Psyllid ID: psy14413


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-
MWRADKTEIVSDHKKNTDKFYDLVSAYIEEMKARSNKTSSFSDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRALGRRL
cHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEccccEEEEEEEccccccccHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHcccEEEEEEcccEEEEEccHHHHHHHHHccccccccccHHHHHccccccc
cHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHccccccccccHccccEEEccEEcccccEEEEEEEEEcccccccccHHHccHHHHccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHcccccccccccccccEEEccEEcccccEEEEEEEEEcccccccccHHHccHHHHcccccccEccccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEccccccHHHccccccccccccccccEEEEEcEcccccccccEEEEEEcccEEEEEHHHHHcccccccccccccccccEHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEcHHHHHHHHcccccccccccHHHHHHHHcccc
MWRADKTEIVSDHKKNTDKFYDLVSAYIEEMKArsnktssfsddQLLVLLLDLFmagsettsnsLSFSVLYLIRYPHVQRKIQEEIDslnkeptildrykcpylEATIMEIMRhgntapigVAHRAMKtsrlgsyvipqdsiILVNLWSIMRdqehwgdpdvfrperfihptsgevlydetlipfgldpgyLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRsygqdsvedasihKYGLFSLVSVLGEDWWLVLRCGhtylderkvcqvptqpnlKKYLYANLVslggglpcdpedvknneDKIYSIAKRyggipagesngrrgYMLTYIIAYIRDFACdyyfigdsfetsvpwdkTVLLCINVKKRLTRECTDDQLLVLLLDLFmagsettsnsLSFSVLYLIRYPHVQRKIQEEIDslnkeptildrykcpylEATIMEIMRhgntapigVAHRAMKtsrlgsyvipqdsiILVNLWSIMRdqehwgdpdvfrperfihptsgevlydetlipfglgkrrclgepmaRTSLFIFLSSLLYHfnisipsdeplpavtvldgvtlapapykapgelypkqmrfsEKLSVFLLsyspldfwitgpllnlfkkshrlnvpgpswlpvVGCYLEFSRLLSKFKYHYLVCENYArrygpitglrlgrdrIILVSGFKAVREVLtrdefdgrpsgyfFRLRALGRRL
mwradkteivsdhkkntdkfYDLVSAYIEEMKArsnktssfsdDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEeidslnkeptildrYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAkryggipagesngrRGYMLTYIIAYIRDFACDYYFIGDSfetsvpwdkTVLLCINVKkrltrectDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEeidslnkeptildrYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIhptsgevlydeTLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRygpitglrlgrdrIILVSGFKAVrevltrdefdgrpsgyffrlralgrrl
MWRADKTEIVSDHKKNTDKFYDLVSAYIEEMKARSNKTSSFSddqllvllldlFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTddqllvllldlFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRALGRRL
******************KFYDLVSAYIE**************DQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRA*****
MWRADKTEIVSDHKKNTDKFYDLVSAYIE***************QLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLC***************LLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRALGR**
********IVSDHKKNTDKFYDLVSAYIEEMKARSNKTSSFSDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRALGRRL
MWRADKTEIVSDHKKNTDKFYDLVSAYIEEMKARSNKTSSFSDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSF*TSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRALGR*L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWRADKTEIVSDHKKNTDKFYDLVSAYIEEMKARSNKTSSFSDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLDPGYLELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMRSYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYANLVSLGGGLPCDPEDVKNNEDKIYSIAKRYGGIPAGESNGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSLNKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQMRFSEKLSVFLLSYSPLDFWITGPLLNLFKKSHRLNVPGPSWLPVVGCYLEFSRLLSKFKYHYLVCENYARRYGPITGLRLGRDRIILVSGFKAVREVLTRDEFDGRPSGYFFRLRALGRRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query711 2.2.26 [Sep-21-2011]
O73853514 Steroid 17-alpha-hydroxyl N/A N/A 0.286 0.396 0.408 7e-42
Q9CX98530 Cytochrome P450 2U1 OS=Mu yes N/A 0.333 0.447 0.365 2e-40
Q9VW43504 Probable cytochrome P450 yes N/A 0.277 0.390 0.4 9e-40
Q4V8D1530 Cytochrome P450 2U1 OS=Ra yes N/A 0.278 0.373 0.405 1e-39
Q7Z449544 Cytochrome P450 2U1 OS=Ho yes N/A 0.277 0.362 0.402 1e-39
P70085517 Steroid 17-alpha-hydroxyl N/A N/A 0.289 0.398 0.390 2e-39
Q0IIF9543 Cytochrome P450 2U1 OS=Bo yes N/A 0.275 0.360 0.402 5e-39
O57525519 Steroid 17-alpha-hydroxyl N/A N/A 0.286 0.393 0.384 8e-39
P12394508 Steroid 17-alpha-hydroxyl no N/A 0.288 0.403 0.398 1e-38
P00184524 Cytochrome P450 1A1 OS=Mu no N/A 0.293 0.398 0.380 2e-38
>sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 Back     alignment and function desciption
 Score =  172 bits (436), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/208 (40%), Positives = 129/208 (62%), Gaps = 4/208 (1%)

Query: 382 TDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDS---LNKEPTILDR 438
           TDD LL+ + D+F AG ETT+  L +S+LYLI +P VQRKIQEE+D+    ++ P + DR
Sbjct: 291 TDDHLLMTVGDIFGAGVETTTTVLKWSILYLIHHPQVQRKIQEELDAKIGRDRHPQVNDR 350

Query: 439 YKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWG 498
              PYLEATI E++R    +P+ + H A+  + +G Y + + + ++VNLWS+  D++ W 
Sbjct: 351 GNLPYLEATIREVLRIRPVSPLLIPHVALSDANIGEYTVQKGTRVIVNLWSLHHDEKEWK 410

Query: 499 DPDVFRPERFIHPTSGEVLYDE-TLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISI 557
           +P++F PERF++     +     + +PFG G R CLGE +A+  LF+FLS +L  F + +
Sbjct: 411 NPELFNPERFLNEEGNSLCCPSLSYLPFGAGVRVCLGEALAKLELFLFLSWILQRFTLEV 470

Query: 558 PSDEPLPAVTVLDGVTLAPAPYKAPGEL 585
           P  +PLP +     V L P  YK    L
Sbjct: 471 PGGQPLPELQGKFRVVLQPQKYKVIARL 498




Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction.
Ictalurus punctatus (taxid: 7998)
EC: 1EC: .EC: 1EC: 4EC: .EC: 9EC: 9EC: .EC: 9
>sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 Back     alignment and function description
>sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 Back     alignment and function description
>sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 Back     alignment and function description
>sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 Back     alignment and function description
>sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 Back     alignment and function description
>sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 Back     alignment and function description
>sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query711
326925473606 PREDICTED: cytochrome P450 2J2-like, par 0.738 0.866 0.287 3e-63
317383458484 methyl farnesoate epoxidase [Schistocerc 0.291 0.427 0.511 9e-58
42398143493 cytochrome P450 CYP15A1 [Diploptera punc 0.286 0.413 0.509 2e-56
225548287464 cytochrome p450 [Reticulitermes flavipes 0.291 0.446 0.478 3e-54
242004391503 cytochrome P-450, putative [Pediculus hu 0.277 0.391 0.492 3e-50
91079740492 PREDICTED: similar to cytochrome P450 CY 0.281 0.406 0.472 3e-50
170058686477 cytochrome P450 [Culex quinquefasciatus] 0.289 0.431 0.454 1e-49
225548285487 cytochrome p450 [Reticulitermes flavipes 0.279 0.408 0.458 7e-49
157126335498 cytochrome P450 [Aedes aegypti] gi|10888 0.292 0.417 0.433 2e-47
193589542494 PREDICTED: probable cytochrome P450 305a 0.258 0.372 0.452 1e-46
>gi|326925473|ref|XP_003208939.1| PREDICTED: cytochrome P450 2J2-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information
 Score =  249 bits (637), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 173/602 (28%), Positives = 282/602 (46%), Gaps = 77/602 (12%)

Query: 2   WRADK---TEIVSDHKKNTDKF--YDLVSAYIEEMKARSNKTSSFSDDQLLVLLLDLFMA 56
           WR  K    E +S HK++ +     D + +Y++EM   S +   F +D L+   LDL  A
Sbjct: 53  WRLMKGFVKEKISKHKEDLNPLESRDFIDSYLQEMTKPSGR--EFHEDNLVACTLDLLFA 110

Query: 57  GSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIMEIMR 113
           G+ETTS ++ +++LY+  YP +Q ++Q EID++    ++P + DR   PY  A I E+ R
Sbjct: 111 GTETTSTTIRWALLYMAVYPEIQARVQAEIDAVIGQCRQPALEDRNNMPYTNAVIHEVQR 170

Query: 114 HGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTS 173
             N  P  V   A+K + L  + +P+ +I++ NL S+M DQ+ W  P  F P  F+    
Sbjct: 171 KSNIIPFNVPREAVKDTVLAGFRVPKGTILISNLTSVMFDQKEWETPHSFNPGHFLK--D 228

Query: 174 GEVLYDETLIPFGLDPGYL--ELLTDGLKKLYVTKILGFRDDEMCAATVLFEAQFLDFMR 231
           G+    E  +PF +       ELL      L+ T +L     +    T+L       F  
Sbjct: 229 GQFWKREAFMPFSIGKRACLGELLARAELFLFFTALLQKFTFQAPRDTILXXXXXNPFNP 288

Query: 232 SYGQDSVEDASIHKYGLFSLVSVLGEDWWLVLRCGHTYLDERKVCQVPTQPNLKKYLYAN 291
               ++     I      +      ED+  +LR     +DE     V  Q  +   LY  
Sbjct: 289 HLKINNAVSNIICSVTFGNRFEYHDEDFQSLLR----MMDE----TVTLQGKIMSQLYNA 340

Query: 292 LVSLGGGLPCDPEDVKNNEDKIYS-----IAKRYGGIPAGESNGRRGYMLTYIIAYIRDF 346
             S+   LP   + +  N   + +     I+K    +   ES         +I +Y+++ 
Sbjct: 341 FPSIMKYLPGSHQTIFKNWKLMKNFVCNVISKHKEDLNPSESRD-------FIDSYLQEM 393

Query: 347 ACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLS 406
           A                           K    +  +D L+   LDL  AG+ETTS ++ 
Sbjct: 394 A---------------------------KHNGSDFCEDNLVACTLDLLFAGTETTSTTIR 426

Query: 407 FSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVA 463
           +++LY+  YP +Q ++Q EID++    ++P + DR   PY  A I E+ R  N  P+ V 
Sbjct: 427 WALLYMAMYPEIQARVQAEIDAVIGQCRQPALEDRNNMPYTNAVIHEVQRKSNIIPLNVP 486

Query: 464 HRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLI 523
            + +K + L  + +P+ ++++ N+ S+M D++ W  P  F P+ F+    G+    E  +
Sbjct: 487 RQTVKDTVLAGFRVPKGTVMIANISSVMFDKKEWETPHSFNPQHFLK--DGQFWKREAFM 544

Query: 524 PFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLD-----GVTLAPAP 578
           PF +GKR CLGE +AR  LF+F ++LL  F    P D      T+LD     G+TLAP P
Sbjct: 545 PFSIGKRACLGELLARAELFLFFTALLQKFTFQAPRD------TILDFKFTMGITLAPQP 598

Query: 579 YK 580
           YK
Sbjct: 599 YK 600




Source: Meleagris gallopavo

Species: Meleagris gallopavo

Genus: Meleagris

Family: Phasianidae

Order: Galliformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota

>gi|317383458|gb|ADV17351.1| methyl farnesoate epoxidase [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|42398143|gb|AAS13464.1| cytochrome P450 CYP15A1 [Diploptera punctata] Back     alignment and taxonomy information
>gi|225548287|gb|ACN93795.1| cytochrome p450 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|242004391|ref|XP_002423075.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212506006|gb|EEB10337.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91079740|ref|XP_970303.1| PREDICTED: similar to cytochrome P450 CYP15A1 [Tribolium castaneum] gi|270004816|gb|EFA01264.1| cytochrome P450 15A1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170058686|ref|XP_001865029.1| cytochrome P450 [Culex quinquefasciatus] gi|167877705|gb|EDS41088.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|225548285|gb|ACN93794.1| cytochrome p450 [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|157126335|ref|XP_001654600.1| cytochrome P450 [Aedes aegypti] gi|108882572|gb|EAT46797.1| AAEL002067-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|193589542|ref|XP_001952620.1| PREDICTED: probable cytochrome P450 305a1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query711
ZFIN|ZDB-GENE-040426-790532 cyp2p6 "cytochrome P450, famil 0.260 0.347 0.426 7.6e-39
RGD|1309433530 Cyp2u1 "cytochrome P450, famil 0.260 0.349 0.412 6.2e-38
UNIPROTKB|Q4V8D1530 Cyp2u1 "Cytochrome P450 2U1" [ 0.260 0.349 0.412 6.2e-38
ZFIN|ZDB-GENE-070730-1533 cyp2u1 "cytochrome P450, famil 0.260 0.347 0.402 8.1e-38
UNIPROTKB|F1PXL4548 CYP2U1 "Uncharacterized protei 0.260 0.337 0.412 2.9e-37
UNIPROTKB|E9PGH5335 CYP2U1 "Cytochrome P450 2U1" [ 0.260 0.552 0.412 8e-37
UNIPROTKB|Q7Z449544 CYP2U1 "Cytochrome P450 2U1" [ 0.260 0.340 0.412 8e-37
MGI|MGI:1918769530 Cyp2u1 "cytochrome P450, famil 0.260 0.349 0.402 1e-36
ZFIN|ZDB-GENE-110114-1506 cyp2r1 "cytochrome P450, famil 0.257 0.361 0.390 2.2e-36
MGI|MGI:2449771501 Cyp2r1 "cytochrome P450, famil 0.254 0.361 0.394 2.4e-36
ZFIN|ZDB-GENE-040426-790 cyp2p6 "cytochrome P450, family 2, subfamily P, polypeptide 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 406 (148.0 bits), Expect = 7.6e-39, Sum P(2) = 7.6e-39
 Identities = 81/190 (42%), Positives = 119/190 (62%)

Query:   394 FMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIME 450
             F+AG+ETTS +LS+S+LY+I+YP +Q K+QEEID +   +++P++ DR   PY  A I E
Sbjct:   339 FVAGTETTSTTLSWSLLYMIKYPEIQAKVQEEIDRVIGSSRQPSVSDRDNMPYTNAVIHE 398

Query:   451 IMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIH 510
             I R GN A + +   A+K  ++G Y+IP+ +I++ NL S++ D+  W  P  F P  F+ 
Sbjct:   399 IQRFGNIAALNLPRAAVKDIQVGKYLIPKGTIVIGNLTSVLFDESEWETPHSFNPGHFLD 458

Query:   511 PTSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLD 570
                G+    +  +PF LGKR CLGE +AR  LF+F +SLL HF  S P+    P+     
Sbjct:   459 -AEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSLLQHFTFSSPAGVE-PSFNYKL 516

Query:   571 GVTLAPAPYK 580
             G T AP P+K
Sbjct:   517 GTTRAPKPFK 526


GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016712 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IEA
RGD|1309433 Cyp2u1 "cytochrome P450, family 2, subfamily u, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V8D1 Cyp2u1 "Cytochrome P450 2U1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070730-1 cyp2u1 "cytochrome P450, family 2, subfamily U, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXL4 CYP2U1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGH5 CYP2U1 "Cytochrome P450 2U1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z449 CYP2U1 "Cytochrome P450 2U1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1918769 Cyp2u1 "cytochrome P450, family 2, subfamily u, polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110114-1 cyp2r1 "cytochrome P450, family 2, subfamily R, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2449771 Cyp2r1 "cytochrome P450, family 2, subfamily r, polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.14LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query711
pfam00067461 pfam00067, p450, Cytochrome P450 2e-53
pfam00067461 pfam00067, p450, Cytochrome P450 2e-40
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-32
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-30
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 7e-28
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 9e-28
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 8e-26
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 4e-25
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 8e-25
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 4e-24
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 5e-24
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 8e-24
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-22
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-22
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 9e-21
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-20
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-20
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 7e-20
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 1e-19
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 5e-19
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-18
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-18
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 3e-16
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 3e-16
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-15
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-14
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 4e-14
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 5e-14
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-13
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-12
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-11
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-11
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-11
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 4e-11
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 7e-11
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 9e-11
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 7e-09
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 2e-08
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-07
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-07
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 3e-07
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-06
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-06
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 7e-06
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-05
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 2e-05
pfam00067 461 pfam00067, p450, Cytochrome P450 3e-05
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 1e-04
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 2e-04
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 3e-04
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-04
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 5e-04
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 0.003
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
 Score =  190 bits (486), Expect = 2e-53
 Identities = 76/220 (34%), Positives = 129/220 (58%), Gaps = 4/220 (1%)

Query: 364 DKTVLLCINVKKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQ 423
           D    L +  ++    + TD++L   +L+LF AG++TTS++LS+++  L ++P VQ K++
Sbjct: 240 DFLDALLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTLSWALYELAKHPEVQEKLR 299

Query: 424 EEIDSL---NKEPTILDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQD 480
           EEID +    + PT  D    PYL+A I E +R     P+ +     K + +  Y+IP+ 
Sbjct: 300 EEIDEVIGDKRSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVIPGYLIPKG 359

Query: 481 SIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRRCLGEPMART 540
           ++++VNL+++ RD E + +P+ F PERF+   +G+       +PFG G R CLGE +AR 
Sbjct: 360 TLVIVNLYALHRDPEVFPNPEEFDPERFL-DENGKFRKSFAFLPFGAGPRNCLGERLARM 418

Query: 541 SLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYK 580
            + +FL++LL +F + +P     P +    G+ L P PYK
Sbjct: 419 EMKLFLATLLQNFEVELPPGTDPPDIDETPGLLLPPKPYK 458


Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461

>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 711
KOG0158|consensus499 100.0
KOG0156|consensus489 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
KOG0157|consensus497 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
KOG0159|consensus519 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0158|consensus499 100.0
KOG0156|consensus489 100.0
KOG0684|consensus486 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
KOG0159|consensus519 100.0
PLN02648480 allene oxide synthase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
KOG0157|consensus497 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
KOG0684|consensus486 99.98
PLN02302490 ent-kaurenoic acid oxidase 99.98
PLN02936489 epsilon-ring hydroxylase 99.97
PLN02987472 Cytochrome P450, family 90, subfamily A 99.97
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.97
PLN02648480 allene oxide synthase 99.95
KOG1233|consensus613 86.41
KOG0114|consensus124 83.46
>KOG0158|consensus Back     alignment and domain information
Probab=100.00  E-value=2.1e-51  Score=440.90  Aligned_cols=326  Identities=22%  Similarity=0.340  Sum_probs=250.2

Q ss_pred             eeeeeccCcchhhhhhh--------------------ccccccccc--c---cccCCchhHHHHHHHHHHhhcCCCCCCh
Q psy14413        249 FSLVSVLGEDWWLVLRC--------------------GHTYLDERK--V---CQVPTQPNLKKYLYANLVSLGGGLPCDP  303 (711)
Q Consensus       249 ~~l~~~~g~~~~~~~~~--------------------~~~~~~~~~--~---~~v~~~~~~~~~t~d~i~~~~fG~~~~~  303 (711)
                      .++....|+.|+.++..                    +..+++..+  .   .++++.++..+||.|+|++|+||++.+ 
T Consensus       116 ~~Lf~~~g~~WK~lR~~lsP~Fts~kmk~m~~t~~~~~~~l~~~l~~~~~~~~~~~~~dl~~~yT~DVI~~~AfG~~~~-  194 (499)
T KOG0158|consen  116 LNLFFLRGERWKRLRTKLSPTFTSGKLKKMFPTMEEVGDELVRHLRRKSEGGQEGEIKDLCARYTTDVIGSCAFGLDAN-  194 (499)
T ss_pred             cCchhccCchHHHHHHhhccccchhhHHHHHHHHHHHHHHHHHHHHHhhcccCCccHHHHHHHHHHHHHhHhhcccchh-
Confidence            35566789999977663                    222322211  1   368889999999999999999999987 


Q ss_pred             hhhhchhHHHHHHHHHhCCC-CCccc------------------ccccchhHHHHHHHHHHHHhhhhccCCCCCcCCCch
Q psy14413        304 EDVKNNEDKIYSIAKRYGGI-PAGES------------------NGRRGYMLTYIIAYIRDFACDYYFIGDSFETSVPWD  364 (711)
Q Consensus       304 ~~~~~~~~~~~~~~~~~~~~-~~~~~------------------~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~  364 (711)
                       ++.+..+.|..+.+..... .....                  .........++.+.+.+.++      .+......++
T Consensus       195 -s~~d~~~~F~~~~~~~~~~~~~~~~l~~~~~~~~p~l~~~l~~~~~~~~~~~~~~~~v~~~v~------~R~~~~~~r~  267 (499)
T KOG0158|consen  195 -SLRDPKAEFRRMGRRAFFLSRGLFPLKFMLIFLFPKLALPLRVKLFPEDVTDFFRKLVNSRVE------QREKENIERN  267 (499)
T ss_pred             -hhcCchHHHHHhhHHHHHHhhccchHhHhHHHHhHHHHHhhhcccChHHHHHHHHHHHHHHHH------HHHhcCCCCc
Confidence             7777777777665554322 11000                  00000111111222222111      1233345678


Q ss_pred             hHHHHHHHhhcc--cC---C-CCCHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHhCCchHHHHHHHHhhh--CCC-CCh
Q psy14413        365 KTVLLCINVKKR--LT---R-ECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL--NKE-PTI  435 (711)
Q Consensus       365 ~~~~~~~~~~~~--~~---~-~l~~~~l~~~~~~~~~aG~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~--~~~-~~~  435 (711)
                      |++++++..+..  .+   . .+|.++|+++++.+++||.||||++|++++|+|++||++|+|||+||+++  +.. +++
T Consensus       268 Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~lty  347 (499)
T KOG0158|consen  268 DFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTY  347 (499)
T ss_pred             hHHHHHHHhhcccccccccccccCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCH
Confidence            888888876642  11   1 59999999999999999999999999999999999999999999999999  333 999


Q ss_pred             hhhcCChhHHHHHHHHhcCCCCCCcccceecccccccC-CEEeCCCCEEEechhhhhcCCCCCCCCCCcccCCCCCCCCC
Q psy14413        436 LDRYKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLG-SYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSG  514 (711)
Q Consensus       436 ~~~~~lpyl~a~i~E~lRl~p~~~~~~~r~~~~d~~~~-g~~ip~Gt~V~~~~~~~~~d~~~~~~p~~F~P~Rfl~~~~~  514 (711)
                      +.+.+|+||++||+||||+||+++. +.|.+++|++++ ++.||||+.|.++++++||||++||||++|+||||.+++ .
T Consensus       348 d~l~~L~YLd~Vi~ETLR~yP~~~~-~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~-~  425 (499)
T KOG0158|consen  348 DSLSKLKYLDMVIKETLRLYPPAPF-LNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEEN-N  425 (499)
T ss_pred             HHHhCCcHHHHHHHHHHhhCCCccc-ccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCc-c
Confidence            9999999999999999999999995 999999999999 999999999999999999999999999999999999743 3


Q ss_pred             CCcCCCCccccCCCCCCCccHHHHHHHHHHHHHHHHHHceeeCCCCCCCCcccc-ccCeeecccC-cccceee
Q psy14413        515 EVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTV-LDGVTLAPAP-YKAPGEL  585 (711)
Q Consensus       515 ~~~~~~~~l~FG~G~r~C~G~~lA~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~-~~g~~~~p~~-~~~~~~~  585 (711)
                      +..++.+|+|||.|||+|+|++||.+|+|+.|++||++|+++..+ ...+.... ..+++..|.. ..+++..
T Consensus       426 ~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~-~t~~~~~~~~~~~~l~pk~gi~Lkl~~  497 (499)
T KOG0158|consen  426 KSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCP-TTIIPLEGDPKGFTLSPKGGIWLKLEP  497 (499)
T ss_pred             cccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCC-cccCcccCCccceeeecCCceEEEEEe
Confidence            366788999999999999999999999999999999999999877 33333211 2267777775 6555543



>KOG0156|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG1233|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query711
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 5e-38
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 5e-38
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-35
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 6e-35
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 3e-33
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 4e-06
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-32
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-32
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 6e-32
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 7e-32
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 7e-32
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 8e-32
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 3e-31
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 7e-31
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 5e-05
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 1e-30
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-30
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-05
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-30
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-05
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-29
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-05
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-29
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-05
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-29
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-05
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-29
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-05
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 4e-29
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 6e-28
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-27
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 8e-27
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-04
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 9e-27
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 9e-26
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 6e-04
3pm0_A507 Structural Characterization Of The Complex Between 9e-25
4bca_A658 Mammalian Alkyldihydroxyacetonephosphate Synthase: 2e-24
4bby_A658 Mammalian Alkyldihydroxyacetonephosphate Synthase: 2e-24
4bc7_A658 Mammalian Alkyldihydroxyacetonephosphate Synthase: 2e-24
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 3e-17
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-15
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-15
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-15
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-15
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-15
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 4e-15
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 4e-15
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-15
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 5e-15
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 5e-15
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 5e-15
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 5e-15
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 5e-15
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 5e-15
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 5e-15
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-15
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 6e-15
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 8e-15
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-14
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-14
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-14
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-14
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-14
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-14
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-14
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-14
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-14
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-14
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-14
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-14
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-14
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 2e-14
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 2e-14
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-14
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-14
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 2e-14
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-14
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-14
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-14
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-14
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 6e-14
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 6e-14
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 1e-13
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-13
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 9e-12
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 3e-10
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 8e-09
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 3e-08
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 3e-08
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 4e-08
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 4e-08
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 5e-08
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 6e-08
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 7e-08
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 7e-08
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 1e-07
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-07
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 1e-07
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 1e-07
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 2e-07
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 2e-07
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 4e-07
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 2e-06
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 2e-06
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 5e-06
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 6e-06
1ulw_A402 Crystal Structure Of P450nor Ser73gly/ser75gly Muta 7e-06
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 7e-06
1xqd_A403 Crystal Structure Of P450nor Complexed With 3- Pyri 8e-06
1cl6_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 8e-06
1ehe_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 8e-06
1jfb_A404 X-Ray Structure Of Nitric Oxide Reductase (Cytochro 8e-06
1cmj_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 1e-05
1cmn_A402 Crystal Structures Of Ferric-No Complexes Of Fungal 1e-05
1ehf_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 1e-05
1ehg_A403 Crystal Structures Of Cytochrome P450nor And Its Mu 1e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 1e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 1e-05
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-05
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-05
4dnz_A410 The Crystal Structures Of Cyp199a4 Length = 410 1e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 1e-05
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 2e-05
1f25_A402 Crystal Structure Of No Complex Of Thr243asn Mutant 3e-05
1f24_A402 Crystal Structure Of No Complex Of Thr243ala Mutant 3e-05
1f26_A402 Crystal Structure Of No Complex Of Thr243val Mutant 3e-05
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 4e-05
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 7e-05
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 8e-05
2z36_A413 Crystal Structure Of Cytochrome P450 Moxa From Nono 2e-04
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 3e-04
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 4e-04
3cv8_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-04
2zbx_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-04
2zby_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-04
3cv9_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-04
3rwl_A426 Structure Of P450pyr Hydroxylase Length = 426 7e-04
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 8e-04
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure

Iteration: 1

Score = 155 bits (393), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 74/188 (39%), Positives = 123/188 (65%), Gaps = 5/188 (2%) Query: 395 MAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIMEI 451 +AG+ETT+N L +++L++ YP++Q ++Q+EID + N +P+ D+ K PY EA + E+ Sbjct: 283 IAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEV 342 Query: 452 MRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHP 511 +R N P+G+ H + + + Y IP+ + ++ NL+S+ D+++W DP+VF PERF+ Sbjct: 343 LRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFL-D 401 Query: 512 TSGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDG 571 +SG E L+PF LG+R CLGE +AR +F+F ++LL F++ P E +P + G Sbjct: 402 SSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPH-ELVPDLKPRLG 460 Query: 572 VTLAPAPY 579 +TL P PY Sbjct: 461 MTLQPQPY 468
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|4BCA|A Chain A, Mammalian Alkyldihydroxyacetonephosphate Synthase: Tyr578phe Mutant Length = 658 Back     alignment and structure
>pdb|4BBY|A Chain A, Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type Length = 658 Back     alignment and structure
>pdb|4BC7|A Chain A, Mammalian Alkyldihydroxyacetonephosphate Synthase: Arg419his Mutant Length = 658 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|1ULW|A Chain A, Crystal Structure Of P450nor Ser73gly/ser75gly Mutant Length = 402 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|1XQD|A Chain A, Crystal Structure Of P450nor Complexed With 3- Pyridinealdehyde Adenine Dinucleotide Length = 403 Back     alignment and structure
>pdb|1CL6|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Its Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1EHE|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1JFB|A Chain A, X-Ray Structure Of Nitric Oxide Reductase (Cytochrome P450nor) In The Ferric Resting State At Atomic Resolution Length = 404 Back     alignment and structure
>pdb|1CMJ|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1CMN|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 Back     alignment and structure
>pdb|1EHF|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|1EHG|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|4DNZ|A Chain A, The Crystal Structures Of Cyp199a4 Length = 410 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|1F25|A Chain A, Crystal Structure Of No Complex Of Thr243asn Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1F24|A Chain A, Crystal Structure Of No Complex Of Thr243ala Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|1F26|A Chain A, Crystal Structure Of No Complex Of Thr243val Mutants Of Cytochrome P450nor Length = 402 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|2Z36|A Chain A, Crystal Structure Of Cytochrome P450 Moxa From Nonomuraea Recticatena (Cyp105) Length = 413 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|3CV8|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84f Mutant) Length = 412 Back     alignment and structure
>pdb|2ZBX|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (Wild Type) With Imidazole Bound Length = 412 Back     alignment and structure
>pdb|2ZBY|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84a Mutant) Length = 412 Back     alignment and structure
>pdb|3CV9|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R73aR84A MUTANT) IN COMPLEX WITH 1ALPHA,25- Dihydroxyvitamin D3 Length = 412 Back     alignment and structure
>pdb|3RWL|A Chain A, Structure Of P450pyr Hydroxylase Length = 426 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query711
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-82
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-61
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-15
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-81
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 9e-66
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-15
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-80
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-64
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-15
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-79
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 9e-65
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-13
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-78
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-61
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-13
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 7e-77
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 6e-60
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-10
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 8e-77
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 6e-64
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-14
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-76
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-64
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-14
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-76
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-63
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-14
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 6e-76
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-64
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-14
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-57
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 5e-46
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-08
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-45
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-37
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-05
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-43
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-33
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-08
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-42
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-32
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-05
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-41
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-31
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-06
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-41
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 9e-32
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 5e-07
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 9e-41
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 4e-34
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 9e-07
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 4e-36
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 5e-30
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 3e-07
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-35
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-26
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 9e-35
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-28
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-05
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-34
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-26
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 6e-08
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 7e-34
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-28
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-05
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-33
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-25
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-05
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 5e-32
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 9e-23
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 6e-32
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-27
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-27
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-19
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-24
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-21
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-21
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-19
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-21
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-17
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 4e-16
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 8e-11
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 6e-16
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 2e-10
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 1e-15
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 1e-10
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 2e-15
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 8e-10
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-15
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-10
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 3e-15
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 8e-11
2uuu_A584 Alkyldihydroxyacetonephosphate synthase; transfera 2e-14
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 4e-14
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 3e-09
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 5e-14
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 7e-10
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 5e-14
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 3e-10
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 7e-14
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 1e-09
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 1e-13
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 3e-10
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 1e-13
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 8e-09
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 2e-13
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 8e-10
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-13
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-09
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 2e-13
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 2e-09
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 3e-13
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 1e-09
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 3e-13
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 8e-10
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-13
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 8e-09
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 4e-13
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 2e-09
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 4e-13
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 5e-09
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 5e-13
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 2e-08
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 7e-13
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 1e-09
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 8e-13
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-09
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 9e-13
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 6e-10
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 1e-12
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 4e-09
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 1e-12
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 1e-08
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-12
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 5e-09
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 3e-12
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 4e-09
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 3e-12
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 3e-09
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 3e-12
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 1e-09
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 3e-12
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-09
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-12
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 4e-09
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 3e-12
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-08
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 3e-12
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 4e-10
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-12
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 8e-07
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 6e-12
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 4e-07
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 6e-12
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 9e-08
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 7e-12
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 1e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 9e-12
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 2e-08
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 1e-11
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 1e-07
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 2e-11
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 3e-07
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 4e-11
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 8e-07
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 6e-11
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 7e-07
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 7e-11
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 1e-07
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 7e-11
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 1e-06
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 3e-09
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
 Score =  269 bits (691), Expect = 1e-82
 Identities = 70/204 (34%), Positives = 124/204 (60%), Gaps = 6/204 (2%)

Query: 382 TDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDS---LNKEPTILDR 438
           +D+ +L  + D+F AG ETT++ + +++ +L+  P V++K+ EEID     ++ PTI DR
Sbjct: 270 SDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDR 329

Query: 439 YKCPYLEATIMEIMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWG 498
            +   LEATI E++R    AP+ + H+A   S +G + + + + +++NLW++  +++ W 
Sbjct: 330 NRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWH 389

Query: 499 DPDVFRPERFIHPTSGEVLYD--ETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNIS 556
            PD F PERF++P +G  L     + +PFG G R C+GE +AR  LF+ ++ LL  F++ 
Sbjct: 390 QPDQFMPERFLNP-AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLE 448

Query: 557 IPSDEPLPAVTVLDGVTLAPAPYK 580
           +P D  LP++  +  V      +K
Sbjct: 449 VPDDGQLPSLEGIPKVVFLIDSFK 472


>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2uuu_A Alkyldihydroxyacetonephosphate synthase; transferase, lavoprotein, lipid synthesis, peroxisomal disor; HET: FAD PL3; 1.95A {Dictyostelium discoideum} PDB: 2uuv_A* Length = 584 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query711
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.98
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.97
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.97
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.97
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.97
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.97
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.97
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.97
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.97
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.97
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.97
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.97
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.97
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.97
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.97
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.97
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.97
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.97
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.97
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.97
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.97
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.97
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.97
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.97
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.97
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.97
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.97
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.97
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.96
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.96
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.96
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.96
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.96
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.96
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.96
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.96
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.96
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.96
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.96
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.96
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.96
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.96
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.96
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.96
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.96
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.96
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.96
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.96
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.96
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.96
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.95
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.95
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.95
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.95
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.93
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.92
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 86.92
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=9.8e-47  Score=420.64  Aligned_cols=214  Identities=35%  Similarity=0.682  Sum_probs=195.2

Q ss_pred             cccCCCCCHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHhCCchHHHHHHHHhhh---CCCCChhhhcCChhHHHHHHHH
Q psy14413        375 KRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIMEI  451 (711)
Q Consensus       375 ~~~~~~l~~~~l~~~~~~~~~aG~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~---~~~~~~~~~~~lpyl~a~i~E~  451 (711)
                      ......++++++.+++.++++||+|||+++++|++++|++||++|+|+++|++.+   ++.++.+++.+||||+|||+|+
T Consensus       262 ~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~Et  341 (479)
T 3tbg_A          262 GNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEV  341 (479)
T ss_dssp             TCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHH
T ss_pred             cCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeee
Confidence            3455679999999999999999999999999999999999999999999999988   5678999999999999999999


Q ss_pred             hcCCCCCCcccceecccccccCCEEeCCCCEEEechhhhhcCCCCCCCCCCcccCCCCCCCCCCCcCCCCccccCCCCCC
Q psy14413        452 MRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKRR  531 (711)
Q Consensus       452 lRl~p~~~~~~~r~~~~d~~~~g~~ip~Gt~V~~~~~~~~~d~~~~~~p~~F~P~Rfl~~~~~~~~~~~~~l~FG~G~r~  531 (711)
                      ||++|++|...+|.+.+|++++||.|||||.|.++.+++||||++|+||++|+||||++ +++....+.+|+|||+|+|+
T Consensus       342 lRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~-~~~~~~~~~~~~pFG~G~R~  420 (479)
T 3tbg_A          342 QRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLD-AQGHFVKPEAFLPFSAGRRA  420 (479)
T ss_dssp             HHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBC-TTCCBCCCTTCCTTCCSTTS
T ss_pred             ccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCC-CCcccCCCCceecCCCCCcC
Confidence            99999999888888899999999999999999999999999999999999999999998 44555567889999999999


Q ss_pred             CccHHHHHHHHHHHHHHHHHHceeeCCCCCCCCccccccCeeecccCcccceeecccc
Q psy14413        532 CLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELYPKQ  589 (711)
Q Consensus       532 C~G~~lA~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~g~~~~p~~~~~~~~~~~~~  589 (711)
                      |+|++||.+|++++++.||++|+|+++++.+.+......+++..|.+++++++-|...
T Consensus       421 C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P~~~~v~~~pRs~~  478 (479)
T 3tbg_A          421 CLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPRHHH  478 (479)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEECCCCBEEEEC---
T ss_pred             ChhHHHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeecCCCeEEEEEECCCC
Confidence            9999999999999999999999999988877676666778899999998888776543



>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 711
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-39
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-23
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-11
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-38
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-21
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-10
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-32
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-18
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-12
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-29
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-13
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-11
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 8e-28
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 5e-13
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 5e-09
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-18
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-10
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-05
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 8e-18
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-07
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-16
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-05
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 0.003
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-16
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 4e-05
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 4e-16
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 7e-06
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 7e-04
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-15
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-05
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-15
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 3e-04
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-14
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 6e-04
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-13
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 0.003
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-13
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 4e-13
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 0.004
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 5e-13
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 0.001
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-12
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-12
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-12
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 1e-11
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score =  149 bits (377), Expect = 2e-39
 Identities = 82/249 (32%), Positives = 130/249 (52%), Gaps = 5/249 (2%)

Query: 336 LTYIIAYIRDFACDYYFIGDSFETSVPWDKTVLLCINVKKRLTRECTDDQLLVLLLDLFM 395
           L  I  +I      +    D        D  +L     K   + E     L++ +L LF 
Sbjct: 211 LQEINTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFF 270

Query: 396 AGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIMEIM 452
           AG+ETTS +L +  L +++YPHV  ++Q+EI+ +   ++ P + DR K PY +A I EI 
Sbjct: 271 AGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQ 330

Query: 453 RHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPT 512
           R G+  P GV H   K ++   YVIP+++ +   L S + D  ++  P+ F P  F+   
Sbjct: 331 RLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFL-DA 389

Query: 513 SGEVLYDETLIPFGLGKRRCLGEPMARTSLFIFLSSLLYHFNISIPSD-EPLPAVTVLDG 571
           +G +  +E  +PF LGKR CLGE +ART LF+F +++L +F+I+ P   E +       G
Sbjct: 390 NGALKRNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTPRESG 449

Query: 572 VTLAPAPYK 580
           V   P  Y+
Sbjct: 450 VGNVPPSYQ 458


>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query711
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.98
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.98
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.98
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.97
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.97
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.97
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.97
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.97
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.97
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.97
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.96
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.96
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.96
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.95
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.94
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.94
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.93
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.93
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.92
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.92
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.92
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.91
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.91
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.9
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.9
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.89
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.88
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.86
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 86.65
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.8e-44  Score=392.83  Aligned_cols=211  Identities=36%  Similarity=0.730  Sum_probs=192.8

Q ss_pred             hcccCCCCCHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHhCCchHHHHHHHHhhh---CCCCChhhhcCChhHHHHHHH
Q psy14413        374 KKRLTRECTDDQLLVLLLDLFMAGSETTSNSLSFSVLYLIRYPHVQRKIQEEIDSL---NKEPTILDRYKCPYLEATIME  450 (711)
Q Consensus       374 ~~~~~~~l~~~~l~~~~~~~~~aG~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~---~~~~~~~~~~~lpyl~a~i~E  450 (711)
                      .......++++++..++..+++||+|||+.+++|++++|++||++|+|+++||+.+   .+.++.+++.+||||+||++|
T Consensus       249 ~~~~~~~~s~~~i~~~~~~~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lp~l~a~~~E  328 (463)
T d3czha1         249 KNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHE  328 (463)
T ss_dssp             TTCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHH
T ss_pred             cccccchhHHHHHHHHHHHHHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCCCHHHHHhhhhcccccce
Confidence            34556789999999999999999999999999999999999999999999999988   467899999999999999999


Q ss_pred             HhcCCCCCCcccceecccccccCCEEeCCCCEEEechhhhhcCCCCCCCCCCcccCCCCCCCCCCCcCCCCccccCCCCC
Q psy14413        451 IMRHGNTAPIGVAHRAMKTSRLGSYVIPQDSIILVNLWSIMRDQEHWGDPDVFRPERFIHPTSGEVLYDETLIPFGLGKR  530 (711)
Q Consensus       451 ~lRl~p~~~~~~~r~~~~d~~~~g~~ip~Gt~V~~~~~~~~~d~~~~~~p~~F~P~Rfl~~~~~~~~~~~~~l~FG~G~r  530 (711)
                      ++|++|+++....|.+.+|+.++|+.|||||.|.++.+++|+||++|+||++|+||||++ +++....+..|+|||+|+|
T Consensus       329 t~Rl~~~~~~~~~r~~~~~~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~-~~~~~~~~~~~~~FG~G~r  407 (463)
T d3czha1         329 VLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLD-SSGYFAKKEALVPFSLGRR  407 (463)
T ss_dssp             HHHHHCSSTTCSCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBC-TTSCBCCCTTCCTTCCSTT
T ss_pred             eeeeeccccccceecccCCcccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCC-CccccCCCCceeCCCCCCc
Confidence            999999999888999999999999999999999999999999999999999999999998 3444456678999999999


Q ss_pred             CCccHHHHHHHHHHHHHHHHHHceeeCCCCCCCCccccccCeeecccCcccceeec
Q psy14413        531 RCLGEPMARTSLFIFLSSLLYHFNISIPSDEPLPAVTVLDGVTLAPAPYKAPGELY  586 (711)
Q Consensus       531 ~C~G~~lA~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~g~~~~p~~~~~~~~~~  586 (711)
                      .|||++||.+|++++++.||++|+|+++++. .++.....+++..|.+++|+++.|
T Consensus       408 ~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~-~~~~~~~~~~~~~p~~~~v~~~~R  462 (463)
T d3czha1         408 HCLGEHLARMEMFLFFTALLQRFHLHFPHEL-VPDLKPRLGMTLQPQPYLICAERR  462 (463)
T ss_dssp             CCTTHHHHHHHHHHHHHHHHHHEEEECGGGC-CCCCCCCSSSSCCCCCCCBEEEEC
T ss_pred             CCchHHHHHHHHHHHHHHHHHhcEEEeCCCC-CCCceeccCeEEeccCcEEEEEeC
Confidence            9999999999999999999999999987654 355666778888899998887765



>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure