Psyllid ID: psy14902

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-----
MYRWLFLALLPLLWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGYT
cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHccccccccccccHHHHcccccccccccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHcccccEEEEEEEcccccHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEEcccHHccccccccccccccccccccccccccEEccEEEEccccccccccccEEEEEEEccccccccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHccccHHHHHccccccHHHHccccccccccccHHHHHHHHcccccccEEEEEcccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHcccccccHHccHHHcccccEEEEEccHHHHcccccccccccEHHHHHHHHcHHHccccccccccccHHHHHHHHHHHHHHccccEEEEEccHHHHccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccEHHHHHccHHHccHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHccEEEEEEEccEEEEcccccHHHHHHHHHHHHHHHcHcccccEccccccHHHHHHHHHHHHHHccccHHHcccccHHHHHHHcccccEEEEEcccEEEEEEccccccccccHHHHccccccccEcccEccccccEcccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHEEEEEccHHHHccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccEHHHHHccHHHccHHHHHHHHHHHHHHHHcHHHEEEEEccccEHHccccEEEEEEEccEcccccccHHHcccccEEEEccccHHHcccccccEEEEEccccccccccccccccHHHHHHHHHcEccccccEcccHHHHHHHHHHHHHcccccEEEEEccEEcccccccccccHHEEEcccccccEEEEEcccEEEcccccccccccEHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEccHHHHcccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHccEEEEEEEccEEEEcccccHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccHHHccccEEEEEcccccccccccHHHHHHHHHHHHccccEEEEEEcccEccccHHHccc
MYRWLFLALLPLLWSTVELKrsqdkggnlgtqmnkhqfppgflwgcSTAAFQvegawnedgkgeniwdhlvhtqpdlvkdrqnadvaCDSYHKYKEDVALIRDIGFQVYRFSlswsrilptgdtdrineKGVQYYRNLINEVlskniqpmvtlnhydlpqplqefggwanpvvaDYFESFADVAFKtfgdkvpywitinepldvmggygyksgapylnlsglggDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVsitldscnyyphnatskeDQEAAERVFQFTLGlfahpiyseagdyppiVRQIVDqnsakegrarsrlprftEEEIKALKGSFDFFALNHYTSILIannnhtsnappstindraatfsqdpnwpssnspwlkvvPDGFRALLNWIKkeynnppvfitengfsddgrlddegridYYAFQVYRFSlswsrilptgdidkiNEKGVQYYRNLIDELLLNNIQPMVTLyhwdlpqplqdfggwtNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILdnfewldgytcrfgivhvdfsssfdyfglnhytsflvskktepspepsfrndanvvlsddrkwpkgasfWLKVVPDGFRALLNWIKkeynnppvfitengfsddgqlddqgrvdfyqglsvsfpcfwfmvnvpffvpshyvpsgkgeniwdrlvhtnpaavvdkqngdvacdsyHKYKEDVAIIKDLGFQVYRFslswsrilptgdidkiNEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAmqgydfktyapylsmtgvgGEYLAAHNLLRSHAKAYRLYekkykpsqkgkvaltlnthfnypldpsskeDQEAAERYIQFKfglfahpiysqagdyppivRQIVDqnsakegrarsrlprftEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAigedkcnvIGYTAWSLLDNFEWLCGYT
MYRWLFLALLPLLWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSlswsrilptgdtdrinEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDqnsakegrarsrlprftEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKeynnppvfITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVSkktepspepsfrndanvvlsddrkWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSlswsrilptgdidkinEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDqnsakegrarsrlprfteeeikalkgkteeeinalkgKQKYLTALSKAIGEDKCNKYLTALSkaigedkcNVIGYTAWSLLDNFEWLCGYT
MYRWlflallpllWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGYT
*YRWLFLALLPLLWSTVELK**************KHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHN*********AERVFQFTLGLFAHPIYSEAGDYPPIVRQIV********************EIKALKGSFDFFALNHYTSILIAN******************************PWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLV*****************VVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYP************ERYIQFKFGLFAHPIYSQAGDYPPIVRQIV************************************KGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGY*
*YRWLFLALLPLLWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGYT
MYRWLFLALLPLLWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVS***********RNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGYT
MYRWLFLALLPLLWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGYT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRWLFLALLPLLWSTVELKRSQDKGGNLGTQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFLVSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVKLWITIKETLEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGKTEEEINALKGKQKYLTALSKAIGEDKCNKYLTALSKAIGEDKCNVIGYTAWSLLDNFEWLCGYT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query985 2.2.26 [Sep-21-2011]
P09849 1926 Lactase-phlorizin hydrola yes N/A 0.734 0.375 0.336 1e-128
P09848 1927 Lactase-phlorizin hydrola yes N/A 0.786 0.402 0.331 1e-120
Q95X01464 Myrosinase 1 OS=Brevicory N/A N/A 0.393 0.836 0.524 1e-118
Q024011928 Lactase-phlorizin hydrola yes N/A 0.395 0.202 0.464 1e-99
Q6UWM7567 Lactase-like protein OS=H no N/A 0.420 0.730 0.440 4e-96
Q8K1F9566 Lactase-like protein OS=M no N/A 0.393 0.685 0.446 3e-94
Q5RF65469 Cytosolic beta-glucosidas no N/A 0.452 0.950 0.415 2e-90
Q9H227469 Cytosolic beta-glucosidas no N/A 0.452 0.950 0.410 8e-90
P97265469 Cytosolic beta-glucosidas no N/A 0.450 0.946 0.398 5e-88
Q9FIW4490 Beta-glucosidase 42 OS=Ar yes N/A 0.385 0.775 0.436 6e-84
>sp|P09849|LPH_RABIT Lactase-phlorizin hydrolase OS=Oryctolagus cuniculus GN=LCT PE=1 SV=1 Back     alignment and function desciption
 Score =  459 bits (1181), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 311/923 (33%), Positives = 435/923 (47%), Gaps = 200/923 (21%)

Query: 42   FLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALI 101
            FLWG S++A+Q+EGAW+ DGKG +IWD+  HT  + V D    D+ACDSY++   D+ ++
Sbjct: 905  FLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGNGVTDNSTGDIACDSYNQLDADLNVL 964

Query: 102  RDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQP 161
            R +  + YRFSLSWSRI PTG    IN  GV YY  LI+ +L+ +I PMVTL H+DLPQ 
Sbjct: 965  RALKVKAYRFSLSWSRIFPTGTNSSINSHGVDYYNRLIDGLLASDIFPMVTLFHWDLPQA 1024

Query: 162  LQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYLNLSG 221
            LQ+ GGW NP + D F+S+AD  F+TFGD+V +WIT NEP      + Y SG    N++ 
Sbjct: 1025 LQDIGGWENPSLIDLFDSYADYCFQTFGDRVKFWITFNEP-TYYSWWSYGSGTFPPNVND 1083

Query: 222  LG-GDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQEAAER 280
             G   Y ++H L++AHA+ Y  Y++KY+  Q G +S++L +    P +     D EAA+R
Sbjct: 1084 PGWAPYRISHALIKAHARVYHTYDEKYRQSQNGVISLSLVAQWAEPKSPDVLRDVEAADR 1143

Query: 281  VFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFF 340
              QFTLG +AHPI+ + GDYP  ++  V   S  +  A SRLP FTEEE   ++G+ D F
Sbjct: 1144 KMQFTLGWYAHPIF-KTGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKSYIRGTADVF 1202

Query: 341  ALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIK 400
             L          N ++S                            K+V     AL     
Sbjct: 1203 CL----------NTYSS----------------------------KIVQHKTPAL----- 1219

Query: 401  KEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQY 460
                NPP       + DD  L +E               SW    PT  +++    G++ 
Sbjct: 1220 ----NPP------SYEDDQELAEEE------------DTSW----PTTAMNRAASFGMRR 1253

Query: 461  YRNLIDELLLNNIQPMVTLYHWDLPQPLQDFG-GWTNAIIADYFETYADFAYKTFGDKKY 519
              N I E             + D+P  + + G G TN  + D       F YKT     Y
Sbjct: 1254 LLNWIKE------------EYGDIPIYITENGVGLTNPRLEDIDRI---FYYKT-----Y 1293

Query: 520  LTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHYTSFL 579
            +    KA   D  N+ GY AWS++DNFEWL GYT +              FGL H     
Sbjct: 1294 INEALKAYRLDGVNLRGYFAWSLMDNFEWLQGYTIK--------------FGLYHVDFEN 1339

Query: 580  VSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNPPVFI 639
            V++        S+  +  ++ ++    P    F     P+GF                  
Sbjct: 1340 VNRPRTARISASYYTE--LITNNGMPLPSEDEFVYGQFPEGF------------------ 1379

Query: 640  TENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDRLVHT 699
                                          W      F +   +   GKG  IWD   HT
Sbjct: 1380 -----------------------------VWSTSTAAFQIEGAWRADGKGLGIWDTFTHT 1410

Query: 700  NPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINEKGVQ 759
                + +    DVACDSYHK  EDV  +++L    YRFS+SWSRILP G  + INE G+ 
Sbjct: 1411 R-LKIENDDIADVACDSYHKISEDVVALQNLAVTHYRFSISWSRILPDGTTNYINEAGLN 1469

Query: 760  YYRNLIDELLLNNIQPMV-----------------------------------------K 778
            YY  LID LL  NI+P V                                         K
Sbjct: 1470 YYVRLIDALLAANIKPQVTMYHFDLPQALQDVGGWENETIVQRFKEYADVLFQRLGDKVK 1529

Query: 779  LWITIKET-LEAMQGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYKPSQK 837
             WIT+ E  + A  GY    YAP +        Y+  HNL+++HA+A+ LY   Y+ SQ 
Sbjct: 1530 FWITLNEPFVVAYHGYGTGLYAPGIYFRPGTAPYIVGHNLIKAHAEAWHLYNDVYRASQG 1589

Query: 838  GKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIVDQNS 897
            G +++T+++ +  P DPS++ED EAA+RY+QF  G FAHPI+ + GDY  +++  + + S
Sbjct: 1590 GVISITISSDWAEPRDPSNQEDVEAAKRYVQFMGGWFAHPIF-KNGDYNEVMKTQIRERS 1648

Query: 898  AKEGRARSRLPRFTEEEIKALKG 920
               G   SRLP FTE E + + G
Sbjct: 1649 LAAGLNESRLPEFTESEKRRING 1671
LPH splits lactose in the small intestine.
Oryctolagus cuniculus (taxid: 9986)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 6EC: 2
>sp|P09848|LPH_HUMAN Lactase-phlorizin hydrolase OS=Homo sapiens GN=LCT PE=1 SV=3 Back     alignment and function description
>sp|Q95X01|MYRO1_BREBR Myrosinase 1 OS=Brevicoryne brassicae PE=1 SV=1 Back     alignment and function description
>sp|Q02401|LPH_RAT Lactase-phlorizin hydrolase OS=Rattus norvegicus GN=Lct PE=2 SV=2 Back     alignment and function description
>sp|Q6UWM7|LCTL_HUMAN Lactase-like protein OS=Homo sapiens GN=LCTL PE=1 SV=2 Back     alignment and function description
>sp|Q8K1F9|LCTL_MOUSE Lactase-like protein OS=Mus musculus GN=Lctl PE=2 SV=1 Back     alignment and function description
>sp|Q5RF65|GBA3_PONAB Cytosolic beta-glucosidase OS=Pongo abelii GN=GBA3 PE=2 SV=1 Back     alignment and function description
>sp|Q9H227|GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens GN=GBA3 PE=1 SV=2 Back     alignment and function description
>sp|P97265|GBA3_CAVPO Cytosolic beta-glucosidase OS=Cavia porcellus GN=Gba3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIW4|BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana GN=BGLU42 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query985
291391494 1926 PREDICTED: lactase-phlorizin hydrolase-l 0.738 0.377 0.338 1e-129
415865 1920 lactase-phlorizin hydrolase [Oryctolagus 0.734 0.376 0.339 1e-128
156119346 1926 lactase-phlorizin hydrolase precursor [O 0.734 0.375 0.336 1e-126
415863 1919 lactase-phlorizin hydrolase [Oryctolagus 0.738 0.378 0.343 1e-126
291391492 1925 PREDICTED: lactase-phlorizin hydrolase-l 0.734 0.375 0.343 1e-126
270009723877 hypothetical protein TcasGA2_TC009018 [T 0.532 0.598 0.410 1e-125
332236929 1927 PREDICTED: lactase-phlorizin hydrolase [ 0.786 0.402 0.334 1e-121
355751620 1928 hypothetical protein EGM_05165 [Macaca f 0.779 0.398 0.337 1e-121
355566020 1928 hypothetical protein EGK_05718 [Macaca m 0.779 0.398 0.337 1e-121
297266842 1927 PREDICTED: lactase-phlorizin hydrolase [ 0.779 0.398 0.336 1e-120
>gi|291391494|ref|XP_002712475.1| PREDICTED: lactase-phlorizin hydrolase-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 314/927 (33%), Positives = 442/927 (47%), Gaps = 200/927 (21%)

Query: 38   FPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKED 97
            F   FLWG S++A+Q+EGAW+ DGKG +IWD+  HT  + V D    D+ACDSY++   D
Sbjct: 901  FRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGNGVMDNSTGDIACDSYNQLDAD 960

Query: 98   VALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYD 157
            + ++R +  + YRFSLSWSRI PTG    IN  GV YY  LI+ +L+ +I PMVTL H+D
Sbjct: 961  LNVLRALKVKAYRFSLSWSRIFPTGTNSSINSHGVDYYNRLIDGLLASDIFPMVTLFHWD 1020

Query: 158  LPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPYL 217
            LPQ LQ+ GGW NP + D F+S+AD  F+TFGD+V +WIT+NEP      + Y SG    
Sbjct: 1021 LPQALQDIGGWENPSLIDLFDSYADYCFQTFGDRVKFWITLNEPT-YYSWWSYGSGTFPP 1079

Query: 218  NLSGLG-GDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQE 276
            N++  G   Y ++H L++AHA+ Y  Y++KY+  Q G +S++L +    P +     D E
Sbjct: 1080 NVNDPGWAPYRISHALIKAHARVYHTYDEKYRQSQNGVISLSLVAQWAEPKSPDVLRDVE 1139

Query: 277  AAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGS 336
            AA+R  QFTLG +AHPI+ + GDYP  ++  V   S  +  A SRLP FTEEE   ++G+
Sbjct: 1140 AADRKMQFTLGWYAHPIF-KTGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKSYIRGT 1198

Query: 337  FDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALL 396
             D F L          N ++S                            K+V     AL 
Sbjct: 1199 ADVFCL----------NTYSS----------------------------KIVQHKTPAL- 1219

Query: 397  NWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEK 456
                    NPP       + DD  L +E               SW    PT  +++    
Sbjct: 1220 --------NPP------SYEDDQELAEEE------------DTSW----PTTAMNRAASF 1249

Query: 457  GVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFG-GWTNAIIADYFETYADFAYKTFG 515
            G++   N I E             + D+P  + + G G TN  + D       F YKT  
Sbjct: 1250 GMRRLLNWIKE------------EYGDIPIYITENGVGLTNPELEDIDRI---FYYKT-- 1292

Query: 516  DKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSSSFDYFGLNHY 575
               Y+    KA   D  N+ GY+AWS++DNFEWL GYT +              FGL H 
Sbjct: 1293 ---YINEALKAYRLDGVNLRGYSAWSLMDNFEWLRGYTVK--------------FGLYHV 1335

Query: 576  TSFLVSKKTEPSPEPSFRNDANVVLSDDRKWPKGASFWLKVVPDGFRALLNWIKKEYNNP 635
                V++        S+ ++  ++ ++    P    F     P+GF              
Sbjct: 1336 DFEDVNRPRTARISASYYSE--LITNNGMPLPSEDEFVYGQFPEGF-------------- 1379

Query: 636  PVFITENGFSDDGQLDDQGRVDFYQGLSVSFPCFWFMVNVPFFVPSHYVPSGKGENIWDR 695
                                              W      + +   +   GKG +IWD 
Sbjct: 1380 ---------------------------------VWSAATAAYQIEGAWRADGKGLSIWDT 1406

Query: 696  LVHTNPAAVVDKQNGDVACDSYHKYKEDVAIIKDLGFQVYRFSLSWSRILPTGDIDKINE 755
              HT P  + +    DVACDSYHK  EDV  +++L    YRFS+SWSRILP G  + INE
Sbjct: 1407 FTHT-PLKIENDDIADVACDSYHKISEDVVALQNLAVTHYRFSISWSRILPDGTTNYINE 1465

Query: 756  KGVQYYRNLIDELLLNNIQPMV-------------------------------------- 777
             G+ YY  LID LL  NI+P V                                      
Sbjct: 1466 AGLNYYVRLIDALLAANIKPQVTLYHWDLPQALQDVGGWENETIVQRFREYADVLFQRLG 1525

Query: 778  ---KLWITIKETLEAM-QGYDFKTYAPYLSMTGVGGEYLAAHNLLRSHAKAYRLYEKKYK 833
               K WIT+ E    +  GY    YAP +S+      Y+A HNL+++HA+A+ LY   Y+
Sbjct: 1526 DKVKFWITLNEPFVIVNHGYGNGVYAPGISLRPGTAPYIAGHNLIKAHAEAWHLYNDVYR 1585

Query: 834  PSQKGKVALTLNTHFNYPLDPSSKEDQEAAERYIQFKFGLFAHPIYSQAGDYPPIVRQIV 893
             SQ G +++T+N+ +  P DPS++ED EAA RY+QF  G FAHPI+ + GDY  +++  +
Sbjct: 1586 ASQGGVISITINSDWAEPRDPSNQEDVEAAMRYVQFMGGWFAHPIF-KNGDYHEVMKTRI 1644

Query: 894  DQNSAKEGRARSRLPRFTEEEIKALKG 920
             + S   G   SRLP FTE E + + G
Sbjct: 1645 RERSLAAGLNESRLPEFTESEKRRING 1671

Source: Oryctolagus cuniculus

Species: Oryctolagus cuniculus

Genus: Oryctolagus

Family: Leporidae

Order: Lagomorpha

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|415865|emb|CAA81691.1| lactase-phlorizin hydrolase [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|156119346|ref|NP_001095159.1| lactase-phlorizin hydrolase precursor [Oryctolagus cuniculus] gi|126429|sp|P09849.1|LPH_RABIT RecName: Full=Lactase-phlorizin hydrolase; AltName: Full=Lactase-glycosylceramidase; Includes: RecName: Full=Lactase; Includes: RecName: Full=Phlorizin hydrolase; Flags: Precursor gi|1617|emb|CAA30802.1| lactase phlorizin hydrolase [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|415863|emb|CAA81690.1| lactase-phlorizin hydrolase [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|291391492|ref|XP_002712474.1| PREDICTED: lactase-phlorizin hydrolase-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|270009723|gb|EFA06171.1| hypothetical protein TcasGA2_TC009018 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332236929|ref|XP_003267652.1| PREDICTED: lactase-phlorizin hydrolase [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|355751620|gb|EHH55875.1| hypothetical protein EGM_05165 [Macaca fascicularis] Back     alignment and taxonomy information
>gi|355566020|gb|EHH22449.1| hypothetical protein EGK_05718 [Macaca mulatta] Back     alignment and taxonomy information
>gi|297266842|ref|XP_001096426.2| PREDICTED: lactase-phlorizin hydrolase [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query985
UNIPROTKB|E1BK891928 LCT "Uncharacterized protein" 0.395 0.202 0.478 1.6e-106
UNIPROTKB|F1NAN41936 LCT "Uncharacterized protein" 0.396 0.201 0.468 4.2e-105
UNIPROTKB|I3L7V11930 LOC100625897 "Uncharacterized 0.395 0.202 0.468 8e-104
RGD|6208231928 Lct "lactase" [Rattus norvegic 0.395 0.202 0.465 1.8e-101
UNIPROTKB|P098481927 LCT "Lactase-phlorizin hydrola 0.394 0.201 0.474 7.8e-104
UNIPROTKB|F1PDK61360 LCT "Uncharacterized protein" 0.394 0.286 0.474 2.7e-107
ZFIN|ZDB-GENE-081104-4341898 si:dkey-79p17.2 "si:dkey-79p17 0.393 0.204 0.469 1.8e-107
UNIPROTKB|H0Y4E41003 LCT "Lactase" [Homo sapiens (t 0.439 0.431 0.420 3.5e-121
UNIPROTKB|F1S0D71005 F1S0D7 "Uncharacterized protei 0.438 0.429 0.417 3.3e-117
UNIPROTKB|F1NEP31034 KLB "Uncharacterized protein" 0.300 0.286 0.424 4.9e-108
UNIPROTKB|E1BK89 LCT "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 998 (356.4 bits), Expect = 1.6e-106, Sum P(2) = 1.6e-106
 Identities = 190/397 (47%), Positives = 258/397 (64%)

Query:    37 QFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKE 96
             QFP  F+W  +TA++Q+EGAW  DGKG +IWD   HT P  V++    DVACDSYHK  E
Sbjct:  1377 QFPKDFIWSAATASYQIEGAWRADGKGLSIWDTFSHT-PLKVENNDTGDVACDSYHKIAE 1435

Query:    97 DVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHY 156
             D+A ++ +G   YRFS+SW+RILP G    +NE G+ YY  LI+ +L+ NIQP VT+ H+
Sbjct:  1436 DLAALQTLGVTHYRFSISWTRILPDGTNRYVNEAGLDYYVRLIDTLLAANIQPQVTIYHW 1495

Query:   157 DLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVM-GGYGYKSGAP 215
             DLPQ LQ+ GGW N  +   F+ +A+V F+  GDKV +WIT+NEP  V   GYGY + AP
Sbjct:  1496 DLPQALQDVGGWENETIVQRFKEYAEVLFQRLGDKVKFWITLNEPYVVAYQGYGYGTAAP 1555

Query:   216 YLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQ 275
              ++       Y+V HNL++AHA+A+ LY   Y++ Q G +SIT+ S    P + +++ED 
Sbjct:  1556 GISFRPGTAPYIVGHNLIKAHAEAWHLYNDVYRARQGGVISITISSDWAEPRDPSNQEDV 1615

Query:   276 EAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKG 335
             EAA+R  QF  G FAHPI+   GDYP +++  +   S  EG  +SRLP FTE E + + G
Sbjct:  1616 EAAKRYVQFMGGWFAHPIFKN-GDYPEVMKTRIRDRSLAEGLNKSRLPEFTESEKRRING 1674

Query:   336 SFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRAL 395
             ++DFF  NHYT++L  N N+ S    S   DR      D +WP S S WLK+ P GFR +
Sbjct:  1675 TYDFFGFNHYTTVLAYNLNYASWIS-SFDADRGVASITDRSWPDSGSFWLKMTPFGFRRI 1733

Query:   396 LNWIKKEYNNPPVFITENGFSDDGR--LDDEGRIDYY 430
             LNW+K+EYNNPP+++TENG S  G   L+D  RI YY
Sbjct:  1734 LNWLKEEYNNPPIYVTENGVSHRGEANLNDTARI-YY 1769
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
UNIPROTKB|F1NAN4 LCT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7V1 LOC100625897 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|620823 Lct "lactase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P09848 LCT "Lactase-phlorizin hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDK6 LCT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-434 si:dkey-79p17.2 "si:dkey-79p17.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y4E4 LCT "Lactase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0D7 F1S0D7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEP3 KLB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1.21LOW CONFIDENCE prediction!
3rd Layer3.2.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 1e-142
TIGR03356426 TIGR03356, BGL, beta-galactosidase 1e-106
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 1e-104
PLN02814504 PLN02814, PLN02814, beta-glucosidase 2e-87
PLN02849503 PLN02849, PLN02849, beta-glucosidase 5e-85
PLN02998497 PLN02998, PLN02998, beta-glucosidase 6e-79
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 1e-65
pfam00232 454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 8e-62
PRK09589476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 1e-52
PRK09852474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 3e-47
PRK09593478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 1e-44
PRK15014477 PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl 4e-44
TIGR01233467 TIGR01233, lacG, 6-phospho-beta-galactosidase 3e-43
TIGR03356426 TIGR03356, BGL, beta-galactosidase 4e-43
COG2723 460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 1e-41
PLN02814 504 PLN02814, PLN02814, beta-glucosidase 1e-38
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 9e-37
PLN02849 503 PLN02849, PLN02849, beta-glucosidase 1e-35
PLN02998 497 PLN02998, PLN02998, beta-glucosidase 2e-34
TIGR03356426 TIGR03356, BGL, beta-galactosidase 4e-32
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 1e-30
PRK13511 469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 8e-26
PLN02998497 PLN02998, PLN02998, beta-glucosidase 1e-22
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 3e-21
PLN02814504 PLN02814, PLN02814, beta-glucosidase 2e-20
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 7e-20
PLN02849503 PLN02849, PLN02849, beta-glucosidase 7e-20
PRK15014477 PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl 4e-17
PRK09589476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 4e-16
PRK09589 476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 2e-15
PRK09852474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 2e-15
PRK09852 474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 3e-15
TIGR03356426 TIGR03356, BGL, beta-galactosidase 6e-14
PRK09593 478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 1e-13
TIGR01233 467 TIGR01233, lacG, 6-phospho-beta-galactosidase 3e-13
PRK15014 477 PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl 4e-13
TIGR01233467 TIGR01233, lacG, 6-phospho-beta-galactosidase 4e-13
PRK09593478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 7e-13
TIGR03356426 TIGR03356, BGL, beta-galactosidase 5e-12
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 2e-11
PLN02814504 PLN02814, PLN02814, beta-glucosidase 7e-09
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 5e-08
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 5e-08
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 2e-07
TIGR03356426 TIGR03356, BGL, beta-galactosidase 7e-07
TIGR01233467 TIGR01233, lacG, 6-phospho-beta-galactosidase 8e-07
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 2e-05
PRK09589476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 2e-05
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 1e-04
PLN02849503 PLN02849, PLN02849, beta-glucosidase 3e-04
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 0.002
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information 
 Score =  432 bits (1113), Expect = e-142
 Identities = 185/399 (46%), Positives = 249/399 (62%), Gaps = 23/399 (5%)

Query: 37  QFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKE 96
            FP  FLWG +TAA+Q+EGAWNEDGKG +IWD   HT P  V    N DVACDSYH+YKE
Sbjct: 4   TFPEDFLWGAATAAYQIEGAWNEDGKGPSIWDTFCHT-PGKVFGGHNGDVACDSYHRYKE 62

Query: 97  DVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHY 156
           DVAL++++G   YRFS+SW RI P G+ + INE G+ YY  LI+E+L+  I+P VTL H+
Sbjct: 63  DVALMKELGVTAYRFSISWPRIFPKGEGE-INEAGLDYYDRLIDELLAAGIEPYVTLYHW 121

Query: 157 DLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPY 216
           DLPQ LQ++GGW N    D F+ +AD  FK FGD+V YW+T NEP  V    GY +G   
Sbjct: 122 DLPQALQDYGGWLNRSTIDDFKDYADTCFKRFGDRVKYWLTFNEPW-VAAWLGYGTGVHA 180

Query: 217 LNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQE 276
              +     Y  AH+LL AHA+A +LY + Y   QKG++ I L+    YP + +  +D E
Sbjct: 181 PGGNDGVAPYQAAHHLLLAHARAVKLYREHY---QKGQIGIVLNLSWAYPLSPSPPDDVE 237

Query: 277 AAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGS 336
           AAER  QF  G F  P++   GDYP  +R+IV          R  LP FTEE+ + +KG 
Sbjct: 238 AAERADQFHNGWFLDPVFR--GDYPEEMREIV--------GERGGLPNFTEEDKELIKGP 287

Query: 337 FDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALL 396
           +DF  LN+YTS  + N+   SN P  T          +P+WPS++  W+ + P+G R LL
Sbjct: 288 YDFLGLNYYTSRRVRNDPEPSNIPSYT-EGIGMDSEVNPSWPSTDWGWI-IYPEGLRDLL 345

Query: 397 NWIKKEYNNPPVFITENGFS-----DDGRLDDEGRIDYY 430
           N +K++Y NPP++ITENG       ++G ++D+ RIDY 
Sbjct: 346 NRLKEDYGNPPIYITENGAGYKDEVENGTVNDDKRIDYL 384

Length = 454
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 985
KOG0626|consensus524 100.0
PLN02998497 beta-glucosidase 100.0
PLN02814504 beta-glucosidase 100.0
PLN02849503 beta-glucosidase 100.0
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 100.0
PRK13511469 6-phospho-beta-galactosidase; Provisional 100.0
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 100.0
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 100.0
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 100.0
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 100.0
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 100.0
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 100.0
TIGR03356427 BGL beta-galactosidase. 100.0
KOG0626|consensus524 100.0
PLN02998497 beta-glucosidase 100.0
PLN02849503 beta-glucosidase 100.0
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 100.0
PLN02814504 beta-glucosidase 100.0
PRK13511469 6-phospho-beta-galactosidase; Provisional 100.0
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 100.0
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 100.0
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 100.0
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 100.0
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 100.0
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 100.0
TIGR03356427 BGL beta-galactosidase. 100.0
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.8
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 98.62
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 98.32
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 98.22
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 97.43
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 97.11
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 96.46
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 96.17
PRK10150604 beta-D-glucuronidase; Provisional 95.72
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 95.68
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 95.28
COG1874673 LacA Beta-galactosidase [Carbohydrate transport an 95.23
PF01229486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 95.08
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 94.07
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 91.59
PLN02803548 beta-amylase 90.86
PLN02161531 beta-amylase 90.83
PF01373402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 90.57
PLN00197573 beta-amylase; Provisional 90.35
PRK10150604 beta-D-glucuronidase; Provisional 89.34
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 88.93
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 87.28
PLN02801517 beta-amylase 87.21
PLN03059840 beta-galactosidase; Provisional 86.94
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 86.85
PLN02905702 beta-amylase 86.16
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 85.58
PLN02705681 beta-amylase 85.47
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 84.01
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 82.2
>KOG0626|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.5e-114  Score=973.29  Aligned_cols=434  Identities=49%  Similarity=0.877  Sum_probs=391.3

Q ss_pred             ccccCCCCCCceehhhhchhhccCCCCCCCCcCceeeeccccCCCcccCCCCCCcccccccchHHHHHHHHHcCCCeeEe
Q psy14902         32 QMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRF  111 (985)
Q Consensus        32 ~~~~~~fp~~F~wG~atsa~Q~Eg~~~~~gkg~s~wd~~~~~~~~~~~~~~~~~~a~d~Y~ry~eDi~L~k~lG~~~yRf  111 (985)
                      .+....||+||+||+||||||+|||++++|||+|+||+|+|..|+++.++.++|+|||+||||+|||+|||+||+++|||
T Consensus        31 ~~~r~~FP~~F~FGtAtSAyQ~EGA~~e~gRg~svWD~f~~~~p~~~~~~~ngdva~D~Yh~ykeDv~Lmk~lgv~afRF  110 (524)
T KOG0626|consen   31 KFSRADFPKGFLFGTATSAYQVEGAANEDGRGPSVWDTFTHKYPGKICDGSNGDVAVDFYHRYKEDVKLMKELGVDAFRF  110 (524)
T ss_pred             cccccCCCCCceeeccchHHHhhhhhccCCCCCchhhhhhccCCcccccCCCCCeechhhhhhHHHHHHHHHcCCCeEEE
Confidence            45677899999999999999999999999999999999999888877788889999999999999999999999999999


Q ss_pred             eccccceecCCC-CCCCCHHHHHHHHHHHHHHHhCCCceeEEEecCCCcHhhHh-hCCCCChhhHHHHHHHHHHHHHHhC
Q psy14902        112 SLSWSRILPTGD-TDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQE-FGGWANPVVADYFESFADVAFKTFG  189 (985)
Q Consensus       112 SIsWsRI~P~G~-~~~~n~~gi~~Y~~li~~L~~~GIeP~VTL~H~dlP~~l~~-~GGW~n~~~v~~F~~Ya~~~~~~fg  189 (985)
                      |||||||+|.|+ .+.||++||+||++||++|+++||||+|||||||+||+|++ ||||+|+++|+.|.+||++||++||
T Consensus       111 SIsWSRIlP~G~~~~gVN~~Gi~fY~~LI~eL~~nGI~P~VTLfHwDlPq~LeDeYgGwLn~~ivedF~~yA~~CF~~fG  190 (524)
T KOG0626|consen  111 SISWSRILPNGRLTGGVNEAGIQFYNNLIDELLANGIEPFVTLFHWDLPQALEDEYGGWLNPEIVEDFRDYADLCFQEFG  190 (524)
T ss_pred             EeehHhhCCCCCcCCCcCHHHHHHHHHHHHHHHHcCCeEEEEEecCCCCHHHHHHhccccCHHHHHHHHHHHHHHHHHhc
Confidence            999999999998 46799999999999999999999999999999999999998 9999999999999999999999999


Q ss_pred             CCCCEEEeccCcccc-ccccccccCCCCCC----------CCCcchhHHHHHHHHHHHHHHHHHHHHhhhcCCCCcEEEe
Q psy14902        190 DKVPYWITINEPLDV-MGGYGYKSGAPYLN----------LSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSIT  258 (985)
Q Consensus       190 d~V~~W~T~NEP~~~-~~gy~~G~~~Pg~~----------~~~~~~~~~~~~~~l~Aha~a~~~~~~~~~~~~~gkVGi~  258 (985)
                      ||||+|||||||+++ ..||..|..|||+.          +.+ ++.|.|+||||+|||+||++||++|+..|+|+|||+
T Consensus       191 DrVK~WiT~NEP~v~s~~gY~~G~~aPGrCs~~~~~c~~g~s~-~epYiv~HNllLAHA~Av~~yr~kyk~~Q~G~IGi~  269 (524)
T KOG0626|consen  191 DRVKHWITFNEPNVFSIGGYDTGTKAPGRCSKYVGNCSAGNSG-TEPYIVAHNLLLAHAAAVDLYRKKYKKKQGGKIGIA  269 (524)
T ss_pred             ccceeeEEecccceeeeehhccCCCCCCCCCcccccCCCCCCC-CCcchHHHHHHHHHHHHHHHHHHhhhhhcCCeEeEE
Confidence            999999999999999 99999999999984          233 679999999999999999999999999999999999


Q ss_pred             ecCCccccCCCCCHHHHHHHHHHHHhhcccccccccccCCCCcHHHHHHHhhhccccccccCCCCCCCHHHHHhhcCCcc
Q psy14902        259 LDSCNYYPHNATSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFD  338 (985)
Q Consensus       259 ~~~~~~~P~~~~~~~D~~aa~r~~~~~~~~f~~pi~~~~G~YP~~~~~~l~~~~~~~~~~~~~lp~ft~~d~~~ik~~~D  338 (985)
                      ++..|++|.++ +++|.+||+|+.+|.++||++|+.  .|+||+.|++.++          +|||.||++|.+.+||+.|
T Consensus       270 ~~~~w~eP~~~-s~~D~~Aa~Ra~~F~~gw~l~p~~--~GdYP~~Mk~~vg----------~rLP~FT~ee~~~lKGS~D  336 (524)
T KOG0626|consen  270 LSARWFEPYDD-SKEDKEAAERALDFFLGWFLEPLT--FGDYPDEMKERVG----------SRLPKFTEEESKLLKGSYD  336 (524)
T ss_pred             EeeeeeccCCC-ChHHHHHHHHHHHhhhhhhhcccc--cCCcHHHHHHHhc----------ccCCCCCHHHHHHhcCchh
Confidence            99999999995 599999999999999999999954  5999999999987          4799999999999999999


Q ss_pred             EEeeccccceEEecCCCCCC---CCCCCcccccc-cccCCCCCCCCCCCCcccCcHHHHHHHHHHHHHcCCCCcEEeecC
Q psy14902        339 FFALNHYTSILIANNNHTSN---APPSTINDRAA-TFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENG  414 (985)
Q Consensus       339 FlGlNyYt~~~v~~~~~~~~---~~~~~~~~~~~-~~~~~~~~~~~~~~w~~~~p~gl~~~l~~~~~~y~~~pi~itEnG  414 (985)
                      |+||||||+.+|+.......   ++...+..... .....+.++.+.+.|+.++|||||++|++++++|+||||||||||
T Consensus       337 FvGiNyYts~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~v~P~Glr~~L~yiK~~Y~np~iyItENG  416 (524)
T KOG0626|consen  337 FVGINYYTSRYVKHLKPPPDPSQPGWSTDSGVDWTLEGNDLIGPKAGSDWLPVYPWGLRKLLNYIKDKYGNPPIYITENG  416 (524)
T ss_pred             hceeehhhhhhhhccCCCCCCCCcccccccceeeeecccccccccccccceeeccHHHHHHHHHHHhhcCCCcEEEEeCC
Confidence            99999999999986433221   11111111111 001145566777889999999999999999999999999999999


Q ss_pred             CCCCC--------CccccccccccccceeEEeeeccccCCCCCCcccchhhHHHHHHHHHHHHhCCCcceEEeeccCCch
Q psy14902        415 FSDDG--------RLDDEGRIDYYAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQ  486 (985)
Q Consensus       415 ~~~~~--------~~~D~~~~~~~g~~~yR~si~WsRi~P~G~~~~~n~~g~~fY~~~i~~l~~~gi~P~vTL~H~d~P~  486 (985)
                      +++.+        .++|..|+.|+                               .++|.+|++                
T Consensus       417 ~~d~~~~~~~~~~~l~D~~Ri~Y~-------------------------------~~~L~~~~k----------------  449 (524)
T KOG0626|consen  417 FDDLDGGTKSLEVALKDTKRIEYL-------------------------------QNHLQAVLK----------------  449 (524)
T ss_pred             CCcccccccchhhhhcchHHHHHH-------------------------------HHHHHHHHH----------------
Confidence            99863        45688888888                               999999999                


Q ss_pred             hhhhhcCCcchhhHHHHHHHHHHHHHHhCCeeEEEeecceeeecccceeeeeeeccccccccchhhhcccceeeecCCC
Q psy14902        487 PLQDFGGWTNAIIADYFETYADFAYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFSS  565 (985)
Q Consensus       487 ~l~~~gGW~n~~~id~f~~ya~~~~~~~gd~VW~Tf~~~~~~~~~~~~~~~~~~~~~~~g~y~~~~~~~~~~~~~~~~~  565 (985)
                      |+.+                                       +++++.|||+|+++||+||-.+++.|||+.++|+++
T Consensus       450 Ai~~---------------------------------------dgvnv~GYf~WSLmDnfEw~~Gy~~RFGlyyVDf~d  489 (524)
T KOG0626|consen  450 AIKE---------------------------------------DGVNVKGYFVWSLLDNFEWLDGYKVRFGLYYVDFKD  489 (524)
T ss_pred             HHHh---------------------------------------cCCceeeEEEeEcccchhhhcCcccccccEEEeCCC
Confidence            9865                                       788999999999999999999999999999888653

>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>KOG0626|consensus Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
1wcg_A464 Aphid Myrosinase Length = 464 1e-119
1wcg_A464 Aphid Myrosinase Length = 464 3e-65
1wcg_A464 Aphid Myrosinase Length = 464 3e-08
3ahz_A487 Crystal Structure Of Beta-Glucosidase From Termite 1e-118
3ahz_A 487 Crystal Structure Of Beta-Glucosidase From Termite 5e-59
3ahz_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
3ai0_A487 Crystal Structure Of Beta-Glucosidase From Termite 1e-118
3ai0_A 487 Crystal Structure Of Beta-Glucosidase From Termite 1e-58
3ai0_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
3vik_A487 Crystal Structure Of Beta-Glucosidase From Termite 1e-118
3vik_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-58
3vik_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
3vij_A487 Crystal Structure Of Beta-Glucosidase From Termite 1e-118
3vij_A 487 Crystal Structure Of Beta-Glucosidase From Termite 2e-58
3vij_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
2e9l_A469 Crystal Structure Of Human Cytosolic Neutral Beta-G 7e-91
2e9l_A 469 Crystal Structure Of Human Cytosolic Neutral Beta-G 2e-49
2jfe_X469 The Crystal Structure Of Human Cytosolic Beta-Gluco 1e-90
2jfe_X 469 The Crystal Structure Of Human Cytosolic Beta-Gluco 2e-49
2zox_A469 Crystal Structure Of The Covalent Intermediate Of H 1e-90
2zox_A 469 Crystal Structure Of The Covalent Intermediate Of H 4e-49
1cbg_A490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 2e-84
1cbg_A 490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 1e-39
3gno_A488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 5e-82
3gno_A 488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 1e-35
2rgl_A481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 5e-81
2rgl_A 481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 3e-38
2rgl_A481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 3e-06
4gxp_A467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 9e-81
4gxp_A 467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 1e-35
4gxp_A467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 5e-04
3f4v_A481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 1e-80
3f4v_A 481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 7e-38
3f4v_A481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 3e-06
3scr_A481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 2e-80
3scr_A 481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 3e-38
3scr_A481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 3e-06
3scv_A481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 2e-80
3scv_A 481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 3e-38
3scv_A481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 3e-06
3scp_A481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 2e-80
3scp_A 481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 3e-38
3scp_A481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 3e-06
3scn_A481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 3e-80
3scn_A 481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 3e-38
3scn_A481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 3e-06
3scw_A481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 3e-80
3scw_A 481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 3e-38
3scw_A481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 3e-06
3ptk_A505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 5e-80
3ptk_A 505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 3e-40
3ptk_A505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 4e-04
1v03_A565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 4e-79
1v03_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 2e-34
1v02_E565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-78
1v02_E 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 7e-33
1v02_A565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 3e-78
1v02_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 4e-33
2dga_A565 Crystal Structure Of Hexameric Beta-Glucosidase In 3e-75
2dga_A 565 Crystal Structure Of Hexameric Beta-Glucosidase In 1e-30
1hxj_A507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 1e-74
1hxj_A 507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 4e-29
3ais_A565 Crystal Structure Of A Mutant Beta-Glucosidase In W 1e-74
3ais_A 565 Crystal Structure Of A Mutant Beta-Glucosidase In W 1e-30
1e1e_A512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 1e-74
1e1e_A 512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 5e-29
3aiu_A564 Crystal Structure Of Beta-Glucosidase In Rye Length 3e-74
3aiu_A 564 Crystal Structure Of Beta-Glucosidase In Rye Length 3e-31
1e4l_A512 Crystal Structure Of The Inactive Mutant Monocot (M 4e-74
1e4l_A 512 Crystal Structure Of The Inactive Mutant Monocot (M 4e-29
1h49_A512 Crystal Structure Of The Inactive Double Mutant Of 1e-73
1h49_A 512 Crystal Structure Of The Inactive Double Mutant Of 1e-28
2e3z_A465 Crystal Structure Of Intracellular Family 1 Beta- G 5e-72
2e3z_A 465 Crystal Structure Of Intracellular Family 1 Beta- G 9e-37
2e3z_A465 Crystal Structure Of Intracellular Family 1 Beta- G 3e-04
4a3y_A540 Crystal Structure Of Raucaffricine Glucosidase From 2e-71
4a3y_A 540 Crystal Structure Of Raucaffricine Glucosidase From 8e-34
4atd_A513 Crystal Structure Of Native Raucaffricine Glucosida 3e-71
4atd_A 513 Crystal Structure Of Native Raucaffricine Glucosida 7e-34
3u57_A513 Structures Of Alkaloid Biosynthetic Glucosidases De 8e-71
3u57_A 513 Structures Of Alkaloid Biosynthetic Glucosidases De 2e-33
3ahx_A453 Crystal Structure Of Beta-Glucosidase A From Bacter 5e-70
3ahx_A453 Crystal Structure Of Beta-Glucosidase A From Bacter 3e-30
1od0_A468 Family 1 B-Glucosidase From Thermotoga Maritima Len 1e-69
1od0_A468 Family 1 B-Glucosidase From Thermotoga Maritima Len 2e-30
3ahy_A473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 1e-68
3ahy_A 473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 5e-35
3ahy_A473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 1e-04
2jf6_A532 Structure Of Inactive Mutant Of Strictosidine Gluco 1e-66
2jf6_A 532 Structure Of Inactive Mutant Of Strictosidine Gluco 1e-33
1qox_A449 Beta-Glucosidase From Bacillus Circulans Sp. Alkalo 2e-66
1qox_A449 Beta-Glucosidase From Bacillus Circulans Sp. Alkalo 6e-29
3ta9_A458 Beta-Glucosidase A From The Halothermophile H. Oren 3e-65
3ta9_A458 Beta-Glucosidase A From The Halothermophile H. Oren 5e-29
3cmj_A465 Crystal Structure Of Engineered Beta-Glucosidase Fr 7e-63
3cmj_A465 Crystal Structure Of Engineered Beta-Glucosidase Fr 6e-25
1myr_A501 Myrosinase From Sinapis Alba Length = 501 1e-61
1myr_A 501 Myrosinase From Sinapis Alba Length = 501 5e-26
4hz6_A444 Crystal Structure Of Bglb Length = 444 2e-61
4hz6_A444 Crystal Structure Of Bglb Length = 444 6e-25
1dwa_M499 Study On Radiation Damage On A Cryocooled Crystal. 2e-58
1dwa_M 499 Study On Radiation Damage On A Cryocooled Crystal. 4e-25
1e6q_M501 Myrosinase From Sinapis Alba With The Bound Transit 2e-58
1e6q_M 501 Myrosinase From Sinapis Alba With The Bound Transit 4e-25
1tr1_A447 Crystal Structure Of E96k Mutated Beta-glucosidase 2e-54
1tr1_A447 Crystal Structure Of E96k Mutated Beta-glucosidase 1e-27
1e4i_A447 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE 2e-54
1e4i_A447 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE 1e-27
1bgg_A448 Glucosidase A From Bacillus Polymyxa Complexed With 3e-54
1bgg_A448 Glucosidase A From Bacillus Polymyxa Complexed With 3e-27
1bga_A447 Beta-Glucosidase A From Bacillus Polymyxa Length = 6e-54
1bga_A447 Beta-Glucosidase A From Bacillus Polymyxa Length = 3e-27
1uyq_A447 Mutated B-Glucosidase A From Paenibacillus Polymyxa 6e-54
1uyq_A447 Mutated B-Glucosidase A From Paenibacillus Polymyxa 1e-27
2o9p_A454 Beta-Glucosidase B From Paenibacillus Polymyxa Leng 1e-48
2o9p_A454 Beta-Glucosidase B From Paenibacillus Polymyxa Leng 3e-24
2jie_A454 Beta-Glucosidase B From Bacillus Polymyxa Complexed 1e-48
2jie_A454 Beta-Glucosidase B From Bacillus Polymyxa Complexed 2e-24
2o9r_A452 Beta-Glucosidase B Complexed With Thiocellobiose Le 2e-48
2o9r_A452 Beta-Glucosidase B Complexed With Thiocellobiose Le 3e-24
1gnx_A479 B-Glucosidase From Streptomyces Sp Length = 479 3e-48
1gnx_A 479 B-Glucosidase From Streptomyces Sp Length = 479 5e-21
4f66_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 4e-46
4f66_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 8e-15
4f66_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 6e-13
4f79_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 1e-45
4f79_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 8e-15
4f79_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 6e-13
3pn8_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 1e-44
3pn8_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 8e-15
3pn8_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 1e-12
1np2_A436 Crystal Structure Of Thermostable Beta-Glycosidase 9e-44
1np2_A 436 Crystal Structure Of Thermostable Beta-Glycosidase 7e-20
3zjk_A431 Crystal Structure Of Ttb-gly F401s Mutant Length = 1e-42
3zjk_A 431 Crystal Structure Of Ttb-gly F401s Mutant Length = 5e-19
1ug6_A431 Structure Of Beta-Glucosidase At Atomic Resolution 3e-42
1ug6_A 431 Structure Of Beta-Glucosidase At Atomic Resolution 5e-19
2xhy_A479 Crystal Structure Of E.Coli Bgla Length = 479 3e-39
2xhy_A479 Crystal Structure Of E.Coli Bgla Length = 479 3e-15
2xhy_A 479 Crystal Structure Of E.Coli Bgla Length = 479 3e-12
4b3k_A479 Family 1 6-phospho-beta-d Glycosidase From Streptoc 6e-35
4b3k_A479 Family 1 6-phospho-beta-d Glycosidase From Streptoc 8e-12
4b3k_A 479 Family 1 6-phospho-beta-d Glycosidase From Streptoc 2e-09
3qom_A481 Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro 1e-34
3qom_A481 Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro 3e-14
3qom_A 481 Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro 1e-13
1pbg_A468 The Three-Dimensional Structure Of 6-Phospho-Beta G 2e-33
1pbg_A 468 The Three-Dimensional Structure Of 6-Phospho-Beta G 1e-13
2pbg_A468 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 3e-33
2pbg_A 468 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 1e-13
4pbg_A468 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 2e-32
4pbg_A 468 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 1e-13
1vff_A423 Beta-Glycosidase From Pyrococcus Horikoshii Length 1e-25
1vff_A423 Beta-Glycosidase From Pyrococcus Horikoshii Length 3e-13
4ha3_A489 Structure Of Beta-Glycosidase From Acidilobus Sacch 1e-13
4ha3_A489 Structure Of Beta-Glycosidase From Acidilobus Sacch 1e-05
3apg_A473 Crystal Structure Of Hyperthermophilic Beta-Glucosi 5e-09
3apg_A473 Crystal Structure Of Hyperthermophilic Beta-Glucosi 1e-05
1uwq_A489 Structure Of Beta-glycosidase From Sulfolobus Solfa 5e-08
1uwq_A489 Structure Of Beta-glycosidase From Sulfolobus Solfa 2e-04
4eam_A489 1.70a Resolution Structure Of Apo Beta-Glycosidase 1e-06
4eam_A489 1.70a Resolution Structure Of Apo Beta-Glycosidase 2e-04
1gow_A489 Beta-Glycosidase From Sulfolobus Solfataricus Lengt 2e-06
1gow_A489 Beta-Glycosidase From Sulfolobus Solfataricus Lengt 2e-04
1uwi_A489 Crystal Structure Of Mutated Beta-Glycosidase From 2e-06
1uwi_A489 Crystal Structure Of Mutated Beta-Glycosidase From 2e-04
1qvb_A481 Crystal Structure Of The Beta-Glycosidase From The 9e-04
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure 
Iteration: 1

 Score =  427 bits (1098), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/395 (52%), Positives = 276/395 (69%), Gaps = 7/395 (1%)
Query: 36  HQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYK 95
           ++FP  F++G STA++Q+EG WNEDGKGENIWD LVHT P+++KD  N D+ACDSYHKYK
Sbjct: 3   YKFPKDFMFGTSTASYQIEGGWNEDGKGENIWDRLVHTSPEVIKDGTNGDIACDSYHKYK 62
Query: 96  EDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNH 155
           EDVA+I+D+  + YRFS+SW+RI P+G  + +  KG+ YY NLINE++  +I P+VT+ H
Sbjct: 63  EDVAIIKDLNLKFYRFSISWARIAPSGVMNSLEPKGIAYYNNLINELIKNDIIPLVTMYH 122
Query: 156 YDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAP 215
           +DLPQ LQ+ GGW NP+++DYF+ +A V F  FGD+V +WIT NEP+ V  GY  K+ AP
Sbjct: 123 WDLPQYLQDLGGWVNPIMSDYFKEYARVLFTYFGDRVKWWITFNEPIAVCKGYSIKAYAP 182
Query: 216 YLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQ 275
            LNL    G YL  H  L AH KAYRLYE+ +K  Q GK+SI++    + P NA S +D 
Sbjct: 183 NLNLK-TTGHYLAGHTQLIAHGKAYRLYEEMFKPTQNGKISISISGVFFMPKNAESDDDI 241
Query: 276 EAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKG 335
           E AER  QF  G F HP+Y   GDYPPI+++ VDQ S +EG   S+LP+FT++EIK LKG
Sbjct: 242 ETAERANQFERGWFGHPVYK--GDYPPIMKKWVDQKSKEEGLPWSKLPKFTKDEIKLLKG 299
Query: 336 SFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSN-SPWLKVVPDGFRA 394
           + DF+ALNHY+S L+      S+  P+   D +   S D  W   N +P++  VP+G R 
Sbjct: 300 TADFYALNHYSSRLVT---FGSDPNPNFNPDASYVTSVDEAWLKPNETPYIIPVPEGLRK 356
Query: 395 LLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDY 429
           LL W+K EY NP + ITENG+ DDG+LDD  +I Y
Sbjct: 357 LLIWLKNEYGNPQLLITENGYGDDGQLDDFEKISY 391
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 Back     alignment and structure
>pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 Back     alignment and structure
>pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 Back     alignment and structure
>pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|1TR1|A Chain A, Crystal Structure Of E96k Mutated Beta-glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 Back     alignment and structure
>pdb|1TR1|A Chain A, Crystal Structure Of E96k Mutated Beta-glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 Back     alignment and structure
>pdb|1E4I|A Chain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1E4I|A Chain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1BGG|A Chain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 Back     alignment and structure
>pdb|1BGG|A Chain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 Back     alignment and structure
>pdb|1BGA|A Chain A, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1BGA|A Chain A, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 Back     alignment and structure
>pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 Back     alignment and structure
>pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 Back     alignment and structure
>pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 Back     alignment and structure
>pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 Back     alignment and structure
>pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 Back     alignment and structure
>pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 Back     alignment and structure
>pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 Back     alignment and structure
>pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 Back     alignment and structure
>pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 Back     alignment and structure
>pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 Back     alignment and structure
>pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 Back     alignment and structure
>pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 Back     alignment and structure
>pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 Back     alignment and structure
>pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 Back     alignment and structure
>pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 Back     alignment and structure
>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 Back     alignment and structure
>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 Back     alignment and structure
>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 Back     alignment and structure
>pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 Back     alignment and structure
>pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 Back     alignment and structure
>pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 Back     alignment and structure
>pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 Back     alignment and structure
>pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 Back     alignment and structure
>pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 Back     alignment and structure
>pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 Back     alignment and structure
>pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 Back     alignment and structure
>pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 Back     alignment and structure
>pdb|1VFF|A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii Length = 423 Back     alignment and structure
>pdb|1VFF|A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii Length = 423 Back     alignment and structure
>pdb|4HA3|A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris Length = 489 Back     alignment and structure
>pdb|4HA3|A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris Length = 489 Back     alignment and structure
>pdb|3APG|A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus Length = 473 Back     alignment and structure
>pdb|3APG|A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus Length = 473 Back     alignment and structure
>pdb|1UWQ|A Chain A, Structure Of Beta-glycosidase From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|1UWQ|A Chain A, Structure Of Beta-glycosidase From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|4EAM|A Chain A, 1.70a Resolution Structure Of Apo Beta-Glycosidase (W33g) From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|4EAM|A Chain A, 1.70a Resolution Structure Of Apo Beta-Glycosidase (W33g) From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|1GOW|A Chain A, Beta-Glycosidase From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|1GOW|A Chain A, Beta-Glycosidase From Sulfolobus Solfataricus Length = 489 Back     alignment and structure
>pdb|1UWI|A Chain A, Crystal Structure Of Mutated Beta-Glycosidase From Sulfolobus Solfataricus, Working At Moderate Temperature Length = 489 Back     alignment and structure
>pdb|1UWI|A Chain A, Crystal Structure Of Mutated Beta-Glycosidase From Sulfolobus Solfataricus, Working At Moderate Temperature Length = 489 Back     alignment and structure
>pdb|1QVB|A Chain A, Crystal Structure Of The Beta-Glycosidase From The Hyperthermophile Thermosphaera Aggregans Length = 481 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query985
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 0.0
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-101
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 5e-46
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 8e-36
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-19
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-13
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 0.0
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 1e-103
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 4e-46
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 7e-35
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 1e-19
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 1e-13
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 0.0
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 1e-101
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 4e-46
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 3e-33
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 1e-19
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 3e-13
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 0.0
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 5e-92
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 3e-43
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 1e-30
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 8e-19
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 3e-12
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 0.0
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 1e-91
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 3e-43
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 5e-31
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 3e-18
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 3e-12
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 0.0
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 5e-91
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 3e-43
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 1e-30
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 2e-18
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 4e-12
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 0.0
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 6e-90
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 1e-43
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 8e-31
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 3e-18
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 4e-12
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 0.0
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 2e-91
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 5e-43
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 5e-29
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 3e-18
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 3e-12
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 0.0
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 4e-90
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 9e-43
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 4e-29
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 4e-18
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 3e-12
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 0.0
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 2e-89
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 9e-44
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 6e-30
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 3e-19
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 2e-13
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 0.0
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 2e-89
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-41
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-28
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 4e-18
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 4e-12
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 0.0
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 4e-88
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 3e-42
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 2e-29
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 1e-18
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 2e-12
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 0.0
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 2e-88
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 4e-41
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 2e-28
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 4e-19
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 2e-13
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 0.0
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 3e-88
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 8e-43
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 4e-28
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 1e-19
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 1e-13
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-180
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 5e-86
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 4e-38
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 6e-30
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 5e-19
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 8e-13
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 1e-169
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 2e-76
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 1e-42
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 2e-24
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 1e-17
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 2e-11
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 1e-168
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 3e-75
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 1e-42
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 3e-25
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 1e-17
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 2e-11
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 1e-166
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 7e-74
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 4e-42
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 5e-23
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 5e-17
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 6e-11
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 1e-165
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 9e-73
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 4e-42
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 2e-24
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 3e-17
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 4e-11
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 1e-163
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 7e-71
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 2e-41
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 1e-22
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 4e-17
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 6e-11
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 1e-162
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 3e-73
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 3e-42
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 7e-22
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 2e-17
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 5e-11
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 1e-162
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 2e-72
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 3e-41
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 8e-22
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 3e-17
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 4e-11
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 1e-162
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 5e-70
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 1e-41
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 7e-23
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 5e-17
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 8e-11
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 1e-153
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 3e-65
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 9e-42
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 1e-20
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 5e-17
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 1e-10
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 1e-150
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-65
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-39
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 3e-19
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 4e-16
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-10
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 1e-141
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 6e-54
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 1e-33
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 4e-20
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 5e-17
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 6e-11
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 1e-139
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 4e-57
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 3e-33
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 1e-19
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 1e-16
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 1e-10
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 1e-122
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 6e-55
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 1e-37
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 8e-16
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 1e-15
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 6e-10
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 1e-122
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 1e-47
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 1e-32
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 3e-19
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 2e-16
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 2e-10
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 3e-95
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 3e-33
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 1e-32
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 2e-05
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 6e-95
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 3e-33
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 9e-32
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 1e-05
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 2e-94
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 3e-33
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 3e-32
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 4e-04
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 6e-04
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 8e-04
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
 Score =  609 bits (1573), Expect = 0.0
 Identities = 203/401 (50%), Positives = 270/401 (67%), Gaps = 5/401 (1%)

Query: 31  TQMNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDS 90
           +    + FP  F  G +TA++Q+EGAW+E+GKG NIWD L H  PD V D    D+A DS
Sbjct: 5   SSDTVYTFPDEFKLGAATASYQIEGAWDENGKGPNIWDTLTHEHPDYVVDGATGDIADDS 64

Query: 91  YHKYKEDVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPM 150
           YH YKEDV +++++G QVYRFS+SW+R+LP G  + +N+ G+ YY NLINE+L+  I+PM
Sbjct: 65  YHLYKEDVKILKELGAQVYRFSISWARVLPEGHDNIVNQDGIDYYNNLINELLANGIEPM 124

Query: 151 VTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVM-GGYG 209
           VT+ H+DLPQ LQ+ GGW N V+A Y E++A V FK FGD+V  W+T NEPL  M G   
Sbjct: 125 VTMYHWDLPQALQDLGGWPNLVLAKYSENYARVLFKNFGDRVKLWLTFNEPLTFMDGYAS 184

Query: 210 YKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNA 269
               AP +N  G+ GDYL AH ++ AHA+ Y LY++++++ Q GKV I+L+     P   
Sbjct: 185 EIGMAPSINTPGI-GDYLAAHTVIHAHARIYHLYDQEFRAEQGGKVGISLNINWCEPAT- 242

Query: 270 TSKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEE 329
            S ED+ + E   QF LGL+AHPI++E GDYP +++  V +NSA EG   SRLP+FT EE
Sbjct: 243 NSAEDRASCENYQQFNLGLYAHPIFTEEGDYPAVLKDRVSRNSADEGYTDSRLPQFTAEE 302

Query: 330 IKALKGSFDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVP 389
           ++ ++G+ DF  +N YT++L  +        PS   D     +QD  WP S S WLKVVP
Sbjct: 303 VEYIRGTHDFLGINFYTALLGKSG--VEGYEPSRYRDSGVILTQDAAWPISASSWLKVVP 360

Query: 390 DGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYY 430
            GFR  LNWIK EYNNPPVFITENGFSD G L+D GR+ YY
Sbjct: 361 WGFRKELNWIKNEYNNPPVFITENGFSDYGGLNDTGRVHYY 401
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query985
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 100.0
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 100.0
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 100.0
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 100.0
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 100.0
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 100.0
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 100.0
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 100.0
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 100.0
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 100.0
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 100.0
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 100.0
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 100.0
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 100.0
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 100.0
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 100.0
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 100.0
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 100.0
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 100.0
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 100.0
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 100.0
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 100.0
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 100.0
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 100.0
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 100.0
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 100.0
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 100.0
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 100.0
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 100.0
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 100.0
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 100.0
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 100.0
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 100.0
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 100.0
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 100.0
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 100.0
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 100.0
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 100.0
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 100.0
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 100.0
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 100.0
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 100.0
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 100.0
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 100.0
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 100.0
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 100.0
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 100.0
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 100.0
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 100.0
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 100.0
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 100.0
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 100.0
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 100.0
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 100.0
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 100.0
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 100.0
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 100.0
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 100.0
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 100.0
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 100.0
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 100.0
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 100.0
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 100.0
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 100.0
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.87
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.77
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.69
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.67
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.64
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.57
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.56
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.51
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.5
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.49
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.49
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.43
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.39
3tty_A675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.39
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.38
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.38
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.37
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.37
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.35
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.34
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.32
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.29
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 99.27
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.24
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.23
1kwg_A645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.18
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.16
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.14
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.13
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.11
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 99.05
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 99.02
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.01
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 98.99
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 98.97
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.93
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 98.93
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 98.91
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 98.88
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 98.87
3tty_A675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 98.82
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 98.8
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 98.78
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 98.77
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 98.76
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 98.74
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 98.73
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 98.72
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 98.7
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 98.69
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 98.66
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 98.64
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 98.61
4ekj_A500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 98.61
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 98.6
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 98.59
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 98.57
3d3a_A612 Beta-galactosidase; protein structure initiative I 98.53
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 98.5
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 98.5
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 98.5
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 98.49
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 98.47
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 98.41
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 98.4
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 98.4
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 98.38
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 98.38
1kwg_A645 Beta-galactosidase; TIM barrel, glycoside hydrolas 98.35
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 98.33
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 98.3
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 98.21
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 98.16
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 98.06
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 98.06
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 97.97
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 97.87
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 97.87
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 97.86
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 97.86
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 97.85
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 97.83
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 97.81
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 97.78
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 97.76
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 97.74
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 97.74
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 97.7
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 97.69
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 97.66
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 97.65
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 97.6
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 97.58
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 97.56
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 97.47
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 97.41
3d3a_A612 Beta-galactosidase; protein structure initiative I 97.38
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 97.31
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 97.17
3u7v_A552 Beta-galactosidase; structural genomics, PSI-biolo 97.13
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 97.11
3fn9_A692 Putative beta-galactosidase; structural genomics, 97.08
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 97.06
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 97.05
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 97.05
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 97.04
3cmg_A667 Putative beta-galactosidase; structural genomics, 97.04
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 96.91
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 96.82
3thd_A654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 96.81
4e8d_A595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 96.69
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 96.66
1tg7_A971 Beta-galactosidase; TIM barrel domain, glycoside h 96.56
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 96.45
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 96.35
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 96.27
3og2_A1003 Beta-galactosidase; TIM barrel domain, glycoside h 96.11
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 95.99
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 95.88
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 95.67
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 95.58
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 95.53
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 95.5
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 95.47
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 95.46
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 95.46
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 95.4
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 95.3
1qw9_A502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 95.24
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 95.17
2c7f_A513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 95.17
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 95.13
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 95.07
2w61_A555 GAS2P, glycolipid-anchored surface protein 2; glyc 95.03
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 94.98
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 94.68
2yih_A524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 94.47
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 94.47
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 94.28
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 94.03
2y2w_A574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 93.88
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 93.86
3cmg_A667 Putative beta-galactosidase; structural genomics, 93.72
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 93.69
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 93.16
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 93.11
3fn9_A692 Putative beta-galactosidase; structural genomics, 92.87
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 92.59
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 92.58
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 92.58
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 92.54
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 91.68
1yq2_A1024 Beta-galactosidase; glycosyl hydrolase family 2, T 91.39
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 91.29
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 90.95
1fa2_A498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 90.03
1wdp_A495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 89.78
2xfr_A535 Beta-amylase; hydrolase, carbohydrate metabolism, 89.52
4aw7_A591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 88.22
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 88.19
2je8_A848 Beta-mannosidase; glycoside hydrolase, hydrolase; 86.94
3bga_A1010 Beta-galactosidase; NYSGXRC, protein structure ini 86.45
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 85.89
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 85.44
1jz7_A1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 84.77
2e4t_A519 Endoglucanase, xyloglucanase; TIM barrel, TIM-like 82.19
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 82.01
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 81.31
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-113  Score=998.69  Aligned_cols=441  Identities=51%  Similarity=0.964  Sum_probs=402.9

Q ss_pred             cccCCCCCCceehhhhchhhccCCCCCCCCcCceeeeccccCCCcccCCCCCCcccccccchHHHHHHHHHcCCCeeEee
Q psy14902         33 MNKHQFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFS  112 (985)
Q Consensus        33 ~~~~~fp~~F~wG~atsa~Q~Eg~~~~~gkg~s~wd~~~~~~~~~~~~~~~~~~a~d~Y~ry~eDi~L~k~lG~~~yRfS  112 (985)
                      ..+.+||++|+||+|||||||||||++||||+||||+|+|.+|+++.+++++++||||||||+|||+|||+||+++||||
T Consensus         7 ~~~~~FP~~FlwG~AtaA~QiEGa~~~dGkg~SiwD~~~~~~~~~i~~~~~gd~A~D~Yhry~EDi~Lm~elG~~~yRfS   86 (487)
T 3vii_A            7 DTVYTFPDEFKLGAATASYQIEGAWDENGKGPNIWDTLTHEHPDYVVDGATGDIADDSYHLYKEDVKILKELGAQVYRFS   86 (487)
T ss_dssp             -CTTBCCTTCEEEEECCHHHHCCCTTGGGCCCBHHHHHHHHCGGGSGGGCCSSSTTCHHHHHHHHHHHHHHHTCSEEEEE
T ss_pred             chhccCCCCCEEEEeccHHhcCCCcCCCCCcccHHHhHhhcCCccccCCCCCCcccChHHHHHHHHHHHHHcCCCEEEee
Confidence            34567999999999999999999999999999999999998677888889999999999999999999999999999999


Q ss_pred             ccccceecCCCCCCCCHHHHHHHHHHHHHHHhCCCceeEEEecCCCcHhhHhhCCCCChhhHHHHHHHHHHHHHHhCCCC
Q psy14902        113 LSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKV  192 (985)
Q Consensus       113 IsWsRI~P~G~~~~~n~~gi~~Y~~li~~L~~~GIeP~VTL~H~dlP~~l~~~GGW~n~~~v~~F~~Ya~~~~~~fgd~V  192 (985)
                      ||||||+|+|+.|++|++||+||++|||+|+++|||||||||||||||||+++|||+||++|++|++||++||++|||||
T Consensus        87 IsWsRI~P~G~~g~~N~~Gl~fY~~lId~Ll~~GIeP~VTL~H~DlP~~L~~~GGW~nr~~v~~F~~YA~~~f~~fgdrV  166 (487)
T 3vii_A           87 ISWARVLPEGHDNIVNQDGIDYYNNLINELLANGIEPMVTMYHWDLPQALQDLGGWPNLVLAKYSENYARVLFKNFGDRV  166 (487)
T ss_dssp             CCHHHHSTTSSTTCCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHTTTSTTSTHHHHHHHHHHHHHHHHHTTTC
T ss_pred             CCHHHcCcCCCCCCcCHHHHHHHHHHHHHHHHCCCEEEEEEecCCCcHHHHHcCCCCCHHHHHHHHHHHHHHHHHhcCCC
Confidence            99999999997689999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEeccCcccc-cccccccc-CCCCCCCCCcchhHHHHHHHHHHHHHHHHHHHHhhhcCCCCcEEEeecCCccccCCCC
Q psy14902        193 PYWITINEPLDV-MGGYGYKS-GAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNAT  270 (985)
Q Consensus       193 ~~W~T~NEP~~~-~~gy~~G~-~~Pg~~~~~~~~~~~~~~~~l~Aha~a~~~~~~~~~~~~~gkVGi~~~~~~~~P~~~~  270 (985)
                      |+|+||||| ++ ..||..|. +|||..+.. +..++|+||+++|||+|++++|+.++..|+++|||+++..|++|.+ +
T Consensus       167 k~W~T~NEp-~~~~~gy~~g~~~~Pg~~~~~-~~~~~~~h~~llAha~Av~~~r~~~~~~~~~~IGi~l~~~~~~P~~-~  243 (487)
T 3vii_A          167 KLWLTFNEP-LTFMDGYASEIGMAPSINTPG-IGDYLAAHTVIHAHARIYHLYDQEFRAEQGGKVGISLNINWCEPAT-N  243 (487)
T ss_dssp             CEEEEEECH-HHHGGGGBCTTSSTTCCBCTT-THHHHHHHHHHHHHHHHHHHHHHHTHHHHCCEEEEEEECCEEEESS-S
T ss_pred             CeEEEecCc-hhhhcccccccccCCcccccH-HHHHHHHHHHHHHHHHHHHHHHHhcccCCCCeEEEEecCCccCCCC-c
Confidence            999999999 88 99999999 999987654 4689999999999999999999977666899999999999999998 7


Q ss_pred             CHHHHHHHHHHHHhhcccccccccccCCCCcHHHHHHHhhhccccccccCCCCCCCHHHHHhhcCCccEEeeccccceEE
Q psy14902        271 SKEDQEAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILI  350 (985)
Q Consensus       271 ~~~D~~aa~r~~~~~~~~f~~pi~~~~G~YP~~~~~~l~~~~~~~~~~~~~lp~ft~~d~~~ik~~~DFlGlNyYt~~~v  350 (985)
                      +|+|++||++++++.++||++|++.++|+||+.|++.++++++++|++.+++|.||++|++.|++++||||||||++.+|
T Consensus       244 ~p~D~~Aa~~~~~~~~~~f~dpi~~~~G~YP~~~~~~~~~~~~~~g~~~~~~p~~~~~d~~~i~~~~DFlGiNyY~~~~v  323 (487)
T 3vii_A          244 SAEDRASCENYQQFNLGLYAHPIFTEEGDYPAVLKDRVSRNSADEGYTDSRLPQFTAEEVEYIRGTHDFLGINFYTALLG  323 (487)
T ss_dssp             CHHHHHHHHHHHHHHTHHHHHHHHSSSCSSCHHHHHHHHHHHHHTTCSSCSSCCCCHHHHHHHTTCCSCEEEECCCEEEE
T ss_pred             CHHHHHHHHHHHHHhhhhhhhhHhccCCCCCHHHHHHHHhhccccccccccCCCCCHHHHHHhcCCCcEEEEecccceee
Confidence            99999999999999999999999933499999999999999988999999999999999999999999999999999999


Q ss_pred             ecCCCCCCCCCCCcccccccccCCCCCCCCCCCCcccCcHHHHHHHHHHHHHcCCCCcEEeecCCCCCCCcccccccccc
Q psy14902        351 ANNNHTSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYY  430 (985)
Q Consensus       351 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~p~gl~~~l~~~~~~y~~~pi~itEnG~~~~~~~~D~~~~~~~  430 (985)
                      +.......+++.  .+.......+|.++.+++||++|+|+|||.+|+++++||+++||||||||+++.+.++|..|+.||
T Consensus       324 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~t~~gW~~i~P~Gl~~~L~~~~~rY~~~Pi~ITENG~~~~g~i~D~~Ri~Yl  401 (487)
T 3vii_A          324 KSGVEGYEPSRY--RDSGVILTQDAAWPISASSWLKVVPWGFRKELNWIKNEYNNPPVFITENGFSDYGGLNDTGRVHYY  401 (487)
T ss_dssp             ESSCCSCSSCHH--HHHTCEEECCTTSCCCSSTTCCCCHHHHHHHHHHHHHHHTSCCEEEEECCCCBSSCSCCHHHHHHH
T ss_pred             ccCCCCCCCCcc--cccccccccCCCCCCCcCcccccCHHHHHHHHHHHHHHcCCCCEEEecCCCCCCCCcCcHHHHHHH
Confidence            864321111100  011111235789999999999999999999999999999889999999999876688999999999


Q ss_pred             ccceeEEeeeccccCCCCCCcccchhhHHHHHHHHHHHHhCCCcceEEeeccCCchhhhhhcCCcchhhHHHHHHHHHHH
Q psy14902        431 AFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADFA  510 (985)
Q Consensus       431 g~~~yR~si~WsRi~P~G~~~~~n~~g~~fY~~~i~~l~~~gi~P~vTL~H~d~P~~l~~~gGW~n~~~id~f~~ya~~~  510 (985)
                                                     +++|++|++                |+.+                    
T Consensus       402 -------------------------------~~hl~~~~~----------------Ai~~--------------------  414 (487)
T 3vii_A          402 -------------------------------TEHLKEMLK----------------AIHE--------------------  414 (487)
T ss_dssp             -------------------------------HHHHHHHHH----------------HHHT--------------------
T ss_pred             -------------------------------HHHHHHHHH----------------HHHH--------------------
Confidence                                           999999999                9932                    


Q ss_pred             HHHhCCeeEEEeecceeeecccceeeeeeeccccccccchhhhcccceeeecCC
Q psy14902        511 YKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFS  564 (985)
Q Consensus       511 ~~~~gd~VW~Tf~~~~~~~~~~~~~~~~~~~~~~~g~y~~~~~~~~~~~~~~~~  564 (985)
                                         +|++++||++|+++||.+|..++.+|||+.++|+.
T Consensus       415 -------------------dGv~v~GY~~WSl~DnfeW~~Gy~~RfGlvyVD~~  449 (487)
T 3vii_A          415 -------------------DGVNVIGYTAWSLMDNFEWLRGYSEKFGIYAVDFE  449 (487)
T ss_dssp             -------------------TCCCEEEEEEECSBCCCCGGGTTSSBCCSEEECTT
T ss_pred             -------------------cCCeEEEEEEeeccccchhhcccccccCeEEEcCC
Confidence                               79999999999999999999999999999988864
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>2e4t_A Endoglucanase, xyloglucanase; TIM barrel, TIM-like barrel, composite domain of glycosyl HY families 5, 30, 39 and 51, hydrolase; 0.96A {Clostridium thermocellum} PDB: 2e0p_A 2eo7_A* 2ej1_A* 2eex_A* 2eqd_A* Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 985
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 1e-116
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 2e-50
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 2e-23
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 2e-20
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 1e-16
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 2e-10
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-107
d1cbga_ 490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 3e-41
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-20
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 2e-17
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 9e-15
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 3e-09
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-103
d1v02a_ 484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 7e-41
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 2e-19
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 6e-15
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-14
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 3e-09
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 4e-96
d1e4mm_ 499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 3e-39
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 6e-20
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 7e-16
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 1e-14
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 1e-10
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 2e-94
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 2e-40
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 1e-21
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 2e-14
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 5e-11
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 3e-93
d1gnxa_ 464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 3e-34
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 8e-22
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 3e-12
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 2e-09
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 6e-92
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 4e-33
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 1e-21
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 7e-15
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 1e-10
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 2e-09
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 2e-87
d1pbga_ 468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 2e-34
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 2e-18
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 2e-09
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 3e-85
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 6e-36
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 9e-19
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 6e-15
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 2e-09
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 7e-06
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 4e-78
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 4e-42
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 4e-24
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 2e-14
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 6e-78
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 8e-36
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 1e-19
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 2e-14
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 1e-12
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 2e-76
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 1e-36
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 9e-20
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 2e-14
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 1e-11
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 1e-58
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 6e-35
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 1e-15
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 2e-14
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 2e-05
d1kwga2393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 1e-10
d1kwga2393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 5e-06
d1kwga2 393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 0.004
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 2e-07
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 2e-04
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 2e-04
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 1e-06
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 2e-05
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 3e-06
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 3e-05
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 4e-04
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 1e-05
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 9e-05
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 3e-04
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 0.002
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Thioglucosidase
species: Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]

 Score =  362 bits (929), Expect = e-116
 Identities = 207/395 (52%), Positives = 275/395 (69%), Gaps = 7/395 (1%)

Query: 37  QFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKE 96
           +FP  F++G STA++Q+EG WNEDGKGENIWD LVHT P+++KD  N D+ACDSYHKYKE
Sbjct: 2   KFPKDFMFGTSTASYQIEGGWNEDGKGENIWDRLVHTSPEVIKDGTNGDIACDSYHKYKE 61

Query: 97  DVALIRDIGFQVYRFSLSWSRILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHY 156
           DVA+I+D+  + YRFS+SW+RI P+G  + +  KG+ YY NLINE++  +I P+VT+ H+
Sbjct: 62  DVAIIKDLNLKFYRFSISWARIAPSGVMNSLEPKGIAYYNNLINELIKNDIIPLVTMYHW 121

Query: 157 DLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWITINEPLDVMGGYGYKSGAPY 216
           DLPQ LQ+ GGW NP+++DYF+ +A V F  FGD+V +WIT NEP+ V  GY  K+ AP 
Sbjct: 122 DLPQYLQDLGGWVNPIMSDYFKEYARVLFTYFGDRVKWWITFNEPIAVCKGYSIKAYAPN 181

Query: 217 LNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQE 276
           LNL    G YL  H  L AH KAYRLYE+ +K  Q GK+SI++    + P NA S +D E
Sbjct: 182 LNLKT-TGHYLAGHTQLIAHGKAYRLYEEMFKPTQNGKISISISGVFFMPKNAESDDDIE 240

Query: 277 AAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGS 336
            AER  QF  G F HP+Y   GDYPPI+++ VDQ S +EG   S+LP+FT++EIK LKG+
Sbjct: 241 TAERANQFERGWFGHPVYK--GDYPPIMKKWVDQKSKEEGLPWSKLPKFTKDEIKLLKGT 298

Query: 337 FDFFALNHYTSILIANNNHTSNAPPSTINDRAATFSQDPNWPSSN-SPWLKVVPDGFRAL 395
            DF+ALNHY+S L+      S+  P+   D +   S D  W   N +P++  VP+G R L
Sbjct: 299 ADFYALNHYSSRLVT---FGSDPNPNFNPDASYVTSVDEAWLKPNETPYIIPVPEGLRKL 355

Query: 396 LNWIKKEYNNPPVFITENGFSDDGRLDDEGRIDYY 430
           L W+K EY NP + ITENG+ DDG+LDD  +I Y 
Sbjct: 356 LIWLKNEYGNPQLLITENGYGDDGQLDDFEKISYL 390
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query985
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 100.0
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 100.0
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 100.0
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 100.0
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 100.0
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 100.0
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.91
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.67
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.59
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.38
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.38
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.22
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 99.1
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.07
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 98.98
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.91
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 98.87
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.85
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 98.84
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 98.8
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.68
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 98.65
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 98.62
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 98.6
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.49
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 98.48
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 98.43
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 98.41
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 98.36
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.26
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 98.23
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 98.2
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 98.14
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 98.12
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.04
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 98.02
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 97.98
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 97.96
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 97.86
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 97.85
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 97.69
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 97.69
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 97.66
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 97.57
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 97.44
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 97.39
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 97.34
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 97.3
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 97.29
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 97.21
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 97.16
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 97.15
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 97.0
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 96.95
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 96.87
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 96.47
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 96.16
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 96.08
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 95.67
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 95.66
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 95.47
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 95.45
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 95.22
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 95.11
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 94.56
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 94.26
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 94.19
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 93.99
d1vema2 417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 93.87
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 93.55
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 93.08
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 92.8
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 91.43
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 91.04
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 89.7
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 89.34
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 87.32
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 86.41
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 85.83
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 85.16
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 84.45
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 84.11
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 83.27
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 82.68
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 81.77
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 80.4
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Beta-glucosidase A
species: Bacillus circulans, subsp. alkalophilus [TaxId: 1397]

Probab=100.00  E-value=8.9e-104  Score=921.13  Aligned_cols=415  Identities=38%  Similarity=0.724  Sum_probs=383.8

Q ss_pred             CCCCCceehhhhchhhccCCCCCCCCcCceeeeccccCCCcccCCCCCCcccccccchHHHHHHHHHcCCCeeEeecccc
Q psy14902         37 QFPPGFLWGCSTAAFQVEGAWNEDGKGENIWDHLVHTQPDLVKDRQNADVACDSYHKYKEDVALIRDIGFQVYRFSLSWS  116 (985)
Q Consensus        37 ~fp~~F~wG~atsa~Q~Eg~~~~~gkg~s~wd~~~~~~~~~~~~~~~~~~a~d~Y~ry~eDi~L~k~lG~~~yRfSIsWs  116 (985)
                      .||+||+||+|||||||||||+++|||+|+||.|+|. |+++.+++++++||||||||+|||+|||+||+|+||||||||
T Consensus         4 ~FP~~F~wG~atsa~Q~EG~~~~~g~g~s~wd~~~~~-~~~~~~~~~~~~a~d~y~~y~eDi~l~~~lG~~~yRfSi~Ws   82 (449)
T d1qoxa_           4 MFPSDFKWGVATAAYQIEGAYNEDGRGMSIWDTFAHT-PGKVKNGDNGNVACDSYHRVEEDVQLLKDLGVKVYRFSISWP   82 (449)
T ss_dssp             ECCTTCEEEEECCHHHHCCCTTSTTCCCBHHHHHHHS-TTTSGGGCCTTTTTCTTSCHHHHHHHHHHHTCSEEEEECCHH
T ss_pred             CCCCCCeeeeechHHHhCcCcCCCCCccchhhhhhcC-CCcccCCCCCCcccchhhhhHHHHHHHHHcCCCEEEccCCHH
Confidence            4999999999999999999999999999999999997 888899999999999999999999999999999999999999


Q ss_pred             ceecCCCCCCCCHHHHHHHHHHHHHHHhCCCceeEEEecCCCcHhhHhhCCCCChhhHHHHHHHHHHHHHHhCCCCCEEE
Q psy14902        117 RILPTGDTDRINEKGVQYYRNLINEVLSKNIQPMVTLNHYDLPQPLQEFGGWANPVVADYFESFADVAFKTFGDKVPYWI  196 (985)
Q Consensus       117 RI~P~G~~~~~n~~gi~~Y~~li~~L~~~GIeP~VTL~H~dlP~~l~~~GGW~n~~~v~~F~~Ya~~~~~~fgd~V~~W~  196 (985)
                      ||+|+|+ |.+|++||+||++||++|+++||||||||||||+|+||+++|||+|++++++|++||++||++|||+||+|+
T Consensus        83 Ri~P~g~-g~~n~~~~~~Y~~~i~~l~~~gi~P~vTL~H~d~P~~l~~~gGw~~~~~~~~F~~Ya~~v~~~fgd~V~~W~  161 (449)
T d1qoxa_          83 RVLPQGT-GEVNRAGLDYYHRLVDELLANGIEPFCTLYHWDLPQALQDQGGWGSRITIDAFAEYAELMFKELGGKIKQWI  161 (449)
T ss_dssp             HHSTTSS-SSCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHTTTGGGSTHHHHHHHHHHHHHHHHHTTTCCEEE
T ss_pred             HcccCCC-CCcCHHHHHHHHHHHHHHHhcCCeEEEEEecccccchhccccCcCCHHHHHHHHHHHHHHHHHhcccccceE
Confidence            9999985 789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCcccc-ccccccccCCCCCCCCCcchhHHHHHHHHHHHHHHHHHHHHhhhcCCCCcEEEeecCCccccCCCCCHHHH
Q psy14902        197 TINEPLDV-MGGYGYKSGAPYLNLSGLGGDYLVAHNLLRAHAKAYRLYEKKYKSLQKGKVSITLDSCNYYPHNATSKEDQ  275 (985)
Q Consensus       197 T~NEP~~~-~~gy~~G~~~Pg~~~~~~~~~~~~~~~~l~Aha~a~~~~~~~~~~~~~gkVGi~~~~~~~~P~~~~~~~D~  275 (985)
                      |||||+++ ..||+.|.+|||..+..  ..++|+||+++||++|++++|+   ..++++||+++++.+++|.+ ++++|+
T Consensus       162 T~NEP~~~~~~gy~~g~~~Pg~~~~~--~~~~~~~~~~~Aha~a~~~~~~---~~~~~~vgi~~~~~~~~p~~-~~~~d~  235 (449)
T d1qoxa_         162 TFNEPWCMAFLSNYLGVHAPGNKDLQ--LAIDVSHHLLVAHGRAVTLFRE---LGISGEIGIAPNTSWAVPYR-RTKEDM  235 (449)
T ss_dssp             EEECHHHHHHHHHTSCSSTTCCCCHH--HHHHHHHHHHHHHHHHHHHHHH---TTCCSEEEEECCCCEEEESS-SCHHHH
T ss_pred             EecCcceeccccccccccCcccccHH--HHHHHHHHHHHHHHHHHHHHHh---hCCCceeeeeccccccccCC-hHHHHH
Confidence            99999999 99999999999988765  7899999999999999999998   77899999999999999998 789999


Q ss_pred             HHHHHHHHhhcccccccccccCCCCcHHHHHHHhhhccccccccCCCCCCCHHHHHhhcCCccEEeeccccceEEecCCC
Q psy14902        276 EAAERVFQFTLGLFAHPIYSEAGDYPPIVRQIVDQNSAKEGRARSRLPRFTEEEIKALKGSFDFFALNHYTSILIANNNH  355 (985)
Q Consensus       276 ~aa~r~~~~~~~~f~~pi~~~~G~YP~~~~~~l~~~~~~~~~~~~~lp~ft~~d~~~ik~~~DFlGlNyYt~~~v~~~~~  355 (985)
                      +||++.+++.++||++|++.  |+||+.|++.++..+        .+|.|+++|++.+++++||||||||++.+|+....
T Consensus       236 ~Aa~~~~~~~~~~~~dp~~~--G~yp~~~~~~~~~~~--------~~p~~~~~d~~~i~~~~DFlGiNyYt~~~v~~~~~  305 (449)
T d1qoxa_         236 EACLRVNGWSGDWYLDPIYF--GEYPKFMLDWYENLG--------YKPPIVDGDMELIHQPIDFIGINYYTSSMNRYNPG  305 (449)
T ss_dssp             HHHHHHHHTTTHHHHHHHHT--SSCCHHHHHHHHHHT--------CCCCCCTTHHHHHCCCCSEEEEECSCEEEEEECSS
T ss_pred             HHHHHHHHhhcccccCceec--CCCcHHHHHHHHhcc--------ccccCCHHHHHHhcCCcccceecccccceeecCCc
Confidence            99999999999999999995  999999999998654        58999999999999999999999999999986422


Q ss_pred             CCCCCCCCcccccccccCCCCCCCCCCCCcccCcHHHHHHHHHHHHHcCCCCcEEeecCCCCCC------Cccccccccc
Q psy14902        356 TSNAPPSTINDRAATFSQDPNWPSSNSPWLKVVPDGFRALLNWIKKEYNNPPVFITENGFSDDG------RLDDEGRIDY  429 (985)
Q Consensus       356 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~p~gl~~~l~~~~~~y~~~pi~itEnG~~~~~------~~~D~~~~~~  429 (985)
                      ......   .    ....++..+.|++|| +++|+||+.+|++++++|++|||+|||||+++.+      .++|..|++|
T Consensus       306 ~~~~~~---~----~~~~~~~~~~td~gw-ei~P~Gl~~~L~~i~~~y~~p~i~ITENG~a~~d~~~~~~~i~D~~Ri~y  377 (449)
T d1qoxa_         306 EAGGML---S----SEAISMGAPKTDIGW-EIYAEGLYDLLRYTADKYGNPTLYITENGACYNDGLSLDGRIHDQRRIDY  377 (449)
T ss_dssp             GGGTTT---T----EEECCCCCCBCTTSC-BCCTHHHHHHHHHHHHHTTSCCEEEEECCCCCCCCCCTTSSCCCHHHHHH
T ss_pred             cccCcc---c----ccccCCCCccCCCCC-eeecchhHHHHHHHHHHhCCCeEEEeccCcccCCCCCccccccCHHHHHH
Confidence            111000   0    012367789999999 9999999999999999999989999999999865      4567777777


Q ss_pred             cccceeEEeeeccccCCCCCCcccchhhHHHHHHHHHHHHhCCCcceEEeeccCCchhhhhhcCCcchhhHHHHHHHHHH
Q psy14902        430 YAFQVYRFSLSWSRILPTGDIDKINEKGVQYYRNLIDELLLNNIQPMVTLYHWDLPQPLQDFGGWTNAIIADYFETYADF  509 (985)
Q Consensus       430 ~g~~~yR~si~WsRi~P~G~~~~~n~~g~~fY~~~i~~l~~~gi~P~vTL~H~d~P~~l~~~gGW~n~~~id~f~~ya~~  509 (985)
                      |                               +++|++|++                +++                    
T Consensus       378 l-------------------------------~~hL~~~~~----------------Ai~--------------------  390 (449)
T d1qoxa_         378 L-------------------------------AMHLIQASR----------------AIE--------------------  390 (449)
T ss_dssp             H-------------------------------HHHHHHHHH----------------HHH--------------------
T ss_pred             H-------------------------------HHHHHHHHH----------------HHH--------------------
Confidence            7                               999999999                887                    


Q ss_pred             HHHHhCCeeEEEeecceeeecccceeeeeeeccccccccchhhhcccceeeecCC
Q psy14902        510 AYKTFGDKKYLTAMQKALVNDKCNIIGYTAWSILDNFEWLDGYTCRFGIVHVDFS  564 (985)
Q Consensus       510 ~~~~~gd~VW~Tf~~~~~~~~~~~~~~~~~~~~~~~g~y~~~~~~~~~~~~~~~~  564 (985)
                                          +|++++||++|+++||.||..++.+|||+.++|+.
T Consensus       391 --------------------dGv~V~GY~~WSl~Dn~EW~~Gy~~RFGL~~VD~~  425 (449)
T d1qoxa_         391 --------------------DGINLKGYMEWSLMDNFEWAEGYGMRFGLVHVDYD  425 (449)
T ss_dssp             --------------------TTCCEEEEEEECSBCCCCGGGTTSSCCCSEEEETT
T ss_pred             --------------------CCCCEEEEeecCcchhcChhhcccCccceEEECCC
Confidence                                78999999999999999999999999999988863
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure