Psyllid ID: psy14737

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170-
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV
cEEEEcccccEEEEEccccEEccccccEEEccEEEEEcccEEEEEEcccccccccEEEEEEccccccEEEEEHHHHHcccccccccccEEEEcccccccccccEEEEcccccEEEEEcccccEEEEEccccccccccccEEEEEEccccEEccccEEEcccccEEEEEcccccHHccccccccccEEEEEEEHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHccccccccccEEEcEEEEcccEEEEEcccccccccccEEEEcccccccccccccccccHHHHcccccccccEEEEEEEEEEcccEEEEEEccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccEEEEEcccccccccEEEEccccccEEEEEEccccEEEEEEccccccccccccEEEEccEEccccccEEEEEcccccccccEEEEEEEccccEEEEEEHHHHccccccccccccEEEEcccccccccccEEEEccccEEEEEEcccccEEEEcccccccccccccEEEEEEccccEEccccEEEcccccEEEEEcccccccccccccccccEEEEEEEHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccEEccccHHHHHHHHccccccccccEEEcEEEEcccEEEEEcccccccccccEEEEcccccccccccccccccHHHHcccccccccEEEEEEEEEEcccEEEEEEccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccEEEEEcccccccccEEEEccccccEEEEEEccccEEEEEEccccccccccccEEEEcEEEccccccccccccccccccccEEEEEEEccccEEEEEEHHHHccccccccccccEEEEcccccccccccEEEEccccEEEEEEcccccEEEEcccccccccccccEEEEEEccccEEccccEEEccccEEEEEEcccccccccccccccccEEEEEEEHHHHcccccccc
cEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEcccccccccEEEEEEccccccEEEEcHHHHccccccccccccEEEEccccccccccHEEEcccccEEEEEEcccccEEEEccccccccccHccccEEEEcccEEEEccccEEccccEEEEEEcccHHHHHccccccccEEEEEEccHHHHHccccccccccccccccccccccccHHHHccccccccccccccEEEEEEEcccccccccHHEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHccccccccccccccEEcccEEEEEEcccccccccEEEEEEcccccccccccccccccccHccccccccccEEEEEEEEEcccccEEEEEcccEccccccccccccEEEEEEcccccEEEEEEccHHHccccccEEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEcccccccccEEEEEEccccccEEEEcHHHHccccccccccccEEEEccccccccccHEEEcccccEEEEEEcccccEEEEccccccccccHHHccEEEEcccEEEEccccEEccccEEEEEEcccHHHHHccccccccEEEEEEccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEHEEccccccHHHHHHHHHcccccccccccccEEEcccEEEEEEcccccccccEEEEEEcccccccccccccccccccHccccccccccEEEEEEEEEcccccEEEEEccEEEcccccccccccEEEEEEcccccEEEEEEccHHHcccccEEEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEcccEEEEcccEEEEEEcccccccccEEEEEEEcccccEEEEcHHHHccccccccccccEEEEcccccccccEEEEEcccccEEEEEEccccEEEEEccccccccccccccEEEEEcccEEEEccccEEccccEEEEEEccccHHHcccccccccEEEEEEccHHHHHccccccc
mivydlennesykvkhhyfyfdplsgnynvggvnfqwtdgvfgvalspvhkedgyrtlyfhplsstrefsVNTKILqnkttasnsyYEFKVlgsrgpnsqasaesldeKTGVLFYTQVnkdgvgcwnsykhaneysadttdlvatdsetlvfpndlkvdkegYLWVLSDKLSVHIYKGLHTDEINYrifqtpvkdaikgtvcdvgtpqrlqffslrhippiqmfhwktllgtdtinaptywyltesitdgsSYFSLLQLLGKRLRLLKlrshipcsliSAMSLKCLTLLAGVCLLACRVNAANERLKELFAwktvdfdfpddATRAKAIENkeyiqennlplgldrwhdklfvtiprwksgivSTLNYINLteakgnlspnlkpypsyeinnihkkngttlvsgfrinvdvcdrlwMVDTGLADilgegnqistprivVIDLKTDKIIKEHTIAKEDIAAHSFFANIlvdttpntcdkafayipdlggFQMIVYDlennesykvkhhyfyfdplsgnynvggvnfqwtdgvfgvalspvhkedgyrtlyfhplsstrefsVNTKILqnkttasnsyYEFKVlgsrgpnsqasaesldeKTGVLFYTQVnkdgvgcwnsykhaneysadttdlvatdsetlvfpndlkvdkegYLWVLSDKLSVHIYKGLHTDEINYrifqtpvkdaikgTVCDVVVTYIgsrghlelqfgdrhippiqmftgrpmlgttrpikphlLGKRLRLLKLrshipcsliSAMSLKCLTLLAGVCLLACRVNAANERLKELFAwktvdfdfpddATRAKAIENkeyiqennlplgldrwhdklfvtiprwksgivSTLNYINLteakgnlspnlkpypsyeinnihkkngttlvsgfrinvdvcdrlwMVDTGLADilgegnqistprivVIDLKTDKIIKEHTIAKEDIAAHSFFANIlvdttpntcdkafayipdlggFQMIVYDlennesykvkhhyfyfdplsgnynvggvnfqwtdgvfgvalspvhkedgyrtlyfhplsstrefsVNTKILqnkttasnsyYEFKvlgsrgpnsqataesldeKTGVLFYTQVnkdgvgcwnsykhaneysadttdlvatdsetlvfpndlkvdkegylwvlsdklpvhihkglhtdeINYRIfqtpvkdaikgtvcdv
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHplsstrefsvnTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELfawktvdfdfpDDATRAKAIenkeyiqennlplgldrWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADilgegnqistprivVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHplsstrefsvnTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTpvkdaikgTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELfawktvdfdfpDDATRAKAIenkeyiqennlplgldrWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADilgegnqistprivVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHplsstrefsvnTKILQNKTTASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEInyrifqtpvkdaikgtvcdv
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSllqllgkrlrllklrSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHllgkrlrllklrSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV
***YDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVL*****************TGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVL*****************TGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVL****************KTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTV***
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGS***********LDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCD*****************IQMFHWKTLLGTDTINAPTYWY***SITD*SSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAK******LKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVT***********************TGRPMLGT***************LKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAK******LKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSR********ESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVC**
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLG***********SLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLG***********SLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGS**********SLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVGTPQRLQFFSLRHIPPIQMFHWKTLLGTDTINAPTYWYLTESITDGSSYFSLLQLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQASAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLSVHIYKGLHTDEINYRIFQTPVKDAIKGTVCDVVVTYIGSRGHLELQFGDRHIPPIQMFTGRPMLGTTRPIKPHLLGKRLRLLKLRSHIPCSLISAMSLKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1171 2.2.26 [Sep-21-2011]
O02437 568 Protein yellow OS=Drosoph N/A N/A 0.341 0.704 0.390 2e-83
Q9GP81 568 Protein yellow OS=Drosoph N/A N/A 0.341 0.704 0.393 2e-83
Q9BI18 560 Protein yellow OS=Drosoph no N/A 0.342 0.716 0.389 2e-83
Q9GP71 568 Protein yellow OS=Drosoph N/A N/A 0.341 0.704 0.390 4e-83
Q9BI23 541 Protein yellow OS=Drosoph N/A N/A 0.326 0.706 0.396 6e-83
Q9BI17 541 Protein yellow OS=Drosoph N/A N/A 0.326 0.706 0.396 7e-83
P09957 541 Protein yellow OS=Drosoph no N/A 0.326 0.706 0.399 7e-83
P62407541 Protein yellow OS=Drosoph N/A N/A 0.380 0.822 0.363 7e-83
P62408541 Protein yellow OS=Drosoph N/A N/A 0.380 0.822 0.363 7e-83
O18330432 Major royal jelly protein no N/A 0.334 0.907 0.290 1e-43
>sp|O02437|YELL_DROSU Protein yellow OS=Drosophila subobscura GN=y PE=3 SV=1 Back     alignment and function desciption
 Score =  311 bits (798), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 163/417 (39%), Positives = 255/417 (61%), Gaps = 17/417 (4%)

Query: 760  LKCLTLLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPL 819
            L  L+LL     +     AA  +L+E ++W  +DF FP    + +A+ + +YI  N LP+
Sbjct: 10   LPALSLLLIAVAMVSPSQAA-YKLQERYSWNQLDFAFPSARLKEQALASGDYIPTNALPV 68

Query: 820  GLDRWHDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLV 879
            G++ + ++LFVT+PRW+ GI +TL YIN+  +    SP L PYP +  N        ++ 
Sbjct: 69   GVEHFGNRLFVTVPRWRDGIPATLTYINMDHSVTG-SPELIPYPDWRANTA-GDCANSIT 126

Query: 880  SGFRINVDVCDRLWMVDTGLADILGEGNQISTP---RIVVIDLKTDKIIKEHTIAKEDIA 936
            + +RI VD C RLW++DTG    +G GN  + P    I + DL TD  I+ + +   D  
Sbjct: 127  TAYRIKVDECGRLWVLDTG---TVGIGNTTTNPCPYAINIFDLATDTRIRRYELPAADTN 183

Query: 937  AHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVK-HHYFYFDPLSGNY 995
             ++F ANI VD    +CD AFAY  D  G+ +I Y  E N+S++   H YF+ DPL G++
Sbjct: 184  PNTFIANIAVDIG-KSCDDAFAYFADELGYGLISYSWELNKSWRFSAHSYFFPDPLRGDF 242

Query: 996  NVGGVNFQW-TDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYY 1054
            NV G+NFQW  +G+FG++L+P+ + DGYRTLYF PL+S R+F+V+T+IL+++T   +SY+
Sbjct: 243  NVAGINFQWGEEGIFGMSLTPI-RSDGYRTLYFSPLASHRQFAVSTRILRDETRTEDSYH 301

Query: 1055 EFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDS 1114
            +F  L  RGPN+  T+  + +  GV  +  ++++ VGCW+S   +  YS  +  +V  D 
Sbjct: 302  DFVALDERGPNAHTTSRVMSDD-GVELFNLIDQNAVGCWHS---SMPYSPQSHGIVDRDD 357

Query: 1115 ETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV 1171
              LVFP D+K+D+   +WVLSD++PV +   L   + N+RI+  P+   I+ TVCD+
Sbjct: 358  VGLVFPADIKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLIENTVCDL 414
Controls the pigmentation pattern of the adult cuticle and larval mouth parts.
Drosophila subobscura (taxid: 7241)
>sp|Q9GP81|YELL_DROGU Protein yellow OS=Drosophila guanche GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI18|YELL_DROPS Protein yellow OS=Drosophila pseudoobscura pseudoobscura GN=y PE=3 SV=2 Back     alignment and function description
>sp|Q9GP71|YELL_DROMD Protein yellow OS=Drosophila madeirensis GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI23|YELL_DROER Protein yellow OS=Drosophila erecta GN=y PE=3 SV=1 Back     alignment and function description
>sp|Q9BI17|YELL_DROYA Protein yellow OS=Drosophila yakuba GN=y PE=3 SV=1 Back     alignment and function description
>sp|P09957|YELL_DROME Protein yellow OS=Drosophila melanogaster GN=y PE=1 SV=1 Back     alignment and function description
>sp|P62407|YELL_DROSI Protein yellow OS=Drosophila simulans GN=y PE=3 SV=1 Back     alignment and function description
>sp|P62408|YELL_DROMA Protein yellow OS=Drosophila mauritiana GN=y PE=3 SV=1 Back     alignment and function description
>sp|O18330|MRJP1_APIME Major royal jelly protein 1 OS=Apis mellifera GN=MRJP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1171
193591678413 PREDICTED: protein yellow-like [Acyrthos 0.345 0.978 0.643 1e-159
157115908428 yellow protein precursor, putative [Aede 0.341 0.934 0.497 1e-122
269995911406 yellow-c precursor [Tribolium castaneum] 0.325 0.938 0.529 1e-121
28574202438 yellow-c [Drosophila melanogaster] gi|21 0.346 0.926 0.489 1e-121
195155919438 GL26025 [Drosophila persimilis] gi|19847 0.347 0.929 0.484 1e-121
195437111436 GK18310 [Drosophila willistoni] gi|19416 0.342 0.919 0.489 1e-120
194758489438 GF14904 [Drosophila ananassae] gi|190615 0.347 0.929 0.477 1e-120
195579316438 GD23989 [Drosophila simulans] gi|1941915 0.346 0.926 0.485 1e-120
195338521438 GM15882 [Drosophila sechellia] gi|194129 0.346 0.926 0.485 1e-120
195115591432 GI13248 [Drosophila mojavensis] gi|19391 0.341 0.925 0.484 1e-119
>gi|193591678|ref|XP_001952126.1| PREDICTED: protein yellow-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  570 bits (1470), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 262/407 (64%), Positives = 327/407 (80%), Gaps = 3/407 (0%)

Query: 765  LLAGVCLLACRVNAANERLKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDRW 824
            L+ G C   C V + N+RL+E+F+WK +DF FPD  TR  AI + EY+QENNLPLGL+ W
Sbjct: 9    LILGCC--TCAVWSVNDRLREVFSWKQLDFAFPDQKTRQAAIASGEYVQENNLPLGLEVW 66

Query: 825  HDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRI 884
             DKLF+T+PRWK+G+ STLNY++L     N SPNL PYP+YE N +       +VS FRI
Sbjct: 67   RDKLFITVPRWKAGVASTLNYVSLGSEPENRSPNLIPYPNYEQNRLASNMTDRIVSVFRI 126

Query: 885  NVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANI 944
            NVDVCDRLW+VDTGL D+ GE N + TP+++V DL TD +I+++T   +D+   SFFANI
Sbjct: 127  NVDVCDRLWLVDTGLNDVWGEANPVQTPKLMVFDLNTDTLIRQYTFRPDDMKPDSFFANI 186

Query: 945  LVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQW 1004
            L DTT +TCD AFAYIPDLGG+ ++VY   +N S++VKHH+F+FDPLSGN++VGG NFQW
Sbjct: 187  LADTTKDTCDDAFAYIPDLGGYGLVVYSFASNTSWRVKHHFFHFDPLSGNFHVGGHNFQW 246

Query: 1005 TDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGP 1064
            TDG+FGVALSPV KEDGYRTLYFHPLSSTREF V+T I+QN + AS+SYYE+KVLGSRGP
Sbjct: 247  TDGIFGVALSPV-KEDGYRTLYFHPLSSTREFCVSTHIVQNASIASDSYYEYKVLGSRGP 305

Query: 1065 NSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLK 1124
            N+QA+  SLDE TG LFYTQ+NKDGVGCWNS+++A+EYSADT  LVA+DS+TL FPNDLK
Sbjct: 306  NTQASGSSLDEATGALFYTQINKDGVGCWNSFRNADEYSADTNHLVASDSQTLEFPNDLK 365

Query: 1125 VDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVCDV 1171
            VDK G LWVLSDKLP+++++GL  +E NYRIF  PV D I+GTVCD+
Sbjct: 366  VDKTGTLWVLSDKLPLYLYRGLDLNETNYRIFNAPVVDVIRGTVCDI 412

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157115908|ref|XP_001652709.1| yellow protein precursor, putative [Aedes aegypti] gi|108876711|gb|EAT40936.1| AAEL007374-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|269995911|ref|NP_001161778.1| yellow-c precursor [Tribolium castaneum] gi|270014214|gb|EFA10662.1| hypothetical protein TcasGA2_TC016299 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|28574202|ref|NP_523570.3| yellow-c [Drosophila melanogaster] gi|21064753|gb|AAM29606.1| RH54244p [Drosophila melanogaster] gi|28380379|gb|AAF53432.3| yellow-c [Drosophila melanogaster] gi|220949360|gb|ACL87223.1| yellow-c-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195155919|ref|XP_002018848.1| GL26025 [Drosophila persimilis] gi|198476392|ref|XP_001357355.2| GA18010 [Drosophila pseudoobscura pseudoobscura] gi|194115001|gb|EDW37044.1| GL26025 [Drosophila persimilis] gi|198137673|gb|EAL34424.2| GA18010 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195437111|ref|XP_002066488.1| GK18310 [Drosophila willistoni] gi|194162573|gb|EDW77474.1| GK18310 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194758489|ref|XP_001961494.1| GF14904 [Drosophila ananassae] gi|190615191|gb|EDV30715.1| GF14904 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195579316|ref|XP_002079508.1| GD23989 [Drosophila simulans] gi|194191517|gb|EDX05093.1| GD23989 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195338521|ref|XP_002035873.1| GM15882 [Drosophila sechellia] gi|194129753|gb|EDW51796.1| GM15882 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195115591|ref|XP_002002340.1| GI13248 [Drosophila mojavensis] gi|193912915|gb|EDW11782.1| GI13248 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1171
FB|FBgn0041713438 yellow-c "yellow-c" [Drosophil 0.254 0.680 0.542 9.7e-118
FB|FBgn0032601453 yellow-b "yellow-b" [Drosophil 0.334 0.865 0.419 7.7e-87
FB|FBgn0038105452 yellow-f2 "yellow-f2" [Drosoph 0.312 0.809 0.401 1e-80
FB|FBgn0004034 541 y "yellow" [Drosophila melanog 0.323 0.700 0.4 9.8e-80
FB|FBgn0041710447 yellow-f "yellow-f" [Drosophil 0.303 0.794 0.397 3.1e-78
UNIPROTKB|Q8MZM5462 dce "Dopachrome conversion enz 0.337 0.854 0.353 2e-73
FB|FBgn0039896463 yellow-h "yellow-h" [Drosophil 0.335 0.848 0.362 1.2e-71
UNIPROTKB|O18330432 MRJP1 "Major royal jelly prote 0.334 0.907 0.293 6.5e-44
FB|FBgn0034856412 yellow-d2 "yellow-d2" [Drosoph 0.333 0.949 0.293 1.6e-42
FB|FBgn0038151426 yellow-e2 "yellow-e2" [Drosoph 0.314 0.863 0.294 1.2e-41
FB|FBgn0041713 yellow-c "yellow-c" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 902 (322.6 bits), Expect = 9.7e-118, Sum P(2) = 9.7e-118
 Identities = 165/304 (54%), Positives = 224/304 (73%)

Query:   870 IHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHT 929
             I  K+ +T++S FRI VDVCDRLW++DTGLADILG   QI+   I+V DLKTD +++  T
Sbjct:   139 IQLKDNSTVISTFRIQVDVCDRLWVLDTGLADILGSPKQITPNSILVFDLKTDTLLRRFT 198

Query:   930 IAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFD 989
             I  +     SFFANI+VD   + C  AFAYIPDLG + +IVY L N++SY+VKH++F+FD
Sbjct:   199 IPADQTKEDSFFANIVVDADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFD 258

Query:   990 PLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKT-- 1047
             PL G++NVGGVNFQWTDGVFG+A+ P++  D  + +YFH L+ST+EF V+ ++LQN++  
Sbjct:   259 PLHGDFNVGGVNFQWTDGVFGLAVGPMNP-DHSKDIYFHALASTKEFKVSNRVLQNESHV 317

Query:  1048 TASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTT 1107
             TA +SYY+FK +G RG N Q+TAE  D +TGV+FYTQVNKD + CWN  +    Y+ DT 
Sbjct:   318 TAGDSYYDFKYVGDRGMNGQSTAEVFDPETGVIFYTQVNKDAIACWNIKR---PYTPDTQ 374

Query:  1108 DLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGT 1167
              L+ +DS TLVFPND+K+D EG +WVLSDK+P +++K L    +NYRI     +D IKGT
Sbjct:   375 GLIDSDSHTLVFPNDMKIDNEGTIWVLSDKMPTYLYKELDPSAVNYRILMGQNRDLIKGT 434

Query:  1168 VCDV 1171
              C++
Sbjct:   435 PCEM 438
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0016853 "isomerase activity" evidence=IBA
GO:0048067 "cuticle pigmentation" evidence=IBA
GO:0042438 "melanin biosynthetic process" evidence=IBA
GO:0005576 "extracellular region" evidence=IBA
FB|FBgn0032601 yellow-b "yellow-b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038105 yellow-f2 "yellow-f2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004034 y "yellow" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041710 yellow-f "yellow-f" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MZM5 dce "Dopachrome conversion enzyme" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0039896 yellow-h "yellow-h" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O18330 MRJP1 "Major royal jelly protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0034856 yellow-d2 "yellow-d2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038151 yellow-e2 "yellow-e2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1171
pfam03022285 pfam03022, MRJP, Major royal jelly protein 1e-102
pfam03022285 pfam03022, MRJP, Major royal jelly protein 1e-102
pfam03022285 pfam03022, MRJP, Major royal jelly protein 3e-68
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information 
 Score =  325 bits (834), Expect = e-102
 Identities = 132/293 (45%), Positives = 190/293 (64%), Gaps = 10/293 (3%)

Query: 879  VSGFRINVDVCDRLWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAH 938
            VS +RI VD CDRLW++D+G+ + L    QI  P+++V DL TDK++K   +  +    +
Sbjct: 1    VSVYRIAVDECDRLWVLDSGIVNTLQPPKQICPPKLLVFDLATDKLLKRFELPADVAKGN 60

Query: 939  SFFANILVDTTPNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVG 998
            S   N++VD   +TCD  F YI D  G  +IVYDL +++S++V+H+ FY DP  G + + 
Sbjct: 61   SRLVNLVVDVGDDTCDDTFVYIADAKGRGLIVYDLADDKSWRVEHNTFYPDPDFGKFTIA 120

Query: 999  GVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASN--SYYEF 1056
            G +FQ  DG+FG+ALSP    DG  TLYFHPL+STR +SV T++L+N+T   N   Y +F
Sbjct: 121  GESFQLDDGIFGLALSP-RTPDGR-TLYFHPLASTRLYSVPTEVLRNETNWGNNAQYEDF 178

Query: 1057 KVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSET 1116
            K LG R  N+Q+TA ++D   GVLF+  V ++ VGCWN+      YS     +VA +S+T
Sbjct: 179  KDLGDR--NTQSTALAVD-PNGVLFFGLVGQNAVGCWNTST---PYSRANLGVVARNSDT 232

Query: 1117 LVFPNDLKVDKEGYLWVLSDKLPVHIHKGLHTDEINYRIFQTPVKDAIKGTVC 1169
            L FP+DLK+DKE YLWVLS+++   ++  L  DE+N+RI    V   I+ TVC
Sbjct: 233  LQFPSDLKIDKEEYLWVLSNRMQKFLYNDLDYDEVNFRILGANVDLLIRNTVC 285

Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1171
3q6k_A381 Salivary Protein From Lutzomyia Longipalpis Length 1e-31
3q6p_A381 Salivary Protein From Lutzomyia Longipalpis. Seleno 8e-31
>pdb|3Q6K|A Chain A, Salivary Protein From Lutzomyia Longipalpis Length = 381 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (340), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 106/365 (29%), Positives = 166/365 (45%), Gaps = 28/365 (7%)
Query: 819  LGLDRWHDKLFVTIPRWKSGIVSTLNYI---NLTEAKGNLSPNLKPYPSYEINNIHKKNG 875
               D   +KLF+ +PR    +  TL  +   N    KG  SP L  +  +       K G
Sbjct: 31   FAYDAEGEKLFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSPLLNKFSGH-------KTG 83
Query: 876  TTLVSGFRINVDVCDRLWMVDTGLADILGEGNQ---ISTPRIVVIDLKTDKI--IKEHTI 930
              L S ++  +D C RLW+VD G  +    G +      P IV  DLK      +  +  
Sbjct: 84   KELTSIYQPVIDDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYF 143
Query: 931  AKEDIAAHSFFANILVDTT--PNTCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYF 988
                +   ++F    VD       C + F YI +     + +YD +  +S+ V H  F  
Sbjct: 144  PTRLVEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKA 203
Query: 989  DPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTT 1048
            +  +  ++ GG  +++  G+FG+ L     E G R  Y+   S+ + +SVNTK L+ K  
Sbjct: 204  ERPT-KFDYGGKEYEFKAGIFGITLGDRDSE-GNRPAYYLAGSAIKVYSVNTKELKQKGG 261
Query: 1049 ASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTD 1108
              N     ++LG+RG  + A A + D KT V+F+ + N   V CWN+ K         TD
Sbjct: 262  KLNP----ELLGNRGKYNDAIALAYDPKTKVIFFAEANTKQVSCWNTQKMP--LRMKNTD 315
Query: 1109 LVATDSETLVFPNDLKVDKEGYLWVLSDKL-PVHIHKGLHTDEINYRIFQ-TPVKDAIKG 1166
            +V T S   VF  D+ VD +G LW +S+   P+   +    D   YR+ +    ++AI G
Sbjct: 316  VVYTSSR-FVFGTDISVDSKGGLWFMSNGFPPIRKSEKFKYDFPRYRLMRIMDTQEAIAG 374
Query: 1167 TVCDV 1171
            T CD+
Sbjct: 375  TACDM 379
>pdb|3Q6P|A Chain A, Salivary Protein From Lutzomyia Longipalpis. Selenomethionine Derivative Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1171
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 1e-114
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 1e-113
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 2e-60
2qe8_A343 Uncharacterized protein; structural genomics, join 3e-54
2qe8_A343 Uncharacterized protein; structural genomics, join 5e-54
2qe8_A343 Uncharacterized protein; structural genomics, join 4e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
 Score =  359 bits (921), Expect = e-114
 Identities = 103/402 (25%), Positives = 169/402 (42%), Gaps = 39/402 (9%)

Query: 784  KELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGL--DRWHDKLFVTIPRWKSGIVS 841
             + + WK + ++          +    Y  +N +      D   +KLF+ +PR    +  
Sbjct: 3    TQGYKWKQLLYN---------NVTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPY 53

Query: 842  TLNYINLT---EAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTG 898
            TL  ++       KG  SP L  +  ++           L S ++  +D C RLW+VD G
Sbjct: 54   TLAEVDTKNSLGVKGKHSPLLNKFSGHKTGK-------ELTSIYQPVIDDCRRLWVVDIG 106

Query: 899  LADILGEGNQI---STPRIVVIDLKTDKIIKEHTIA--KEDIAAHSFFANILVDTTPN-- 951
              +    G +      P IV  DLK     +          +   ++F    VD      
Sbjct: 107  SVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPTRLVEKPTYFGGFAVDVANPKG 166

Query: 952  TCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFGV 1011
             C + F YI +     + +YD +  +S+ V H  F  +     ++ GG  +++  G+FG+
Sbjct: 167  DCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAER-PTKFDYGGKEYEFKAGIFGI 225

Query: 1012 ALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQATAE 1071
             L      +G R  Y+   S+ + +SVNTK L+ K    N     ++LG+RG  + A A 
Sbjct: 226  TLGDRD-SEGNRPAYYLAGSAIKVYSVNTKELKQKGGKLN----PELLGNRGKYNDAIAL 280

Query: 1072 SLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYL 1131
            + D KT V+F+ + N   V CWN+ K            V   S   VF  D+ VD +G L
Sbjct: 281  AYDPKTKVIFFAEANTKQVSCWNTQK---MPLRMKNTDVVYTSSRFVFGTDISVDSKGGL 337

Query: 1132 WVLSDKLPVHIHKG-LHTDEINYRIFQT-PVKDAIKGTVCDV 1171
            W +S+  P          D   YR+ +    ++AI GT CD+
Sbjct: 338  WFMSNGFPPIRKSEKFKYDFPRYRLMRIMDTQEAIAGTACDM 379
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1171
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 100.0
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 100.0
2qe8_A343 Uncharacterized protein; structural genomics, join 100.0
2qe8_A343 Uncharacterized protein; structural genomics, join 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.72
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.66
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.6
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.59
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.49
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.48
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.29
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.28
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.15
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.15
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.13
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.13
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.12
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.1
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.09
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.07
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.04
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.03
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.02
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.02
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.01
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.01
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.01
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.01
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.0
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.99
3v65_B386 Low-density lipoprotein receptor-related protein; 98.98
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.98
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.98
3v65_B386 Low-density lipoprotein receptor-related protein; 98.98
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.97
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.96
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.95
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.93
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.88
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.88
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.87
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.86
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.86
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.85
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.85
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.84
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.81
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.81
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.8
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.8
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.79
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.79
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.78
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.77
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.76
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.75
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.74
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.7
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.7
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.69
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.66
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.65
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.65
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.64
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.64
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.58
3kya_A496 Putative phosphatase; structural genomics, joint c 98.58
3kya_A496 Putative phosphatase; structural genomics, joint c 98.57
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.52
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.38
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.31
3ott_A 758 Two-component system sensor histidine kinase; beta 98.22
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.21
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.15
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.13
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.13
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.12
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.08
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.04
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.04
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.97
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.94
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.9
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.9
3ott_A758 Two-component system sensor histidine kinase; beta 97.88
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.85
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.78
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.73
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.72
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.7
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.68
2ece_A462 462AA long hypothetical selenium-binding protein; 97.67
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.66
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.64
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.64
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.55
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.53
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.52
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.5
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.49
2ece_A462 462AA long hypothetical selenium-binding protein; 97.46
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.45
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.45
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 97.44
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.43
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.42
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.41
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.41
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.35
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.35
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.31
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.31
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.19
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.1
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.08
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.03
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.02
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.01
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.89
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.86
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.81
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.79
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.77
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.76
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.67
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.49
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.46
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.32
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 95.9
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 94.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.93
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.87
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.21
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.04
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 93.67
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 93.67
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.52
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.52
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 93.51
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 92.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.39
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 91.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.7
3ow8_A321 WD repeat-containing protein 61; structural genomi 91.69
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 91.5
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 90.87
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 90.8
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.56
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 90.38
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 90.36
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.04
4g56_B357 MGC81050 protein; protein arginine methyltransfera 90.03
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.9
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 89.89
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.61
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 89.39
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 89.26
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 89.13
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 89.01
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 88.93
4g56_B357 MGC81050 protein; protein arginine methyltransfera 88.92
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 88.84
3ow8_A321 WD repeat-containing protein 61; structural genomi 88.71
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 88.6
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 88.46
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 88.07
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 88.06
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 87.89
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.51
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 87.23
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 87.16
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 86.79
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 86.3
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 86.26
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 86.17
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 86.12
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 85.81
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 85.68
2xyi_A430 Probable histone-binding protein CAF1; transcripti 85.4
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 85.37
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 85.3
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 85.2
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 84.94
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 84.79
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 84.77
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 84.64
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 84.5
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 84.39
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 83.5
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 83.47
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 82.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 82.87
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 82.72
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 82.65
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 82.51
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 82.44
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 81.67
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 81.61
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 81.56
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 81.5
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 81.44
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 81.44
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 80.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 80.86
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 80.83
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 80.55
1k32_A 1045 Tricorn protease; protein degradation, substrate g 80.53
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 80.16
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 80.1
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-88  Score=782.92  Aligned_cols=364  Identities=29%  Similarity=0.533  Sum_probs=338.2

Q ss_pred             ceEEEEEeeccccCCChHHHHhhhccCCcccCCCceeeeEE--eCCeEEEEecCCCCCCCcEEEEEEecCCCC--CCCCC
Q psy14737        783 LKELFAWKTVDFDFPDDATRAKAIENKEYIQENNLPLGLDR--WHDKLFVTIPRWKSGIVSTLNYINLTEAKG--NLSPN  858 (1171)
Q Consensus       783 l~~vy~Wk~ldf~~p~~~~r~~ai~sg~Yip~n~~P~gV~v--~~gRiFVT~PR~~~GvP~TL~~V~~~~~g~--~~sP~  858 (1171)
                      +|++||||+|||+         ||.+|+|+|+|++|+||++  ++||+|||+|||++|+|+||++|..+..++  ..+|+
T Consensus         2 ~~~~~~Wk~ld~~---------ai~~g~y~p~n~~P~gv~vd~~~gRiFvt~PR~~~gvp~TL~~v~~~~~~~~~~~~p~   72 (381)
T 3q6k_A            2 DTQGYKWKQLLYN---------NVTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTLAEVDTKNSLGVKGKHSP   72 (381)
T ss_dssp             CCEEEEESSCCBT---------TSCTTSSCGGGCCCCEEEEETTTTEEEEECCTTSTTCSCSEEEEEHHHHTTCTTCSSC
T ss_pred             cceEEEEEeeccc---------cccCCCcccCccceeeeeeecCCCcEEEEeCCCCCCCCcEEEEEeCCCCcccccCCcc
Confidence            6899999999997         9999999999999999999  799999999999999999999998643210  23788


Q ss_pred             c-ccCCCccccccCCCCCCcEEEeeEEEEeCCCeEEEEeCCCCCCCCCCCc---cCCCEEEEEECCCC--cEEEEEECCc
Q psy14737        859 L-KPYPSYEINNIHKKNGTTLVSGFRINVDVCDRLWMVDTGLADILGEGNQ---ISTPRIVVIDLKTD--KIIKEHTIAK  932 (1171)
Q Consensus       859 L-~PYPsw~~N~~~~~~~~~LvSV~~i~ID~cgRLWVLDtG~~~~~~~~~~---~cpPKLvvfDL~Td--klir~y~~p~  932 (1171)
                      | +|||||       .+|++|+||++++||+||||||||+|.++.++++.+   .|+|||++|||+||  +++|+|+||+
T Consensus        73 ll~PYP~w-------~~~~~lvsV~~v~iD~~~rLWVLDtG~~~~~~~~~~~~~~~~pkLv~~DL~t~~~~li~~y~~p~  145 (381)
T 3q6k_A           73 LLNKFSGH-------KTGKELTSIYQPVIDDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPT  145 (381)
T ss_dssp             CBEECTTC-------SSSCSSSCEEEEEECTTCEEEEEECSSCSSCSTTGGGSCCCCCEEEEEESSSTTCCEEEEEECCG
T ss_pred             cccCCCCC-------ccccceEEeeEEEEcCCCcEEEEeCCCcCcCCCccccCCCCCceEEEEECCCCCceeEEEEECCH
Confidence            8 999998       248999999999999999999999999998887788   99999999999999  9999999999


Q ss_pred             cccccCcceeeEEEe-cCCC-CCCceEEEEEcCCCCeEEEEECCCCeEEEEeccccccCCCCCceeecCeeeeecCCcce
Q psy14737        933 EDIAAHSFFANILVD-TTPN-TCDKAFAYIPDLGGFQMIVYDLENNESYKVKHHYFYFDPLSGNYNVGGVNFQWTDGVFG 1010 (1171)
Q Consensus       933 ~v~~~~S~lndivVD-~~~~-~C~~~~aYItDsg~~gLIVyDl~~g~swRv~~~~~~~dP~~~~f~i~G~~f~~~dGI~G 1010 (1171)
                      ++++++|+|+||+|| .++. +|+++||||||++.+||||||+++|++|||+|++|+|| .++.|+|+|++|+|++|++|
T Consensus       146 ~~~~~~S~l~di~VD~~~~~~~c~~~~aYItD~~~~gLIVydl~~~~swRv~~~~~~pd-~~~~~~i~G~~~~~~~Gi~g  224 (381)
T 3q6k_A          146 RLVEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAE-RPTKFDYGGKEYEFKAGIFG  224 (381)
T ss_dssp             GGCCCGGGEEEEEEEESCTTTTSCSEEEEEEETTTTEEEEEETTTTEEEEEECGGGSCC-SCEEEEETTEEEEECCCEEE
T ss_pred             HhcccCCccceEEEecccCCCCCCccEEEEEcCCCCcEEEEECCCCcEEEEccCCCccc-cCcceEECCEEeEeccCceE
Confidence            999999999999999 4433 79999999999999999999999999999999999998 67899999999999999999


Q ss_pred             eeecCCCCCCCceeEEEEeCCCceEEEEechhhcccCCCcccccceEEecccCCCCCCceeEeecCCCeEEEeecCCCeE
Q psy14737       1011 VALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTASNSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGV 1090 (1171)
Q Consensus      1011 IALsp~~~~dg~r~LYf~plss~~ly~V~T~~Lr~~~~~~~~~~~v~~lG~rG~~sqs~g~~~D~~~G~LYft~~~~~aI 1090 (1171)
                      |||||++. +|+|+||||||+|++||+|+|++|+|++.    ..+|+.+|+||+++|+.|+++|+++|+|||+++++++|
T Consensus       225 IaLsp~~~-~~~~~LYf~plss~~ly~V~T~~L~~~~~----~~~v~~~G~kg~~s~~~~~~~D~~~G~ly~~~~~~~aI  299 (381)
T 3q6k_A          225 ITLGDRDS-EGNRPAYYLAGSAIKVYSVNTKELKQKGG----KLNPELLGNRGKYNDAIALAYDPKTKVIFFAEANTKQV  299 (381)
T ss_dssp             EEECCCCT-TSCCEEEEEESSCSEEEEEEHHHHSSTTC----CCCCEEEEECCTTCCEEEEEECTTTCEEEEEESSSSEE
T ss_pred             EEecCCcC-CCCeEEEEEECCCCcEEEEEHHHhhCcch----hhceEEeeecCCCCCcceEEEeCCCCeEEEEeccCCeE
Confidence            99999864 67899999999999999999999999873    46799999999888888999976899999999999999


Q ss_pred             EEEeCCCCCCcCCCCceeEEEecCCCccCCCcEEEcCCCcEEEEeCCccccccCCC-CCCcccEEEEEe-ehhhhcCCCC
Q psy14737       1091 GCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDKEGYLWVLSDKLPVHIHKGL-HTDEINYRIFQT-PVKDAIKGTV 1168 (1171)
Q Consensus      1091 ~~Wdt~~~~~~~~~~n~~~V~~dd~~L~wPd~v~id~dg~LwVlsnrl~~f~~~~l-d~~e~nfrI~r~-~v~~~i~gT~ 1168 (1171)
                      +|||+++  ++|+++|+++|++++ +|+||++++++.+|+|||++||||+|+++++ |.+|+||||||+ +++++|+||+
T Consensus       300 ~~w~~~~--~~~~~~n~~~l~~d~-~l~~pd~~~i~~~g~Lwv~sn~l~~~~~g~l~d~~~~nfrI~r~~~~~~~i~~t~  376 (381)
T 3q6k_A          300 SCWNTQK--MPLRMKNTDVVYTSS-RFVFGTDISVDSKGGLWFMSNGFPPIRKSEKFKYDFPRYRLMRIMDTQEAIAGTA  376 (381)
T ss_dssp             EEEETTS--CSBCGGGEEEEEECT-TCCSEEEEEECTTSCEEEEECSCCSSTTGGGCCCSSCSEEEEEESCHHHHHTTST
T ss_pred             EEEeCCC--CccccCceEEEEECC-CccccCeEEECCCCeEEEEECcchHhhcCCcCCCCcCCEEEEEecCHHHHhcCCC
Confidence            9999985  279999999999976 9999999999999999999999999999999 999999999999 9999999999


Q ss_pred             CCC
Q psy14737       1169 CDV 1171 (1171)
Q Consensus      1169 C~~ 1171 (1171)
                      |++
T Consensus       377 C~~  379 (381)
T 3q6k_A          377 CDM  379 (381)
T ss_dssp             TSC
T ss_pred             CCC
Confidence            986
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1171
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.35
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.32
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.2
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.15
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.12
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.09
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.09
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.07
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.97
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.93
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.91
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.87
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.51
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.48
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.4
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.96
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.65
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.39
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.3
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.27
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.13
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.09
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.03
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.87
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.86
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 96.68
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.22
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.5
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.24
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.24
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.19
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.15
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.05
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.9
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 94.79
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 94.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 94.45
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 94.19
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 94.09
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.41
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 92.93
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 92.32
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 88.02
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 85.4
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 85.22
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 84.28
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 84.1
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 81.27
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 81.26
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 80.66
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 80.01
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: All0351-like
domain: Hypothetical protein All0351 homologue
species: Nostoc punctiforme [TaxId: 272131]

Probab=99.35  E-value=3.1e-10  Score=122.91  Aligned_cols=265  Identities=12%  Similarity=0.036  Sum_probs=177.0

Q ss_pred             cCCCceeeeEEe-CCeEEEEecCCCCCCCcEEEEEEecCCCCCCCCCcccCCCccccccCCCCCCcEEEeeEEEEeCCCe
Q psy14737        813 QENNLPLGLDRW-HDKLFVTIPRWKSGIVSTLNYINLTEAKGNLSPNLKPYPSYEINNIHKKNGTTLVSGFRINVDVCDR  891 (1171)
Q Consensus       813 p~n~~P~gV~v~-~gRiFVT~PR~~~GvP~TL~~V~~~~~g~~~sP~L~PYPsw~~N~~~~~~~~~LvSV~~i~ID~cgR  891 (1171)
                      |.+..|.|+++. +||+|+|-+.  .+   ++-.++.  ++     ..+.++...            -.+.++.+|++|+
T Consensus        25 p~~~~~e~iAv~pdG~l~vt~~~--~~---~I~~i~p--~g-----~~~~~~~~~------------~~~~gla~~~dG~   80 (302)
T d2p4oa1          25 PVNTFLENLASAPDGTIFVTNHE--VG---EIVSITP--DG-----NQQIHATVE------------GKVSGLAFTSNGD   80 (302)
T ss_dssp             CTTCCEEEEEECTTSCEEEEETT--TT---EEEEECT--TC-----CEEEEEECS------------SEEEEEEECTTSC
T ss_pred             CCCCCcCCEEECCCCCEEEEeCC--CC---EEEEEeC--CC-----CEEEEEcCC------------CCcceEEEcCCCC
Confidence            334468899998 8999999765  33   6777764  32     233332111            1467889999999


Q ss_pred             EEEEeCCCCCCCCCCCccCCCEEEEEECCCCcEEEEEECCccccccCcceeeEEEecCCCCCCceEEEEEcCCCCeEEEE
Q psy14737        892 LWMVDTGLADILGEGNQISTPRIVVIDLKTDKIIKEHTIAKEDIAAHSFFANILVDTTPNTCDKAFAYIPDLGGFQMIVY  971 (1171)
Q Consensus       892 LWVLDtG~~~~~~~~~~~cpPKLvvfDL~Tdklir~y~~p~~v~~~~S~lndivVD~~~~~C~~~~aYItDsg~~gLIVy  971 (1171)
                      |||.+.+.-..          .++-.+-.+++.......+     ....++++++|..      +.+|++|+....+..+
T Consensus        81 l~v~~~~~~~~----------~~~~~~~~~~~~~~~~~~~-----~~~~~n~i~~~~~------g~~~v~~~~~~~i~~~  139 (302)
T d2p4oa1          81 LVATGWNADSI----------PVVSLVKSDGTVETLLTLP-----DAIFLNGITPLSD------TQYLTADSYRGAIWLI  139 (302)
T ss_dssp             EEEEEECTTSC----------EEEEEECTTSCEEEEEECT-----TCSCEEEEEESSS------SEEEEEETTTTEEEEE
T ss_pred             eEEEecCCceE----------EEEEecccccceeeccccC-----CccccceeEEccC------CCEEeeccccccceee
Confidence            99998764311          2333444455665555555     3466899999854      6899999999999999


Q ss_pred             ECCCCeEEEEecc-ccccCCCCCceeecCeeeeecCCcceeeecCCCCCCCceeEEEEeCCCceEEEEechhhcccCCCc
Q psy14737        972 DLENNESYKVKHH-YFYFDPLSGNYNVGGVNFQWTDGVFGVALSPVHKEDGYRTLYFHPLSSTREFSVNTKILQNKTTAS 1050 (1171)
Q Consensus       972 Dl~~g~swRv~~~-~~~~dP~~~~f~i~G~~f~~~dGI~GIALsp~~~~dg~r~LYf~plss~~ly~V~T~~Lr~~~~~~ 1050 (1171)
                      |..++..+.+... .........          .....+||+.+.       ..||+......++++++.......    
T Consensus       140 ~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~ngi~~~~-------~~l~~~~~~~~~i~~~~~~~~~~~----  198 (302)
T d2p4oa1         140 DVVQPSGSIWLEHPMLARSNSES----------VFPAANGLKRFG-------NFLYVSNTEKMLLLRIPVDSTDKP----  198 (302)
T ss_dssp             ETTTTEEEEEEECGGGSCSSTTC----------CSCSEEEEEEET-------TEEEEEETTTTEEEEEEBCTTSCB----
T ss_pred             eccCCcceeEecCCccceeeccC----------cccccccccccC-------CceeeecCCCCeEEeccccccccc----
Confidence            9999988877642 222211110          012456777653       379999999999999986432111    


Q ss_pred             ccccceEEecccCCCCCCceeEeecCCCeEEEeecCCCeEEEEeCCCCCCcCCCCceeEEEecCCCccCCCcEEEcC---
Q psy14737       1051 NSYYEFKVLGSRGPNSQATAESLDEKTGVLFYTQVNKDGVGCWNSYKHANEYSADTTDLVATDSETLVFPNDLKVDK--- 1127 (1171)
Q Consensus      1051 ~~~~~v~~lG~rG~~sqs~g~~~D~~~G~LYft~~~~~aI~~Wdt~~~~~~~~~~n~~~V~~dd~~L~wPd~v~id~--- 1127 (1171)
                         ...+.... +  ...+|+++| .+|+||++....++|.++++++   .     ...++.....+..|+.++++.   
T Consensus       199 ---~~~~~~~~-~--~~pdgia~d-~dG~l~va~~~~~~V~~i~p~G---~-----~~~~~~~~~~~~~pt~vafg~~~~  263 (302)
T d2p4oa1         199 ---GEPEIFVE-Q--TNIDDFAFD-VEGNLYGATHIYNSVVRIAPDR---S-----TTIIAQAEQGVIGSTAVAFGQTEG  263 (302)
T ss_dssp             ---CCCEEEEE-S--CCCSSEEEB-TTCCEEEECBTTCCEEEECTTC---C-----EEEEECGGGTCTTEEEEEECCSTT
T ss_pred             ---cccccccC-C--CCCcceEEC-CCCCEEEEEcCCCcEEEECCCC---C-----EEEEEecCCCCCCceEEEEcCCCC
Confidence               11111111 1  247899999 8999999999999999999987   3     345665556788999999953   


Q ss_pred             CC-cEEEEeCCccccccCCCCCCcccEEEEEeehh
Q psy14737       1128 EG-YLWVLSDKLPVHIHKGLHTDEINYRIFQTPVK 1161 (1171)
Q Consensus      1128 dg-~LwVlsnrl~~f~~~~ld~~e~nfrI~r~~v~ 1161 (1171)
                      |+ .|||.++.-....   ......+-+|+++++.
T Consensus       264 D~~~Lyvtt~~g~~~~---~~~~~~~~~~~~~~~~  295 (302)
T d2p4oa1         264 DCTAIYVVTNGGMFLP---PPTGVVPANVVRLEVG  295 (302)
T ss_dssp             TTTEEEEEECTTSSSC---CTTCCCCEEEEEEECS
T ss_pred             CCCEEEEECCCCccCC---CcCCcCCCeEEEEeCC
Confidence            44 5999998643322   1224566889988753
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure