutant Complexed With S-Hexyl- Glutathione Length = 222 | Back alignment and structure |
| >pdb|1VF1|A Chain A, Cgsta1-1 In Complex With Glutathione Length = 229 | Back alignment and structure |
| >pdb|4ACS|A Chain A, Crystal Structure Of Mutant Gst A2-2 With Enhanced Catalytic Efficiency With Azathioprine Length = 222 | Back alignment and structure |
| >pdb|1EV4|A Chain A, Rat Glutathione S-transferase A1-1: Mutant W21f/f220y With Gso3 Bound Length = 221 | Back alignment and structure |
| >pdb|1EV9|A Chain A, Rat Glutathione S-Transferase A1-1 Mutant W21f With Gso3 Bound Length = 221 | Back alignment and structure |
| >pdb|2VCT|A Chain A, Glutathione Transferase A2-2 In Complex With Delta-4- Andostrene-3-17-Dione Length = 222 | Back alignment and structure |
| >pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1-1 In Complex With Glutathione Conjugate Of Benzo[a]pyrene Epoxide Length = 222 | Back alignment and structure |
| >pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1-1 In Complex With Gsh Length = 222 | Back alignment and structure |
| >pdb|1PKW|A Chain A, Crystal Structure Of Human Glutathione Transferase (Gst) A1-1 In Complex With Glutathione Length = 222 | Back alignment and structure |
| >pdb|1YDK|A Chain A, Crystal Structure Of The I219a Mutant Of Human Glutathione Transferase A1-1 With S-Hexylglutathione Length = 222 | Back alignment and structure |
| >pdb|1USB|A Chain A, Rational Design Of A Novel Enzyme - Efficient Thioester Hydrolysis Enabled By The Incorporation Of A Single His Residue Into Human Glutathione Transferase A1-1 Length = 225 | Back alignment and structure |
| >pdb|3GTU|B Chain B, Ligand-Free Heterodimeric Human Glutathione S-Transferase M2-3 (Ec 2.5.1.18), Monoclinic Crystal Form Length = 224 | Back alignment and structure |
| >pdb|1GUH|A Chain A, Structure Determination And Refinement Of Human Alpha Class Glutathione Transferase A1-1, And A Comparison With The Mu And Pi Class Enzymes Length = 221 | Back alignment and structure |
| >pdb|1ML6|A Chain A, Crystal Structure Of Mgsta2-2 In Complex With The Glutathione Conjugate Of Benzo[a]pyrene-7(R),8(S)-Diol- 9(S),10(R)-Epoxide Length = 221 | Back alignment and structure |
| >pdb|1GSE|A Chain A, Glutathione Transferase A1-1 Complexed With An Ethacrynic Acid Glutathione Conjugate (Mutant R15k) Length = 221 | Back alignment and structure |
| >pdb|6GSU|A Chain A, First-Sphere And Second-Sphere Electrostatic Effects In The Active Site Of A Class Mu Glutathione Transferase Length = 217 | Back alignment and structure |
| >pdb|2R6K|A Chain A, Crystal Structure Of An I71v Hgsta1-1 Mutant In Complex With S- Hexylglutathione Length = 222 | Back alignment and structure |
| >pdb|3L0H|B Chain B, Crystal Structure Analysis Of W21a Mutant Of Human Gsta1-1 In Complex With S-Hexylglutathione Length = 222 | Back alignment and structure |
| >pdb|1PL2|A Chain A, Crystal Structure Of Human Glutathione Transferase (Gst) A1- 1 T68e Mutant In Complex With Decarboxy-Glutathione Length = 222 | Back alignment and structure |
| >pdb|1XWG|A Chain A, Human Gst A1-1 T68e Mutant Length = 221 | Back alignment and structure |
| >pdb|3ZFL|A Chain A, Crystal Structure Of The V58a Mutant Of Human Class Alpha Glutathione Transferase In The Apo Form Length = 222 | Back alignment and structure |
| >pdb|3I69|A Chain A, Apo Glutathione Transferase A1-1 Gimf-Helix Mutant Length = 222 | Back alignment and structure |
| >pdb|1B4P|A Chain A, Crystal Structures Of Class Mu Chimeric Gst Isoenzymes M1-2 And M2-1 Length = 217 | Back alignment and structure |
| >pdb|3ZFB|A Chain A, Crystal Structure Of The I75a Mutant Of Human Class Alpha Glutathione Transferase In The Apo Form Length = 222 | Back alignment and structure |
| >pdb|6GSV|A Chain A, First-Sphere And Second-Sphere Electrostatic Effects In The Active Site Of A Class Mu Glutathione Transferase Length = 217 | Back alignment and structure |
| >pdb|1GSB|A Chain A, New Crystal Forms Of A Mu Class Glutathione S-Transferase From Rat Liver Length = 217 | Back alignment and structure |
| >pdb|1MTC|A Chain A, Glutathione Transferase Mutant Y115f Length = 217 | Back alignment and structure |
| >pdb|5FWG|A Chain A, Tetra-(5-Fluorotryptophanyl)-Glutathione Transferase Length = 217 | Back alignment and structure |
| >pdb|6GSW|A Chain A, First-Sphere And Second-Sphere Electrostatic Effects In The Active Site Of A Class Mu Glutathione Transferase Length = 217 | Back alignment and structure |
| >pdb|2FHE|A Chain A, Fasciola Hepatica Glutathione S-Transferase Isoform 1 In Complex With Glutathione Length = 216 | Back alignment and structure |
| >pdb|3Q74|A Chain A, Crystal Structure Analysis Of The L7a Mutant Of The Apo Form Of Human Alpha Class Glutathione Transferase Length = 221 | Back alignment and structure |
| >pdb|3KTL|A Chain A, Crystal Structure Of An I71a Human Gsta1-1 Mutant In Complex With S- Hexylglutathione Length = 221 | Back alignment and structure |
| >pdb|3U6V|A Chain A, Crystal Structure Analysis Of L23a Mutant Of Human Gst A1-1 Length = 222 | Back alignment and structure |
| >pdb|2DC5|A Chain A, Crystal Structure Of Mouse Glutathione S-Transferase, Mu7 (Gstm7) At 1.6 A Resolution Length = 231 | Back alignment and structure |
| >pdb|1AGS|A Chain A, A Surface Mutant (G82r) Of A Human Alpha-Glutathione S- Transferase Shows Decreased Thermal Stability And A New Mode Of Molecular Association In The Crystal Length = 221 | Back alignment and structure |
| >pdb|6GSX|A Chain A, First-sphere And Second-sphere Electrostatic Effects In The Active Site Of A Class Mu Glutathione Transferase Length = 217 | Back alignment and structure |
| >pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-Transferase, Cgstm1-1 At 1.94 Angstrom Resolution Length = 219 | Back alignment and structure |
| >pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contribute To The 1,2-Epoxy-3-(P- Nitrophenoxy)propane Conjugating Activities Of Glutathione S-Transferase Cgstm1-1 Length = 219 | Back alignment and structure |
| >pdb|1HNB|A Chain A, Crystal Structure Of Human Class Mu Glutathione Transferase Gstm2-2: Effects Of Lattice Packing On Conformational Heterogeneity Length = 217 | Back alignment and structure |
| >pdb|2GTU|A Chain A, Ligand-Free Human Glutathione S-Transferase M2-2 (E.C.2.5.1.18), Monoclinic Crystal Form Length = 217 | Back alignment and structure |
| >pdb|2C4J|A Chain A, Human Glutathione-S-Transferase M2-2 T210s Mutant In Complex With Glutathione-Styrene Oxide Conjugate Length = 218 | Back alignment and structure |
| >pdb|4GTU|A Chain A, Ligand-Free Homodimeric Human Glutathione S-Transferase M4-4 Length = 217 | Back alignment and structure |
| >pdb|1GTU|A Chain A, Ligand-Free Human Glutathione S-Transferase M1a-1a Length = 217 | Back alignment and structure |
| >pdb|1YJ6|A Chain A, Crystal Structure Of Human Glutathione S-Transferase M1a-1a Complexed With Glutathionyl-Zinc-Trihydroxide Length = 218 | Back alignment and structure |
| >pdb|3ISO|A Chain A, Crystal Structure Of 26 Kda Gst Of Clonorchis Sinensis In P3221 Symmetry Length = 218 | Back alignment and structure |
| >pdb|1GUL|A Chain A, Human Glutathione Transferase A4-4 Complex With Iodobenzyl Glutathione Length = 222 | Back alignment and structure |
| >pdb|3UBK|A Chain A, Crystal Structure Of Glutathione Transferase (Target Efi-501770) From Leptospira Interrogans Length = 242 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 5e-47 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 6e-47 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 9e-47 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 1e-46 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 2e-46 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 7e-46 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 1e-45 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 2e-45 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 5e-45 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 7e-45 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 3e-44 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 8e-44 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 3e-43 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 5e-43 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 7e-41 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 1e-40 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 2e-39 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 4e-39 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 1e-38 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 2e-38 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 3e-38 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 3e-38 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 2e-37 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 4e-37 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 8e-37 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 9e-37 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 5e-36 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 3e-35 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 1e-34 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 1e-10 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 4e-09 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 6e-09 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 8e-09 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 2e-08 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 9e-08 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 9e-08 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 9e-08 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 1e-07 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 1e-07 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 2e-07 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 2e-07 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-07 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 2e-07 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 2e-07 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 2e-07 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 3e-07 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 4e-07 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 5e-07 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 5e-07 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 6e-07 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 6e-07 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 6e-07 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 7e-07 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 7e-07 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 1e-06 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 1e-06 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 2e-06 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 3e-06 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 4e-06 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 5e-06 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 6e-06 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 1e-05 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 1e-05 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 1e-05 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 2e-05 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 2e-05 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 2e-05 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 2e-05 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 2e-05 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 3e-05 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 4e-05 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 4e-05 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 5e-05 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 5e-05 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 6e-05 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 8e-05 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 2e-04 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 2e-04 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 4e-04 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 5e-04 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 5e-04 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 7e-04 |
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
Score = 148 bits (375), Expect = 5e-47
Identities = 48/100 (48%), Positives = 70/100 (70%)
Query: 1 MPSYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPALKPKMPFGKMPVLEVDGKQ 60
M YKL YF I+G E R I + +Q+FED+R++K+ + +KP +PFG++PVLEVDGKQ
Sbjct: 1 MVHYKLTYFAIRGAGECARQIFALADQEFEDVRLDKEQFAKVKPDLPFGQVPVLEVDGKQ 60
Query: 61 LHQSAAICRYLAKQCGLNGKDAWEDLQIDIAFETFNDFRQ 100
L QS AICRYLA+Q G GK +++ +D + ++D+R
Sbjct: 61 LAQSLAICRYLARQFGFAGKSTFDEAVVDSLADQYSDYRV 100
|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.97 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.97 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.97 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 99.97 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.97 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 99.97 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.96 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.96 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.96 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.96 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.96 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.96 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.96 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.96 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 99.96 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.96 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.95 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.95 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 99.95 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.95 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.95 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.95 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.95 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 99.95 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 99.95 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 99.95 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 99.95 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 99.95 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 99.95 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 99.95 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 99.95 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.95 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 99.95 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.95 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.95 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.94 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 99.94 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 99.94 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 99.94 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 99.94 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 99.94 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.94 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 99.94 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.94 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.94 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 99.94 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 99.94 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.94 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 99.94 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.94 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 99.94 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.94 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 99.94 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.94 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.94 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 99.94 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 99.94 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 99.94 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 99.94 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.93 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.93 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 99.93 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.93 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.93 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 99.93 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.93 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 99.93 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 99.93 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.93 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 99.93 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.93 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.93 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 99.93 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.93 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.93 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 99.93 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.93 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.93 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.93 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.93 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 99.93 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 99.93 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 99.93 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 99.92 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.92 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.92 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.92 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.92 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.92 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.92 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.91 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.91 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.91 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.91 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.91 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.9 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.9 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.9 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.9 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.89 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.89 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.89 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.87 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 99.86 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.86 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.84 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 99.83 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.73 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.7 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.61 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.57 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.49 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.49 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.43 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.42 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.41 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.37 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.37 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 99.34 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.33 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.22 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.18 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.16 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.1 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.04 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 98.93 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 98.88 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 98.86 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.82 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 98.81 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 98.79 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 98.78 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 98.76 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 98.75 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 98.75 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 98.74 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 98.73 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 98.69 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 98.68 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 98.67 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 98.66 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.64 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 98.63 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 98.55 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.47 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 98.46 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 98.45 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 98.4 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 98.38 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 98.31 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.28 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 98.2 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 98.18 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 98.14 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.09 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 97.97 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 97.93 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 97.89 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.89 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 97.86 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.84 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 97.78 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 97.72 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 97.25 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 96.98 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 96.96 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 95.07 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 94.75 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 94.63 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 94.14 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 93.72 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 93.5 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 92.7 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 92.57 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 92.41 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 92.4 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 91.68 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 91.54 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 91.43 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 91.41 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 91.38 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 91.12 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 91.02 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 90.94 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 90.91 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 90.67 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 90.66 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 90.41 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 90.24 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 90.16 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 89.94 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 89.79 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 89.77 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 89.76 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 89.47 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 89.44 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 89.43 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 89.16 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 89.1 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 89.09 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 89.06 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 88.92 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 88.92 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 88.81 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 88.61 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 88.5 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 88.49 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 88.26 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 87.89 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 87.67 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 87.44 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 87.27 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 87.25 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 87.19 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 86.84 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 86.7 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 86.63 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 85.91 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 85.81 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 85.69 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 85.05 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 84.97 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 84.71 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 84.39 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 84.34 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 83.32 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 82.78 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 82.35 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 82.08 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 81.98 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 81.59 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 81.52 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 81.41 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 81.04 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 80.97 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 80.82 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 80.52 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 80.5 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 80.2 |
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
Probab=99.97 E-value=3.2e-30 Score=161.81 Aligned_cols=100 Identities=51% Similarity=0.898 Sum_probs=95.3
Q ss_pred CCccEEEeeCCCCCcHHHHHHHHhcCCCcEEEEecCCCccccCCCCCCCCCceEEECCEEEeehHHHHHHHHHhcCCCCC
Q psy14325 1 MPSYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPALKPKMPFGKMPVLEVDGKQLHQSAAICRYLAKQCGLNGK 80 (103)
Q Consensus 1 m~~~~Ly~~~~~~~~~~vr~~l~~~gi~~~~~~v~~~~~~~~~~~~p~~~vP~l~~~~~~l~eS~aI~~yL~~~~~l~~~ 80 (103)
||+++||+++.||+|++||++|+++|++|+.+.++.++++++++.||.|+||+|++||.+|+||.+|++||+++++++|.
T Consensus 1 m~~~~Ly~~~~s~~~~~v~~~L~~~gi~~e~~~v~~~~~~~~~~~~P~g~vP~L~~~g~~l~eS~aI~~yL~~~~~l~p~ 80 (204)
T 2ws2_A 1 MVHYKLTYFNGRGAAEIIRQVFVLAGQDYEDVRLTHEEWPKHKASMPFGQLPVLEVDGKQLPQSVAIVRYLARKFGYAGK 80 (204)
T ss_dssp CCCEEEEEESSSGGGHHHHHHHHHTTCCCEEEEECTTTGGGTGGGSTTSCSCEEEETTEEEESHHHHHHHHHHHHTCSCS
T ss_pred CCccEEEEeCCCchHHHHHHHHHHcCCCceEEEecHhhHHHhhhcCCCCCCCEEEECCEEeecHHHHHHHHHHHcCCCCC
Confidence 89999999999999999999999999999999999877789999999999999999999999999999999999999999
Q ss_pred CHHHHHHHHHHHHHHHHHHh
Q psy14325 81 DAWEDLQIDIAFETFNDFRQ 100 (103)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~ 100 (103)
++.+++++++|++++++++.
T Consensus 81 ~~~~~a~~~~~~~~~~~~~~ 100 (204)
T 2ws2_A 81 SAWEEAVVDSIADQFKDFLN 100 (204)
T ss_dssp SHHHHHHHHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999887654
|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 103 | ||||
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 4e-30 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 4e-28 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 5e-28 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 1e-27 | |
| d2gsqa2 | 75 | c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre | 2e-26 | |
| d1oe8a2 | 81 | c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc | 3e-24 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 1e-23 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 8e-23 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 5e-22 | |
| d1okta2 | 85 | c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm | 6e-21 | |
| d1fhea2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati | 1e-20 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 2e-20 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 3e-20 | |
| d1duga2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap | 4e-20 | |
| d2fnoa2 | 87 | c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 | 1e-19 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 3e-10 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 6e-10 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 2e-09 | |
| d1g7oa2 | 75 | c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli | 2e-09 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 4e-09 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 7e-09 | |
| d1nhya2 | 75 | c.47.1.5 (A:1-75) GST-like domain of elongation fa | 2e-08 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 6e-08 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 8e-08 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 2e-07 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 2e-07 | |
| d1eema2 | 98 | c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa | 7e-07 | |
| d1f2ea2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau | 2e-06 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 3e-06 | |
| d1v2aa2 | 83 | c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph | 2e-05 | |
| d1n2aa2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Escherichia coli | 5e-05 | |
| d1pmta2 | 80 | c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili | 6e-05 | |
| d1k0da2 | 92 | c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni | 1e-04 | |
| d1k0ma2 | 86 | c.47.1.5 (A:6-91) Chloride intracellular channel 1 | 8e-04 |
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Class sigma GST species: Heligmosomoides polygyrus [TaxId: 6339]
Score = 100 bits (250), Expect = 4e-30
Identities = 38/76 (50%), Positives = 51/76 (67%)
Query: 1 MPSYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPALKPKMPFGKMPVLEVDGKQ 60
M YKL YF +G E R + + +Q +ED+R+ ++ + LK PFG++PVLEVDG+Q
Sbjct: 1 MVHYKLTYFNGRGAGECARQVFALADQKYEDVRLTQETFVPLKATFPFGQVPVLEVDGQQ 60
Query: 61 LHQSAAICRYLAKQCG 76
L QS AICRYLAK G
Sbjct: 61 LAQSQAICRYLAKTFG 76
|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.95 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.95 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.95 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.95 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.95 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.95 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.94 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.94 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.94 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.94 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.94 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.94 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 99.93 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.93 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 99.93 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.93 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.93 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.93 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.93 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.92 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 99.92 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.92 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.92 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.92 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.91 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.91 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.91 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.91 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.9 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 99.89 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.87 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 99.86 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 99.85 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.24 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.07 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.06 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.0 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 98.62 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 98.56 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 98.46 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.46 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 98.22 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 98.07 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.81 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 97.37 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 97.06 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 96.97 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 96.87 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 96.43 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 96.4 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 96.22 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 93.64 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 92.66 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 91.51 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 89.8 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 89.78 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 88.36 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 88.34 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 86.9 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 85.74 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 85.23 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 85.15 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 84.98 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 83.61 | |
| d1pbya1 | 85 | Quinohemoprotein amine dehydrogenase A chain, doma | 83.47 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 83.11 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 82.39 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 81.53 |
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Glutathione S-transferase (GST), N-terminal domain domain: Class pi GST species: Onchocerca volvulus [TaxId: 6282]
Probab=99.95 E-value=1.7e-28 Score=132.51 Aligned_cols=76 Identities=46% Similarity=0.750 Sum_probs=72.8
Q ss_pred CCccEEEeeCCCCCcHHHHHHHHhcCCCcEEEEecCCCccccCCCCCCCCCceEEECCEEEeehHHHHHHHHHhcCC
Q psy14325 1 MPSYKLYYFPIKGLAEPIRFILSYMEQDFEDIRIEKDNWPALKPKMPFGKMPVLEVDGKQLHQSAAICRYLAKQCGL 77 (103)
Q Consensus 1 m~~~~Ly~~~~~~~~~~vr~~l~~~gi~~~~~~v~~~~~~~~~~~~p~~~vP~l~~~~~~l~eS~aI~~yL~~~~~l 77 (103)
|+ +|||||+.+++|++||++|+++|++|+.+.++..+++++++.+|+|+||+|+++|..++||.||++||++++|+
T Consensus 1 M~-~kL~Yf~~~g~~e~iRl~L~~~gi~~e~~~~~~~~~~~~~~~~p~g~lPvL~~~~~~l~qS~AI~~YLa~k~gL 76 (77)
T d1tu7a2 1 MS-YKLTYFSIRGLAEPIRLFLVDQDIKFIDDRIAKDDFSSIKSQFQFGQLPCLYDGDQQIVQSGAILRHLARKYNL 76 (77)
T ss_dssp CC-EEEEEESSSGGGHHHHHHHHHTTCCCEEEEECGGGSTTTGGGSTTSCSCEEEETTEEEESHHHHHHHHHHHTTC
T ss_pred Cc-eEEEecCCcHHHHHHHHHHHHcCCCceeeecccccchhhcccCCCCCCCEEEECCEEEEcHHHHHHHHHHHhCc
Confidence 66 89999999999999999999999999999999888889999999999999999999999999999999999986
|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pbya1 a.3.1.7 (A:1-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|