Psyllid ID: psy14533


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
DVEWKSQNSGTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMRELPMGK
ccccEEEEcccccEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEccccEEEEEEEcccccccccccEEEEEEEEEcccccccEEEEEEEEccccccEEEEEccccccccEEEEEEEEcccccccccccEEEEccccccccccccEEEEEEEccEEEEEEEccccccccEEEEEEEEEEEEcccccccc
ccccEEEccccccEEEEEccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEccccccccEEEEEEEccccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEcccccccc
dvewksqnsgtEQWAVLQDLLPATLYRVRVLAenslgagrpsdpllvhteaepptaepsglhavaissdsirvtwspppahltngdlLGYYLGYreqgfgrqnsynfttipnrsdgagvATLTGLRKYRKYDIVVQAFnekgpgpmssevsvqtledvpaapplditcsalsstslsvtwqppplllqngeilGYKVYYENmrelpmgk
dvewksqnsgteqwAVLQDLLPATLYRVRVLAENSlgagrpsdPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYnfttipnrsdgagVATLTGLRKYRKYDIVVQAfnekgpgpmSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPplllqngeilGYKVYYENMRELPMGK
DVEWKSQNSGTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMRELPMGK
************QWAVLQDLLPATLYRVRVLAEN*****************************VAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFN************************LDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYEN********
DVEWKSQNSGTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDP**VHTEA*PPT*EPS*LHA*AISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYE*********
***********EQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMRELPMGK
**EWKSQNSGTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMR******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DVEWKSQNSGTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMRELPMGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q9VS29 2074 Down syndrome cell adhesi yes N/A 0.885 0.089 0.454 1e-40
O60469 2012 Down syndrome cell adhesi yes N/A 0.928 0.096 0.372 2e-31
Q4VA61 2053 Down syndrome cell adhesi yes N/A 0.947 0.096 0.355 3e-31
Q8TD84 2053 Down syndrome cell adhesi no N/A 0.947 0.096 0.355 3e-31
Q9ERC8 2013 Down syndrome cell adhesi no N/A 0.928 0.096 0.367 1e-30
Q8VHZ8 2013 Down syndrome cell adhesi no N/A 0.928 0.096 0.367 1e-30
Q92859 1461 Neogenin OS=Homo sapiens no N/A 0.851 0.121 0.380 3e-28
P97603 1377 Neogenin (Fragment) OS=Ra no N/A 0.851 0.129 0.370 6e-28
P97798 1493 Neogenin OS=Mus musculus no N/A 0.851 0.119 0.370 6e-28
A4IFW2 1909 Receptor-type tyrosine-pr no N/A 0.875 0.095 0.354 2e-27
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 119/187 (63%), Gaps = 2/187 (1%)

Query: 15   AVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVT 74
            A++++L PAT Y  RV+AE S G   PS  L+V TE + P   P  L A  +SS  + ++
Sbjct: 966  AMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELLIS 1025

Query: 75   WSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGA-GVATLTGLRKYRKYDI 133
            W  P   L +GD+ GY +GY+    G   +YNFT++    DG  G   L+GL K+ +Y +
Sbjct: 1026 WVAPLPELRHGDIQGYNVGYKLSSSG-NTAYNFTSVSGDGDGGNGELLLSGLAKFARYTV 1084

Query: 134  VVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQPPPLLLQNGEIL 193
            VVQAFN+ GPGP+S   + QT+EDVP+ PP D+ C+ALSS SL V+WQPPP+   NG + 
Sbjct: 1085 VVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQ 1144

Query: 194  GYKVYYE 200
            GYK+ +E
Sbjct: 1145 GYKLIFE 1151




Cell adhesion molecule.
Drosophila melanogaster (taxid: 7227)
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function description
>sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like protein 1 homolog OS=Mus musculus GN=Dscaml1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|Q92859|NEO1_HUMAN Neogenin OS=Homo sapiens GN=NEO1 PE=1 SV=2 Back     alignment and function description
>sp|P97603|NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus GN=Neo1 PE=2 SV=1 Back     alignment and function description
>sp|P97798|NEO1_MOUSE Neogenin OS=Mus musculus GN=Neo1 PE=1 SV=1 Back     alignment and function description
>sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
345490445 1863 PREDICTED: Down syndrome cell adhesion m 0.928 0.104 0.449 6e-42
350402059 1965 PREDICTED: Down syndrome cell adhesion m 0.885 0.094 0.475 7e-40
340714858 1965 PREDICTED: Down syndrome cell adhesion m 0.885 0.094 0.475 7e-40
383854374 2032 PREDICTED: Down syndrome cell adhesion m 0.885 0.091 0.481 8e-40
147907437 1886 Dscam family member AbsCAM [Apis mellife 0.885 0.098 0.475 8e-40
380011235 1924 PREDICTED: Down syndrome cell adhesion m 0.885 0.096 0.475 9e-40
92380877 1919 Dscam family member AbsCAM-Ig7A [Apis me 0.885 0.096 0.475 9e-40
112732546 1923 cell adhesion molecule AbsCAM-Ig7B [Apis 0.885 0.096 0.475 9e-40
158293630 1874 AGAP004902-PA [Anopheles gambiae str. PE 0.899 0.100 0.468 2e-39
158293632 1729 AGAP004902-PB [Anopheles gambiae str. PE 0.899 0.108 0.468 3e-39
>gi|345490445|ref|XP_001602265.2| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 124/209 (59%), Gaps = 15/209 (7%)

Query: 10   GTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSD 69
            G+++ A +  L PA  Y+ R+ AEN LG  +PSD L   TE E P   P  L    +SS 
Sbjct: 959  GSQEHAHISGLRPAVTYQFRIFAENELGRSQPSDILDAMTEGETPGGPPKNLKVEPVSST 1018

Query: 70   SIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVA--------- 120
             ++VTW PP   L NG++LGY++GY+EQ  G +  Y + T+  R   A +A         
Sbjct: 1019 ELKVTWDPPVDDLWNGEILGYHVGYKEQRHGAE--YMYRTVEGRISTASIALGLARTAIP 1076

Query: 121  ----TLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSL 176
                 L+ L+KY +Y IVVQA+N  G GPM+ EV  QTLEDVP++PP D+ C+ L+S SL
Sbjct: 1077 GRQCQLSNLKKYTRYSIVVQAYNALGAGPMTPEVVAQTLEDVPSSPPQDVRCTPLTSQSL 1136

Query: 177  SVTWQPPPLLLQNGEILGYKVYYENMREL 205
             VTW PPP    NG + GYKV YENM  L
Sbjct: 1137 QVTWDPPPNSSLNGILKGYKVMYENMNAL 1165




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350402059|ref|XP_003486354.1| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714858|ref|XP_003395940.1| PREDICTED: Down syndrome cell adhesion molecule-like protein CG42256-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383854374|ref|XP_003702696.1| PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|147907437|ref|NP_001035325.2| Dscam family member AbsCAM [Apis mellifera] Back     alignment and taxonomy information
>gi|380011235|ref|XP_003689716.1| PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2-like [Apis florea] Back     alignment and taxonomy information
>gi|92380877|dbj|BAE93381.1| Dscam family member AbsCAM-Ig7A [Apis mellifera] Back     alignment and taxonomy information
>gi|112732546|dbj|BAF03050.1| cell adhesion molecule AbsCAM-Ig7B [Apis mellifera] Back     alignment and taxonomy information
>gi|158293630|ref|XP_001688600.1| AGAP004902-PA [Anopheles gambiae str. PEST] gi|157016539|gb|EDO63980.1| AGAP004902-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158293632|ref|XP_314993.4| AGAP004902-PB [Anopheles gambiae str. PEST] gi|157016540|gb|EAA10381.5| AGAP004902-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
FB|FBgn0263219 1918 Dscam4 "Down syndrome cell adh 0.942 0.102 0.403 3e-34
UNIPROTKB|F1N4K6 1886 DSCAML1 "Uncharacterized prote 0.947 0.104 0.37 2.8e-31
MGI|MGI:2150309 2053 Dscaml1 "Down syndrome cell ad 0.947 0.096 0.37 3.1e-31
UNIPROTKB|Q8TD84 2053 DSCAML1 "Down syndrome cell ad 0.947 0.096 0.37 3.1e-31
RGD|1304887 2111 Dscaml1 "Down syndrome cell ad 0.947 0.093 0.37 3.3e-31
FB|FBgn0033159 2037 Dscam "Down syndrome cell adhe 0.870 0.089 0.398 4e-31
UNIPROTKB|E1BZF3 1870 E1BZF3 "Uncharacterized protei 0.947 0.105 0.37 4.5e-31
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.928 0.096 0.372 5e-31
UNIPROTKB|F1MKB9 1859 DSCAM "Uncharacterized protein 0.928 0.104 0.372 5.7e-31
UNIPROTKB|F1NY98 1994 DSCAM "Uncharacterized protein 0.928 0.097 0.372 2.1e-30
FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 387 (141.3 bits), Expect = 3.0e-34, P = 3.0e-34
 Identities = 82/203 (40%), Positives = 116/203 (57%)

Query:     9 SGTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISS 68
             +G +    +Q L PA  Y +R+ AEN LGA   S+ + V T  E P+  P  + A   SS
Sbjct:   965 AGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSS 1024

Query:    69 DSIRVTWSPPPAHLTNGDLLGYYLGYR------EQGFGRQNSYNFTTIPNRSDGAGVATL 122
               I VTW  P     NG LLGYY+GY+      ++       ++F T+  RS   G   L
Sbjct:  1025 TEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVL 1084

Query:   123 TGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSVTWQP 182
               L K+ +Y ++VQA+  +G GP S E++VQT+EDVP++PP    C  L STS+ +TW P
Sbjct:  1085 ANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSP 1144

Query:   183 PPLLLQNGEILGYKVYYENMREL 205
             P +  QNG+I GYKV+Y ++ EL
Sbjct:  1145 PDIDGQNGKIKGYKVFYISVDEL 1167


GO:0005887 "integral to plasma membrane" evidence=ISM
GO:0007155 "cell adhesion" evidence=ISS
GO:0042802 "identical protein binding" evidence=ISS
UNIPROTKB|F1N4K6 DSCAML1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2150309 Dscaml1 "Down syndrome cell adhesion molecule like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TD84 DSCAML1 "Down syndrome cell adhesion molecule-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1304887 Dscaml1 "Down syndrome cell adhesion molecule-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZF3 E1BZF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKB9 DSCAM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-16
pfam0004184 pfam00041, fn3, Fibronectin type III domain 4e-12
smart0006083 smart00060, FN3, Fibronectin type 3 domain 8e-12
pfam0004184 pfam00041, fn3, Fibronectin type III domain 6e-06
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 1e-05
smart0006083 smart00060, FN3, Fibronectin type 3 domain 3e-05
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-05
pfam0004184 pfam00041, fn3, Fibronectin type III domain 0.002
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 70.2 bits (172), Expect = 5e-16
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 7/97 (7%)

Query: 58  PSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGA 117
           P+ L    ++S S+ ++W+PP      G + GY + YRE+G G       T     S   
Sbjct: 4   PTNLRVTDVTSTSVTLSWTPPED--DGGPITGYVVEYREKGSGDWKEVEVTPGSETS--- 58

Query: 118 GVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQT 154
              TLTGL+   +Y+  V+A N  G  P S  V+V T
Sbjct: 59  --YTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
KOG4221|consensus 1381 99.94
KOG3513|consensus 1051 99.93
KOG4221|consensus 1381 99.92
KOG3513|consensus1051 99.84
KOG0196|consensus 996 99.66
KOG0196|consensus 996 99.55
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.4
KOG4222|consensus 1281 99.38
KOG4258|consensus 1025 99.19
KOG4258|consensus 1025 99.13
KOG4802|consensus 516 99.09
KOG4222|consensus 1281 98.96
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.8
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.41
KOG4802|consensus 516 98.31
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.94
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.94
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 97.92
COG3401 343 Fibronectin type 3 domain-containing protein [Gene 97.77
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.64
KOG3632|consensus 1335 97.48
KOG4367|consensus 699 97.32
KOG4152|consensus830 97.08
cd0006393 FN3 Fibronectin type 3 domain; One of three types 96.94
KOG4152|consensus830 96.83
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.59
COG3401343 Fibronectin type 3 domain-containing protein [Gene 96.12
smart0006083 FN3 Fibronectin type 3 domain. One of three types 95.54
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 94.88
COG4733 952 Phage-related protein, tail component [Function un 94.85
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 93.31
KOG3632|consensus 1335 92.93
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 92.3
PLN02533 427 probable purple acid phosphatase 91.29
KOG4806|consensus454 91.1
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 90.03
KOG4806|consensus454 88.78
KOG1225|consensus525 88.24
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 87.29
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 86.92
COG4733 952 Phage-related protein, tail component [Function un 83.26
KOG3515|consensus741 82.86
KOG4367|consensus699 80.43
>KOG4221|consensus Back     alignment and domain information
Probab=99.94  E-value=1.2e-24  Score=170.78  Aligned_cols=190  Identities=32%  Similarity=0.516  Sum_probs=156.9

Q ss_pred             CCcceEEEeecCCCceEEEEEEEEcCCCCCCCCCCeeEecCCCCCCCCCCceEEEeecCCeEEEEecCCCCCCCCCccee
Q psy14533         10 GTEQWAVLQDLLPATLYRVRVLAENSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLG   89 (209)
Q Consensus        10 ~~~~~~~i~~L~p~~~Y~~~v~a~~~~g~~~~s~~~~~~t~~~~~~~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~~~~   89 (209)
                      .+...++|.+|++.+.|.|+|.|+|..|.+..|..+.++|..+.|.++|.++.+.....++++|+|.+|..+..++.+.+
T Consensus       571 ~n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itg  650 (1381)
T KOG4221|consen  571 NNATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITG  650 (1381)
T ss_pred             cCccEEEeecCCCccceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEE
Confidence            35678999999999999999999999999998999999999999999999999999999999999999987777999999


Q ss_pred             EEEEEEEccccCCCCcceEEeecCCCCcceEEecCCCCCcEEEEEEEEEcCCCCccCCccEEEEeccCCCC----CCCcc
Q psy14533         90 YYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPA----APPLD  165 (209)
Q Consensus        90 y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~~~Y~~~v~a~~~~g~~~~s~~~~~~t~~~~p~----~~p~~  165 (209)
                      |.|+|++  ...........+..   ....+.+.+|+|++.|.|+|.|++..|.|+.|..+.+.|....+.    .+|..
T Consensus       651 YkIRy~~--~~~~~~~~~t~v~~---n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~ps~  725 (1381)
T KOG4221|consen  651 YKIRYRK--LSREDEVNETVVKG---NTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGKPSE  725 (1381)
T ss_pred             EEEEecc--cCcccccceeeccc---chhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccCCCCCce
Confidence            9999997  22222222333332   247888999999999999999999999999999999988865422    14544


Q ss_pred             eEEEEecCCeEEEEEeCCCCccCCceeeEEEEEEEeCCCcCC
Q psy14533        166 ITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMRELPM  207 (209)
Q Consensus       166 ~~~~~~~~~sv~l~W~~p~~~~~~~~i~~Y~i~y~~~~~~~~  207 (209)
                      +... ...+++.+.|.+|  ...+..+.+|+|.|++..+-++
T Consensus       726 l~~~-~g~~si~vsW~Pp--~~~~~~vrgY~ig~r~g~~~p~  764 (1381)
T KOG4221|consen  726 LHVH-PGSNSIVVSWTPP--PHPNIVVRGYKIGYRPGSGIPD  764 (1381)
T ss_pred             eeec-cCceeEEEEeCCC--CChhhhhcceEEeeecccCCCC
Confidence            4444 4566899999999  5777889999999998766553



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 1e-16
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 4e-06
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 2e-12
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 2e-06
2ed9_A124 Solution Structure Of The Third Fibronectin Type Ii 5e-10
3f7p_C 248 Crystal Structure Of A Complex Between Integrin Bet 1e-08
3f7r_A 249 First Pair Of Fibronectin Type Iii Domains And Part 1e-08
1qg3_A195 Crystal Structure Of A Tandem Pair Of Fibronectin T 1e-08
3f7q_A234 First Pair Of Fibronectin Type Iii Domains And Part 1e-08
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 2e-08
1x5g_A116 The Solution Structure Of The Second Fibronectin Ty 5e-08
3p4l_A211 Crystal Structure Of A Hemojuvelin-Binding Fragment 1e-07
2edy_A103 Solution Structures Of The Fn3 Domain Of Human Rece 3e-07
2ed8_A106 Solution Structure Of The Second Fibronectin Type I 2e-06
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 6e-06
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 2e-04
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 8e-06
2dtg_E 897 Insulin Receptor (Ir) Ectodomain In Complex With Fa 1e-04
2gee_A203 Crystal Structure Of Human Type Iii Fibronectin Ext 2e-04
1x5f_A120 The Solution Structure Of The First Fibronectin Typ 2e-04
3loh_E 917 Structure Of The Insulin Receptor Ectodomain, Inclu 2e-04
2v5y_A 731 Crystal Structure Of The Receptor Protein Tyrosine 3e-04
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 6e-04
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure

Iteration: 1

Score = 82.8 bits (203), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 45/113 (39%), Positives = 62/113 (54%), Gaps = 1/113 (0%) Query: 49 TEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFT 108 TE P P + ++S SI+VTW P L NG + GY +GYRE G Y+ Sbjct: 10 TEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIV 69 Query: 109 TIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAA 161 + D + V TL L+K+ +Y +VVQAFN G GP SSE++ TLE P++ Sbjct: 70 EMKATGD-SEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLESGPSS 121
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 Back     alignment and structure
>pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 Back     alignment and structure
>pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 Back     alignment and structure
>pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 Back     alignment and structure
>pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure
>pdb|1X5G|A Chain A, The Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Neogenin Length = 116 Back     alignment and structure
>pdb|3P4L|A Chain A, Crystal Structure Of A Hemojuvelin-Binding Fragment Of Neogenin Length = 211 Back     alignment and structure
>pdb|2EDY|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 103 Back     alignment and structure
>pdb|2ED8|A Chain A, Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 106 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|2DTG|E Chain E, Insulin Receptor (Ir) Ectodomain In Complex With Fab's Length = 897 Back     alignment and structure
>pdb|2GEE|A Chain A, Crystal Structure Of Human Type Iii Fibronectin Extradomain B And Domain 8 Length = 203 Back     alignment and structure
>pdb|1X5F|A Chain A, The Solution Structure Of The First Fibronectin Type Iii Domain Of Human Neogenin Length = 120 Back     alignment and structure
>pdb|3LOH|E Chain E, Structure Of The Insulin Receptor Ectodomain, Including Ct P Length = 917 Back     alignment and structure
>pdb|2V5Y|A Chain A, Crystal Structure Of The Receptor Protein Tyrosine Phosphatase Mu Ectodomain Length = 731 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-58
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 4e-41
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 5e-33
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-22
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-07
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-04
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 4e-53
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-31
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 2e-23
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 5e-08
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 2e-42
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-36
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 1e-24
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 6e-24
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 3e-05
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-42
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-37
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-24
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-24
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 9e-42
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 7e-41
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-41
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 9e-24
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-12
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-41
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-33
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 5e-41
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-32
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 5e-23
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-40
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-36
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-39
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-35
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-34
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-27
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 9e-20
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-38
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 7e-30
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 6e-08
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 9e-38
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-26
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 9e-20
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-37
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 7e-30
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-05
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 9e-37
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 5e-21
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 1e-08
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 3e-36
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-23
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 4e-08
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-35
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-24
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-33
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-26
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-33
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 4e-26
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 7e-23
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-20
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-33
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 4e-27
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 5e-32
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 6e-21
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-09
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 9e-32
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-17
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-08
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-31
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 4e-25
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-31
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 7e-21
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 4e-10
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-31
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-20
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-08
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-30
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 6e-17
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 5e-09
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-30
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 9e-16
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-07
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-29
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 4e-19
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-08
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-29
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-26
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-06
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 4e-29
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-18
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 3e-08
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 6e-29
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 9e-29
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 5e-28
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-24
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-28
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-15
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 5e-08
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 4e-28
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 6e-18
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-07
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-28
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-12
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-10
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-27
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-12
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 7e-09
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 2e-26
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-12
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-09
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 6e-26
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-17
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-06
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-24
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-21
1qr4_A 186 Protein (tenascin); fibronectin type-III, heparin, 6e-06
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 1e-24
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 6e-14
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 1e-07
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 3e-24
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 1e-17
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-04
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-24
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 5e-10
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 5e-07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-23
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-08
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 7e-07
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-23
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-08
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 4e-06
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 7e-23
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 9e-12
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 5e-06
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 7e-23
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-11
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-09
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 8e-23
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-11
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 6e-05
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-22
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-12
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-08
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 4e-22
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 1e-07
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 1e-04
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-21
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 7e-10
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-06
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-21
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-21
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 2e-06
3e0g_A 483 Leukemia inhibitory factor receptor; IG domain, cy 4e-04
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 2e-21
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-11
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 4e-21
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 7e-09
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 7e-21
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-10
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 5e-20
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 6e-13
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 8e-05
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-19
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-18
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 3e-18
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-09
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 3e-08
3t04_D103 Monobody 7C12; engineered binding protein, antibod 5e-18
3t04_D103 Monobody 7C12; engineered binding protein, antibod 5e-08
1x4x_A106 Fibronectin type-III domain containing protein 3A; 6e-18
1x4x_A106 Fibronectin type-III domain containing protein 3A; 5e-09
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-05
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 1e-17
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-07
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 1e-06
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-17
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-07
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 1e-04
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-17
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-15
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 2e-09
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 2e-07
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 2e-16
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 1e-13
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-16
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 7e-08
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-05
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-15
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 4e-07
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 4e-15
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 4e-14
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 1e-14
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 9e-07
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-14
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-08
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-05
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-14
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-06
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-04
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 3e-14
3s98_A 306 Interferon alpha/beta receptor 1; human, type I in 3e-09
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-14
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-06
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-14
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 7e-07
3k2m_C101 Monobody HA4; engineered binding protein, antibody 5e-14
3k2m_C101 Monobody HA4; engineered binding protein, antibody 5e-07
3k2m_C101 Monobody HA4; engineered binding protein, antibody 5e-04
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 7e-14
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-05
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 7e-05
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 7e-14
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 2e-08
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 9e-06
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-13
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 5e-08
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 2e-04
2gys_A419 Cytokine receptor common beta chain; dimer of inte 1e-13
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 6e-10
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 1e-07
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-13
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-05
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 5e-04
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 3e-13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-05
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 4e-13
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-08
1x5x_A109 Fibronectin type-III domain containing protein 3A; 4e-13
1x5x_A109 Fibronectin type-III domain containing protein 3A; 3e-06
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 9e-13
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-08
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-12
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-06
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-05
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 2e-12
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 4e-07
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-12
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-08
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-12
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-08
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 8e-06
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-12
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-07
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 4e-04
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 3e-12
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 1e-05
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 3e-12
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 3e-07
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 4e-12
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 6e-07
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 6e-12
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 4e-04
2crm_A120 Fibronectin type-III domain containing protein 3A; 8e-12
2crm_A120 Fibronectin type-III domain containing protein 3A; 7e-10
2crm_A120 Fibronectin type-III domain containing protein 3A; 1e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 9e-12
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 9e-08
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-11
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 1e-11
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-05
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 1e-11
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-05
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 5e-04
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 2e-11
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 2e-08
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-11
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 6e-05
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 3e-11
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 3e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-11
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 9e-08
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 7e-11
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 8e-11
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-04
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 8e-11
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 1e-07
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-10
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 2e-04
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-10
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 1e-07
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 6e-10
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 3e-05
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-09
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 8e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 3e-04
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-09
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 8e-08
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-09
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-09
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 5e-04
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 3e-09
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 7e-04
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 4e-09
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 4e-05
2erj_C247 Cytokine receptor common gamma chain; immune syste 8e-09
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 1e-08
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 1e-07
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 1e-04
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 1e-08
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-04
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 2e-07
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-06
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-07
2crz_A110 Fibronectin type-III domain containing protein 3A; 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 2e-07
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 9e-06
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 5e-07
1eer_B227 Epobp, erythropoietin receptor; signal transductio 6e-07
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 7e-07
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-05
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-06
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 2e-06
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 2e-06
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 3e-06
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 6e-06
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 1e-05
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-05
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 4e-04
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 6e-05
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 1e-04
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
 Score =  193 bits (490), Expect = 7e-58
 Identities = 47/201 (23%), Positives = 71/201 (35%), Gaps = 6/201 (2%)

Query: 1   DVEWKSQNSGTEQWAVLQDLLPATLYRVRVLAEN--SLGAGRPSDPLLVHTEAEPPTAEP 58
              W  +         +  L P T Y + VL       G G P   L   T+   P   P
Sbjct: 304 SGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGTGSPGPALRTRTKCADPMRGP 363

Query: 59  SGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAG 118
             L  V + S  I + W P   ++T        + Y  Q  G Q         +  +   
Sbjct: 364 RKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGG-QEQVREEVSWDTENSHP 422

Query: 119 VATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAAPPLDITCSALSSTSLSV 178
             T+T L  Y    + +   N +G    S E+ VQT ED+P A P +    +     + +
Sbjct: 423 QHTITNLSPYTNVSVKLILMNPEGRKE-SQELIVQTDEDLPGAVPTESIQGSTFEEKIFL 481

Query: 179 TWQPPPLLLQNGEILGYKVYY 199
            W+ P      G I  Y++ Y
Sbjct: 482 QWREPT--QTYGVITLYEITY 500


>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.93
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.92
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.91
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.91
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.9
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.9
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 99.9
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.89
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.89
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.89
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.89
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 99.89
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.88
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.88
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.88
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.88
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.88
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.87
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.87
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.85
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.84
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.84
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.84
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.83
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.83
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.83
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 99.83
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.82
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.82
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.82
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.8
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.8
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.79
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.79
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.79
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.79
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.78
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.78
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.77
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.77
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.77
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.77
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.77
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.77
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 99.77
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.76
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.76
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.76
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.75
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.75
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.75
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.75
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.75
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.75
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.75
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.74
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.72
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.72
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.72
1tdq_A 283 Tenascin-R; extracellular matrix, lecticans, tenas 99.71
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.71
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.7
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.7
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.7
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.7
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.69
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.69
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.68
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.68
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.67
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.67
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.66
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.66
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.65
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.64
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.64
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.64
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.64
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.63
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.63
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.63
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.63
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.62
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.62
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.61
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.61
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.61
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.61
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.61
2gys_A 419 Cytokine receptor common beta chain; dimer of inte 99.59
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.59
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.59
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.59
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.57
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.57
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.56
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.56
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.56
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.55
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.55
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.55
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.55
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.54
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.54
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.54
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.54
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.54
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.54
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.53
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.52
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.51
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.51
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.5
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.5
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.49
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.48
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.48
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.48
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.47
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.47
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.47
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.47
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.46
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.46
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.46
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.46
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.45
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.45
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.45
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.44
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.44
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.43
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.43
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.43
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.39
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.38
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.38
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.37
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.36
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.36
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.36
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.35
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.34
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.34
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.34
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.32
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.31
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.3
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.3
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.29
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.29
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.27
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.22
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.2
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.2
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.19
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.18
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.17
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.14
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.13
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.13
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.13
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.12
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.11
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.11
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.11
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.08
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.08
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.05
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.04
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.0
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 99.0
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 98.94
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.94
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 98.93
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.9
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.89
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 98.89
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.86
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 98.84
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 98.83
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 98.81
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 98.81
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 98.79
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 98.77
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.77
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.73
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.72
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 98.69
2crz_A110 Fibronectin type-III domain containing protein 3A; 98.68
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.67
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 98.65
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 98.65
1x4x_A106 Fibronectin type-III domain containing protein 3A; 98.64
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 98.64
1x3d_A118 Fibronectin type-III domain containing protein 3A; 98.63
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 98.62
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.61
1x5x_A109 Fibronectin type-III domain containing protein 3A; 98.61
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 98.6
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 98.58
2crm_A120 Fibronectin type-III domain containing protein 3A; 98.56
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 98.56
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 98.54
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 98.53
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 98.53
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 98.52
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 98.51
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 98.51
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 98.48
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 98.47
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.47
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.46
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 98.46
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 98.46
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.45
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 98.44
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.44
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 98.43
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.42
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 98.41
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 98.39
3t04_D103 Monobody 7C12; engineered binding protein, antibod 98.37
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.36
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.36
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 98.35
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 98.33
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 98.33
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.31
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 98.29
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 98.28
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.26
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 98.25
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 98.23
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.21
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.21
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.19
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.18
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 98.15
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.15
3k2m_C101 Monobody HA4; engineered binding protein, antibody 98.15
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 98.11
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 98.09
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 98.09
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.09
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 98.08
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 98.03
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.0
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 97.99
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 97.98
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 97.95
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 97.88
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 97.85
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 97.84
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 97.82
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 97.8
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 97.79
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 97.76
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 97.75
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 97.74
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 97.73
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.73
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 97.67
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 97.67
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 97.67
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.65
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 97.64
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 97.62
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.62
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 97.58
1oww_A98 FN, fibronectin first type III module, CIG; fibron 97.54
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.4
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.39
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.35
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 97.28
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 97.27
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 97.17
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 97.16
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.15
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 97.13
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 97.12
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 96.87
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 96.87
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 96.74
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 96.46
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 96.15
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 95.54
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 93.29
3bes_R 250 Interferon-gamma binding protein C4R; orthopoxviru 92.21
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 91.78
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 91.42
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 91.33
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 85.85
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 82.04
2vtf_A626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 81.44
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 81.23
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=9e-24  Score=167.86  Aligned_cols=195  Identities=25%  Similarity=0.371  Sum_probs=152.4

Q ss_pred             eEEecCCCcceEEEeecCCCceEEEEEEEE--cCCCCCCCCCCeeEecCCCCCCCCCCceEEEeecCCeEEEEecCCCCC
Q psy14533          4 WKSQNSGTEQWAVLQDLLPATLYRVRVLAE--NSLGAGRPSDPLLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAH   81 (209)
Q Consensus         4 w~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~--~~~g~~~~s~~~~~~t~~~~~~~~p~~~~~~~~~~~~~~l~W~~~~~~   81 (209)
                      |......+..++.|.+|.|++.|.|+|.|.  |..|.+.++..+.+++.+..|+.+|.++.+...+.+++.|.|+++...
T Consensus       307 ~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~N~~G~s~~S~~~~~~t~~~~p~~~P~~~~~~~~~~~sv~l~W~~p~~~  386 (731)
T 2v5y_A          307 WNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYN  386 (731)
T ss_dssp             CEEEEECCSSEEEECSCCTTCEEEEEEEEECSSTTCSCCBCCCEEEECCCCCCSCCCEEEEEEEECSSCEEEEEECCCHH
T ss_pred             ceEEeccCcceEEEeCCCCCCEEEEEEEEEecCCCccccCCCcEEeeecCCCCCCCCceeEEEeccCCeEEEEEECCCcc
Confidence            443334456889999999999999999999  999999988889999999888888999999888999999999987542


Q ss_pred             CCCCcceeEEEEEEEccccCCCCcceEEeecCCCCcceEEecCCCCCcEEEEEEEEEcCCCCccCCccEEEEeccCCCCC
Q psy14533         82 LTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPAA  161 (209)
Q Consensus        82 ~~~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~~~Y~~~v~a~~~~g~~~~s~~~~~~t~~~~p~~  161 (209)
                      ...+.+.+|.|.|+.........+....+ ........+.+.+|.|++.|.|+|.|.+..|.+. |..+.+.|...+|..
T Consensus       387 ~~~~~~~~y~v~y~~~~~~~~~~~~~~~~-~~~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~s~-S~~~~~~T~~~~P~~  464 (731)
T 2v5y_A          387 VTRCHSYNLTVHYCYQVGGQEQVREEVSW-DTENSHPQHTITNLSPYTNVSVKLILMNPEGRKE-SQELIVQTDEDLPGA  464 (731)
T ss_dssp             HHCSSSCEEEEEEEEESSSSEEEEEEEEC-CSSCSSCEEEECSCCSSCEEEEEEEEECSSCEEE-CCCEEEECCCCCCCC
T ss_pred             cccceeeeEEEEEEEccCCCCccceeEEE-EecCCcceEEECCCCCCCEEEEEEEEEcCCCCCC-CceEEEEccCCCCCC
Confidence            22456789999998722111111110011 1122247899999999999999999999999884 888999999988886


Q ss_pred             CC-cceEEEEecCCeEEEEEeCCCCccCCceeeEEEEEEEeCC
Q psy14533        162 PP-LDITCSALSSTSLSVTWQPPPLLLQNGEILGYKVYYENMR  203 (209)
Q Consensus       162 ~p-~~~~~~~~~~~sv~l~W~~p~~~~~~~~i~~Y~i~y~~~~  203 (209)
                      +| .++.... ..++|.|+|.+|  ...+|.|.+|+|+|+..+
T Consensus       465 p~~~~~~~~~-~~~si~l~W~~P--~~~~g~i~~Y~V~~~~~~  504 (731)
T 2v5y_A          465 VPTESIQGST-FEEKIFLQWREP--TQTYGVITLYEITYKAVS  504 (731)
T ss_dssp             CCTTTCEEEE-ETTEEEEECCCC--SCCSSCCCEEEEEEEEEE
T ss_pred             CCcceEEeee-cCCeEEEEEcCC--CCCCCCccceEEEEEECc
Confidence            55 3666554 467999999998  567899999999999864



>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 5e-22
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 5e-11
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 1e-05
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 2e-20
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-13
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-06
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-18
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-09
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 4e-17
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-07
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 1e-06
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 6e-17
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 5e-07
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 6e-05
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 3e-16
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 7e-08
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-05
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 4e-15
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-06
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 6e-05
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 2e-14
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 6e-08
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-04
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 3e-14
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 9e-07
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 0.002
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 4e-14
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-05
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 5e-14
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 0.002
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 6e-14
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 4e-06
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 5e-04
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-13
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-06
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 4e-06
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 8e-13
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 7e-06
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 1e-12
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 7e-11
d2dtge2 196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 4e-06
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-12
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 4e-05
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 1e-04
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 3e-12
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 0.001
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 0.002
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 8e-12
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 3e-06
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 1e-11
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 0.003
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 1e-11
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 2e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-11
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-04
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 7e-11
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 2e-05
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 8e-11
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 4e-04
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 1e-10
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 6e-05
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 0.003
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-10
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 3e-10
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 7e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.004
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 4e-10
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 2e-04
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-09
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 0.001
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 1e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 3e-05
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 1e-09
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 0.002
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 2e-09
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 3e-06
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 5e-09
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-04
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 5e-09
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 0.004
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 6e-09
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 5e-05
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 5e-04
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 6e-09
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 7e-09
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 0.003
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 1e-08
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 1e-08
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-08
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 5e-04
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 2e-08
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 2e-04
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 3e-08
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 0.001
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 5e-08
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 0.003
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 9e-08
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 1e-07
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-07
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 9e-05
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 3e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 5e-07
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 6e-07
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 7e-07
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 6e-04
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 1e-06
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 0.002
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 1e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 5e-04
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 2e-06
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 2e-06
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 2e-06
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 2e-06
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 3e-06
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 6e-04
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 4e-06
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 0.001
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 6e-06
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 7e-06
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 9e-06
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 1e-05
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 1e-05
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 1e-05
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 1e-05
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 0.002
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1e-05
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 3e-05
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 4e-05
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-04
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 3e-04
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 3e-04
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 5e-04
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 0.001
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 0.004
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 0.001
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 0.002
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 0.002
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.004
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.004
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Down syndrome cell adhesion molecule-like protein 1, DSCAML1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 84.6 bits (208), Expect = 5e-22
 Identities = 44/110 (40%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 47  VHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYN 106
           + TE   P   P  +    ++S SI+VTW  P   L NG + GY +GYRE   G    Y+
Sbjct: 1   ISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYS 60

Query: 107 FTTIPNRSDGAGVATLTGLRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLE 156
              +    D   V TL  L+K+ +Y +VVQAFN  G GP SSE++  TLE
Sbjct: 61  IVEMKATGDSE-VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE 109


>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.69
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.65
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.65
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.64
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.64
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.63
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.63
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.62
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.61
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.6
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.58
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.57
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.57
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.57
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.57
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.57
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.56
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.56
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.55
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.53
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2crza197 Fibronectin type-III domain containing protein 3a, 99.52
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.52
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.52
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.51
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.51
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.5
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.49
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.47
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.46
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.46
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.46
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.45
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.45
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.44
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.43
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.42
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.41
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.41
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.41
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.4
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.4
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.4
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.4
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.4
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.38
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.38
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.37
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.37
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.37
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.35
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.33
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.33
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.32
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.3
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.27
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.27
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.27
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.24
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.23
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.18
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.13
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.98
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.96
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 98.84
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.83
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.73
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.71
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.7
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.67
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.66
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.63
d2crza197 Fibronectin type-III domain containing protein 3a, 98.61
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.58
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 98.57
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.55
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.54
d1x4xa193 Fibronectin type-III domain containing protein 3a, 98.5
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.49
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 98.49
d2crma1107 Fibronectin type-III domain containing protein 3a, 98.47
d1x5xa196 Fibronectin type-III domain containing protein 3a, 98.47
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.46
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.45
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 98.44
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 98.43
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 98.43
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.4
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.38
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.38
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.38
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.38
d1x3da1105 Fibronectin type-III domain containing protein 3a, 98.36
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.33
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.33
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.3
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.29
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.25
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.24
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.24
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.23
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.22
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.2
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.17
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.15
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.14
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.13
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 98.1
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.09
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.06
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.06
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.05
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.04
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.01
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.01
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.01
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.99
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 97.99
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.98
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 97.97
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 97.97
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.96
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 97.95
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 97.93
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.92
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 97.92
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 97.92
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.91
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.89
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.88
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 97.86
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 97.84
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 97.78
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.48
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 97.41
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 97.31
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.22
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.18
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 96.92
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.7
d2c4fu1116 Extracellular region of human tissue factor {Human 96.62
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.15
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 96.07
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 95.61
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 94.71
d2hfta1106 Extracellular region of human tissue factor {Human 92.94
d1a21a1103 Extracellular region of human tissue factor {Rabbi 91.39
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 89.71
d2c4fu1116 Extracellular region of human tissue factor {Human 89.29
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 88.0
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 86.36
d1a21a1103 Extracellular region of human tissue factor {Rabbi 84.79
d2gysa399 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 84.79
d2hfta1106 Extracellular region of human tissue factor {Human 83.62
d2hyma2103 Interferon-alpha/beta receptor beta chain {Human ( 82.02
d2hyma2103 Interferon-alpha/beta receptor beta chain {Human ( 81.25
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=6.5e-18  Score=102.97  Aligned_cols=111  Identities=29%  Similarity=0.453  Sum_probs=86.8

Q ss_pred             eeEecCCCCCCCCCCceEEEeecCCeEEEEecCCCCCCCCCcceeEEEEEEEccccCCCCcceEEeecCCCCcceEEecC
Q psy14533         45 LLVHTEAEPPTAEPSGLHAVAISSDSIRVTWSPPPAHLTNGDLLGYYLGYREQGFGRQNSYNFTTIPNRSDGAGVATLTG  124 (209)
Q Consensus        45 ~~~~t~~~~~~~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  124 (209)
                      +.++|.++.|..+|.++.+...+.+++.|.|.++.....+|.+.+|.|+|+..  ....   .............+.+.+
T Consensus         2 v~v~T~~~~P~~~P~~v~~~~~~~~si~v~W~~p~~~~~ng~i~~Y~v~y~~~--~~~~---~~~~~~~~~~~~~~~i~~   76 (119)
T d1x5ha1           2 VAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKA--SRKS---DVTETLVSGTQLSQLIEG   76 (119)
T ss_dssp             CCCCCCCSSCCCCCEEEEEECCSSSEEEEEEECCCTTTCCSCEEEEBCEEEET--TEEE---EEECCBCCTTCCEEEEEC
T ss_pred             EEEEcCCCCCCCCCcCeEEEEecCcEEEEEEEcccccCCCCCEEEEEEEEeec--cccc---ceeeeecCCCccEEEeCC
Confidence            45778888888789999999999999999999886655678999999999872  1111   111111122247899999


Q ss_pred             CCCCcEEEEEEEEEcCCCCccCCccEEEEeccCCCC
Q psy14533        125 LRKYRKYDIVVQAFNEKGPGPMSSEVSVQTLEDVPA  160 (209)
Q Consensus       125 L~p~~~Y~~~v~a~~~~g~~~~s~~~~~~t~~~~p~  160 (209)
                      |.|++.|.|+|+|++..|.|.+|..+.+.|....+.
T Consensus        77 L~p~t~Y~~~V~A~n~~G~G~~S~~~~~~T~~~~~~  112 (119)
T d1x5ha1          77 LDRGTEYNFRVAALTINGTGPATDWLSAETFESDLD  112 (119)
T ss_dssp             CCSSCEEEEECEEEETTEEEEECCCEEEECCSSCCC
T ss_pred             CCCCCEEEEEEEEEcCCcCCCCCCCEEEEeCCCCCC
Confidence            999999999999999999999999999999876543



>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma2 b.1.2.1 (A:110-212) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma2 b.1.2.1 (A:110-212) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure