Psyllid ID: psy15051


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060-----
MNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGLPSTSRPDIEGEGPSSEKYWGDILERTVSSNSLQALQRVYPPPHHSMTLPHQYSMSMPPRHSMTLPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFANEPRLPEAAGRPDSDPTAYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSSVNSGLASGKLN
ccHHHHHHHHHHHHHcccccccccHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHcccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEccccccccEEEcEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccccccccccccccccHHHcccccccccccHHHHHHHcccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHccccccccccEEEEcccccccccccccccccccccccccccccEEEcccccccccccccHHHccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHcccccccccccccEEEccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccccccccccHHHHHHHHHHHHcccccEEEEcccccccccccccccccccHHHHcccHHHHcccccccccccccccccccccccccccccccccccHHHcHHHHHcccccHHHHHHHHHHHHcccccEEEEEEEEEcccccEEEEEEEEccEEEEEEEEcccccEEEEccccccccccEEEEEccccccccccccc
ccHHHHHHHHccHHHHHHHHHHHcccHHHHccEEEEcHHHcccccccccccHHHHHccHHHHHEEccccccEcccccccccEEEEccccccEHEHHHHHcccEEEEEcHHHHcccccccHHHHHHHHHHHHHHHccEEEccccccccEEHHcccccccEHHHHccccccccccEEcccccccccccEEEccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEccccccEEEcHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHccHHccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHEccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHccEEEEcHHHcccccccccccHHHHHccHHHHHHHHHHHHHccHHHHHHHcccEEEEcccEEcccccccccccEEEEEcHHHccHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHccccccccccEEEEEcccccccccccccHcccccccEEccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccccccHccccccccHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHcccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEcccccccEEEEcccHHHHHHHHHHHHHccccEEEcccccccccccccHHHcccHHHHHHHHHHHHHHcHHHHccccccccccccccccccccccccHHHHcccHHHHHHccccHHHHHHHHHHHHHHcHHHHHcEEEEEcccccEEEEEEEccccEEEEEEEcccccEEEEccHHHccccEEEEEcccccccccccccc
MNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVpsfkdsnndgigdlrgkNVRKRYLELTlgldpcgssmntdsntIYISFWMNCPILTTAVKTWSRRWIVVNHeqisrlptrtvSSLNIICKYFYMKKFKhridakndslhlidsvlgvptvdieslfstkppshsmcltdskhqcqgqnflfqgrpvnLMSYVLGrelrkhpphstphlphvccpsglpstsrpdiegegpssekywGDILERTVSsnslqalqrvyppphhsmtlphqysmsmpprhsmtlpsppdyprvhqphcavpnpkvlmvpnadiawnpscqttvvDCQMFCYEITLLLCILEFWLkrgvdgfgmDSVLKLYehesfaneprlpeaagrpdsdptaydhiytidqpeTYEMLYKWRTLVEKFgnqsadrqpscadkfaihsvylnpvyagsgnqnwragnqNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVpsfkdsnndgigdlrgkNVRKRYLELTLGLGIIEKIDYLKELGVetlwltpfysgpngdigydisnhtevgkdfgtmeDFDELVKLVHSKgkqkisqkqtknrshQLYCHMYMYAICADKFAIHSVylnpvyagsgnqnwragnQNRAESMEHRAGMKILVEFvpnhssnkhdwfiksaqkidpytnyyvwkdglngkpgtppnnwkhiniTSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYygtgdtqgthLSVNYEIMNKfgatsnakDLENVVNAYLKslpsgkwsswmvgghsitriatryspdLVDAMNMLTLLlpgtavtfagdelgmespilryedqrdpegyifgkdnylkvcrdgsrvpfqwndqenagfskakswlpvhpnywtlnaqaekktkpshysvykdlttlratsgavrmgdykistpnnYVFILTRTEGSTSVYLIINLNsrtetvdlsdcienggdvAIFTSSvnsglasgkln
MNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILvpsfkdsnndgigdlrgkNVRKRYLELTlgldpcgssmnTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNheqisrlptrtvsslNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGLPSTSRPDIEGEGPSSEKYWGDILERTVSSNSLQALQRVYPPPHHSMTLPHQYSMSMPPRHSMTLPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFaneprlpeaagrpdsdptaYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILvpsfkdsnndgigdlrgknvRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHskgkqkisqkqtknrsHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGlngkpgtppnNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSlpsgkwsswMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAqaekktkpshysvykDLTTLRatsgavrmgdykistpnNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTssvnsglasgkln
MNWvallvllstassvlssvRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGLPSTSRPDIEGEGPSSEKYWGDILERTVSSNSLQALQRVYPPPHHSMTLPHQYSMSMPPRHSMTLPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFANEPRLPEAAGRPDSDPTAYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWvallvllstassvlssvRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSSVNSGLASGKLN
**WVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFS*******MCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRE**************************************YWGDIL*****************************************************HCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEH*********************AYDHIYTIDQPETYEMLYKWRTLVEKFGNQS****PSCADKFAIHSVYLNPVYAGSGNQNW*************RADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVH****************HQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNW***************GMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAE****PSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTS************
*NWVALLVLLSTASS**********EWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKF****DAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGL****************KYWGDILERTVSSNSLQALQRVYPPPHHSMTLPHQYSMSMPPRHSMTLPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFANEPRLPEAAGRPDSDPTAYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYA*CADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFT*************
MNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGLPST***********SEKYWGDILERTVSSNSLQALQRVYPPPHHSMTLPHQYSMSMPPRHSMTLPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFANEPRLPEAAGRPDSDPTAYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLV***************RSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSSVNS********
MNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGL***********GPSSEKYWGDILERTVSSNSLQALQRVYPPPHHSMTL***************LPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFANEPRLPEAAGRPDSDPTAYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNW***********EHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSSV**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLDPCGSSMNTDSNTIYISFWMNCPILTTAVKTWSRRWIVVNHEQISRLPTRTVSSLNIICKYFYMKKFKHRIDAKNDSLHLIDSVLGVPTVDIESLFSTKPPSHSMCLTDSKHQCQGQNFLFQGRPVNLMSYVLGRELRKHPPHSTPHLPHVCCPSGLPSTSRPDIEGEGPSSEKYWGDILERTVSSNSLQALQRVYPPPHHSMTLPHQYSMSMPPRHSMTLPSPPDYPRVHQPHCAVPNPKVLMVPNADIAWNPSCQTTVVDCQMFCYEITLLLCILEFWLKRGVDGFGMDSVLKLYEHESFANEPRLPEAAGRPDSDPTAYDHIYTIDQPETYEMLYKWRTLVEKFGNQSADRQPSCADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRADLLHQVVSHFIYCGIVDDTSALMVMNERRLSTIASRTMAAMSLGFIVMVTPWTIQEVVAACTGSKMNWVALLVLLSTASSVLSSVRCNQKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSSVNSGLASGKLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1065 2.2.26 [Sep-21-2011]
P07192574 Maltase A3 OS=Drosophila no N/A 0.440 0.817 0.293 2e-56
Q17058567 Alpha-glucosidase OS=Apis yes N/A 0.471 0.885 0.288 3e-53
O16099594 Maltase 2 OS=Drosophila v N/A N/A 0.246 0.442 0.394 2e-46
O16098632 Maltase 1 OS=Drosophila v N/A N/A 0.230 0.387 0.378 2e-40
P21332558 Oligo-1,6-glucosidase OS= yes N/A 0.430 0.820 0.270 2e-40
P07190577 Probable maltase H OS=Dro no N/A 0.247 0.457 0.324 2e-38
P28904551 Trehalose-6-phosphate hyd N/A N/A 0.421 0.814 0.268 3e-37
Q45101555 Oligo-1,6-glucosidase OS= yes N/A 0.439 0.843 0.25 4e-35
Q9Z3R8551 Probable alpha-glucosidas yes N/A 0.446 0.862 0.241 2e-34
Q54796535 Glucan 1,6-alpha-glucosid yes N/A 0.413 0.822 0.238 5e-34
>sp|P07192|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2 Back     alignment and function desciption
 Score =  221 bits (564), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 155/528 (29%), Positives = 250/528 (47%), Gaps = 59/528 (11%)

Query: 556  WWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLW 615
            WWK    YQI   SFKDS+ DG+GDL               +GI +++ YLKE+G+   W
Sbjct: 23   WWKTGQFYQIYPRSFKDSDGDGVGDL---------------IGITQQLPYLKEIGITATW 67

Query: 616  LTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDE------------LVKLVHSKGKQKIS 663
            L+P ++ P  D GYD+++   +   FGTMEDF+             ++  V +    +  
Sbjct: 68   LSPIFTSPMADFGYDVADLKGIDPIFGTMEDFEALLARAKELDIKIILDFVPNHTSDECD 127

Query: 664  QKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESM-EHRA 722
                     + Y   Y++        I     N V    G+  W    Q +A  + +  A
Sbjct: 128  WFIRSAAGEEEYKDFYVWHTGKVVNGIRQPPTNWVSVFRGSM-WTWNEQRQAYYLHQFHA 186

Query: 723  GMKILVEFVPNHSSNKHD----WFIKSAQ--KIDPYTNYYV--------WKDGLNGKPGT 768
                L    P       D    W  K A   +ID   + Y         W D    +  +
Sbjct: 187  KQPDLNYRNPKVVEAMKDVLRFWLRKGAYGFRIDAVPHVYEIPADADGNWPDEPRNEAVS 246

Query: 769  PPNNW---KHINITSR----EVMRSQKDVVQSFPLIL-----MIITEAYSPSLEKVAKYY 816
             P ++   +HI  T +    E++ + +DV++     L     +++TEAYSP LE + +YY
Sbjct: 247  DPEDYTYLQHIYTTDQPETLELVYAFRDVIEEIDAELGGDDRVLLTEAYSP-LEVLMQYY 305

Query: 817  GTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIAT 876
            G G   G+ +  N+E++ K   +S+A     +++ +L ++P G+ ++W+ G H  +RI +
Sbjct: 306  GNGTHLGSQIPFNFELLAKISYSSDAYHYSELIHNWLDNMPEGQVANWVFGNHDQSRIGS 365

Query: 877  RYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRD 936
            R   D +DA NM+ L LPG +VT+ G+E+GM    + +ED  DP+     +  + ++ RD
Sbjct: 366  RLGADRIDACNMIILGLPGVSVTYQGEEMGMTDVWISWEDTVDPQACQSNEQEFERLTRD 425

Query: 937  GSRVPFQWNDQENAGFSKAK-SWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSG 995
              R PFQW+D+ NAGFS A  +WLPV  NY  +N + E+    SH +VYK L  LR    
Sbjct: 426  PVRTPFQWSDEVNAGFSNASVTWLPVASNYKLVNVKKERGIALSHLNVYKQLRALR-DEP 484

Query: 996  AVRMGDYKISTPNNYVFILTRT-EGSTSVYLIINLNSRTETVDLSDCI 1042
             ++ GD  ++     V    R+  G  S   +IN+N   E+++L    
Sbjct: 485  TLKQGDVSVTAIGPNVLAFKRSLAGYKSYITLININDDVESINLDSVF 532





Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 0
>sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 Back     alignment and function description
>sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 Back     alignment and function description
>sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 Back     alignment and function description
>sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 Back     alignment and function description
>sp|P07190|MAL2_DROME Probable maltase H OS=Drosophila melanogaster GN=LvpH PE=2 SV=2 Back     alignment and function description
>sp|P28904|TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) GN=treC PE=3 SV=3 Back     alignment and function description
>sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 Back     alignment and function description
>sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 Back     alignment and function description
>sp|Q54796|DEXB_STRPN Glucan 1,6-alpha-glucosidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dexB PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1065
383856267567 PREDICTED: probable maltase H-like [Mega 0.470 0.883 0.321 2e-66
328702369588 PREDICTED: probable maltase L-like [Acyr 0.455 0.824 0.303 2e-64
357620398581 alpha amylase [Danaus plexippus] 0.478 0.877 0.299 2e-63
328702366573 PREDICTED: maltase 2-like [Acyrthosiphon 0.469 0.872 0.301 4e-63
306518660583 alpha amylase precursor [Bombyx mori] gi 0.470 0.859 0.314 2e-62
322797332568 hypothetical protein SINV_00822 [Solenop 0.475 0.890 0.313 3e-62
195116947586 GI24705 [Drosophila mojavensis] gi|19391 0.448 0.815 0.299 8e-62
357620800578 alpha amylase [Danaus plexippus] 0.448 0.826 0.307 1e-61
195159471564 GL15372 [Drosophila persimilis] gi|19411 0.472 0.891 0.305 2e-61
91081577575 PREDICTED: similar to GA13362-PA [Tribol 0.470 0.871 0.303 6e-61
>gi|383856267|ref|XP_003703631.1| PREDICTED: probable maltase H-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  261 bits (667), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 183/570 (32%), Positives = 283/570 (49%), Gaps = 69/570 (12%)

Query: 535  LLVLLSTASSVLSSVRCNQKEWWKN-TVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLEL 593
            +  LL  A S L +V      W+ +  VIYQI   SFKDSN DGIGDL G          
Sbjct: 1    MFRLLLLACSALVAVAAPSTAWYDHGAVIYQIYPRSFKDSNGDGIGDLNG---------- 50

Query: 594  TLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKL 653
                 I EK+D+L +LGV+ LW++P ++ P  D GYDISN T++  D+GT+ DFD LV  
Sbjct: 51   -----ITEKLDHLADLGVQALWMSPIFTSPQVDYGYDISNFTDIDPDYGTLADFDRLVAK 105

Query: 654  VHSKGKQKISQKQTKNRSHQLYCHMYMYAICA--DKFAIHSVYLNPVYAGSGN---QNWR 708
              S G + I      + S+Q   H +          +  + V+ +P           NW 
Sbjct: 106  AKSLGLKVILDFVPNHSSNQ---HPWFLKSIKKISPYTDYYVWHDPKIVNGTRYPPNNWI 162

Query: 709  AGNQNRAESMEHRAGMKILVEF-VPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNG--- 764
            +  QN A           L +F V     N  +  +K  Q++    ++++ K G++G   
Sbjct: 163  SNFQNGAWEWNEERQQYYLHQFAVAQPDLNYRNEVLK--QEMKDVLSFWM-KRGVDGFRI 219

Query: 765  --------------KP-----GTPPNNWKHINITSREVMRSQKDVVQSFPLIL------- 798
                          +P     G P N++++++    +      DV++S+ +++       
Sbjct: 220  DAINHLFEDPLFRDEPKANVTGVPENDYEYLDHIYTKNYDEVYDVLKSWRVLMDEFSTKT 279

Query: 799  -----MIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYL 853
                 MI+TEAY+     + KYY  G T    +  N+  ++     S A D +  ++ ++
Sbjct: 280  NSDYKMILTEAYANHTMTI-KYYDAGST----VPFNFMFISDLNNQSTAADFKTFIDRWV 334

Query: 854  KSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGMESPILR 913
             S+P GK S+W+VG H   R+A+R+     D +NML +LLPG +V + GDE+GME     
Sbjct: 335  DSVPQGKVSNWVVGNHDNHRVASRFGTRRADQINMLAMLLPGVSVIYNGDEIGMEDRFFT 394

Query: 914  YEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAK-SWLPVHPNYWTLNAQA 972
            YE+  DP G   G D Y    RD  R PFQW++  +AGFS +  +WLPVH NY  LN QA
Sbjct: 395  YEETIDPAGCNSGPDRYTLRSRDPERTPFQWDNTTSAGFSTSNVTWLPVHTNYKCLNLQA 454

Query: 973  EKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLIINLNSR 1032
            EK+ K SHY V+K L+ L+    A+R    K+    ++V  + R  GS +  L+IN + +
Sbjct: 455  EKQAKESHYHVFKALSALKKVP-AIRHSYLKVLVLADHVLSVVRHIGSRAAVLLINFSDK 513

Query: 1033 TETVDLSDCIENGGDVAIFTSSVNSGLASG 1062
              TV+++       ++ ++TSSV SG+  G
Sbjct: 514  PVTVNVTTSYVVAPELLVYTSSVGSGVLVG 543




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328702369|ref|XP_001952163.2| PREDICTED: probable maltase L-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357620398|gb|EHJ72605.1| alpha amylase [Danaus plexippus] Back     alignment and taxonomy information
>gi|328702366|ref|XP_001943582.2| PREDICTED: maltase 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|306518660|ref|NP_001182391.1| alpha amylase precursor [Bombyx mori] gi|213495553|gb|ACJ49024.1| alpha amylase [Bombyx mori] Back     alignment and taxonomy information
>gi|322797332|gb|EFZ19444.1| hypothetical protein SINV_00822 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195116947|ref|XP_002003012.1| GI24705 [Drosophila mojavensis] gi|193913587|gb|EDW12454.1| GI24705 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|357620800|gb|EHJ72852.1| alpha amylase [Danaus plexippus] Back     alignment and taxonomy information
>gi|195159471|ref|XP_002020602.1| GL15372 [Drosophila persimilis] gi|194117552|gb|EDW39595.1| GL15372 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|91081577|ref|XP_975228.1| PREDICTED: similar to GA13362-PA [Tribolium castaneum] gi|270006189|gb|EFA02637.1| hypothetical protein TcasGA2_TC008358 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1065
FB|FBgn0032382583 Mal-B2 "Maltase B2" [Drosophil 0.246 0.451 0.397 7.3e-81
FB|FBgn0032381584 Mal-B1 "Maltase B1" [Drosophil 0.244 0.445 0.344 1.6e-76
FB|FBgn0050360601 Mal-A6 "Maltase A6" [Drosophil 0.234 0.415 0.353 1.4e-74
FB|FBgn0033296599 Mal-A7 "Maltase A7" [Drosophil 0.224 0.398 0.370 2.3e-70
FB|FBgn0002571574 Mal-A3 "Maltase A3" [Drosophil 0.261 0.486 0.328 6.1e-70
FB|FBgn0002570577 Mal-A1 "Maltase A1" [Drosophil 0.246 0.454 0.327 1.4e-67
FB|FBgn0033297588 Mal-A8 "Maltase A8" [Drosophil 0.285 0.517 0.313 1.8e-57
FB|FBgn0050359630 Mal-A5 "Maltase A5" [Drosophil 0.224 0.379 0.342 5e-55
FB|FBgn0002569567 Mal-A2 "Maltase A2" [Drosophil 0.210 0.395 0.302 5.7e-53
FB|FBgn0033294579 Mal-A4 "Maltase A4" [Drosophil 0.224 0.412 0.338 3.8e-52
FB|FBgn0032382 Mal-B2 "Maltase B2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 489 (177.2 bits), Expect = 7.3e-81, Sum P(3) = 7.3e-81
 Identities = 107/269 (39%), Positives = 159/269 (59%)

Query:   799 MIITEAYSPSLEKVAKYY-GTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAYLKSLP 857
             +++TEAY+  L ++A YY  +   +G+HL  N+  +      S+A+D    V  +L  +P
Sbjct:   297 IMMTEAYA-GLTQLADYYEDSNGVRGSHLPFNFHFITDVKGDSDARDYVYNVEKWLIYMP 355

Query:   858 SGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTFAGDELGM-ESPILRYED 916
              G  ++W++G H   R+A+R+ P  VDAMNML L LPG AVT+ G+ELGM +   L +E+
Sbjct:   356 RGHAANWVMGNHDNPRVASRFGPASVDAMNMLLLTLPGVAVTYNGEELGMVDYRELSWEE 415

Query:   917 QRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKA-KSWLPVHPNYWTLNAQAEKK 975
               DP     G+  Y +V RD  R PFQWN++ NAGFS A K+WLPVHPNY  LN +A+K 
Sbjct:   416 TVDPPARNVGEKLYQEVSRDPVRTPFQWNNETNAGFSTAAKTWLPVHPNYLELNLEAQKV 475

Query:   976 TKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGS-TSVYLIINLNSRTE 1034
                SHY VYKDL  LR  S  +R+G + I     +VF   R+  +  S+  +IN++ + +
Sbjct:   476 ANRSHYQVYKDLLELRK-SAIMRVGRFNIEPLTRWVFAFKRSYPNFESIITVINVSDKEQ 534

Query:  1035 TVDLSDCIENGGDVAIFTSSVNSGLASGK 1063
              VDLS+ +     + +  S V+S    G+
Sbjct:   535 LVDLSEFLSQPKKLVVEVSGVDSKYQPGQ 563


GO:0004558 "alpha-glucosidase activity" evidence=ISS
GO:0043169 "cation binding" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0050360 Mal-A6 "Maltase A6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033296 Mal-A7 "Maltase A7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002571 Mal-A3 "Maltase A3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002570 Mal-A1 "Maltase A1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0050359 Mal-A5 "Maltase A5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002569 Mal-A2 "Maltase A2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033294 Mal-A4 "Maltase A4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1065
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 1e-72
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 7e-42
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 6e-41
COG0366505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 2e-40
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 3e-38
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 1e-37
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 4e-34
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 5e-34
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 3e-31
TIGR02403543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 6e-31
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 2e-30
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 3e-30
TIGR02456539 TIGR02456, treS_nterm, trehalose synthase 4e-26
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 9e-26
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 2e-25
PRK10933551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 2e-25
smart00642166 smart00642, Aamy, Alpha-amylase domain 5e-25
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 7e-24
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 3e-22
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 4e-22
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 1e-21
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 3e-21
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 1e-19
TIGR02403543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 1e-19
pfam00128314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 4e-19
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 6e-17
pfam00128314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 6e-17
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 1e-16
cd11313336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 2e-16
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 2e-15
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 9e-15
PRK10933551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 1e-14
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 2e-14
cd11320389 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase 8e-14
cd11329477 cd11329, AmyAc_maltase-like, Alpha amylase catalyt 7e-13
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 2e-12
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 6e-12
cd11324536 cd11324, AmyAc_Amylosucrase, Alpha amylase catalyt 8e-12
cd11339344 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal 1e-11
cd11352443 cd11352, AmyAc_5, Alpha amylase catalytic domain f 1e-11
cd11340407 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal 1e-11
PRK10933 551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 3e-11
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 5e-11
cd11328470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 1e-10
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 1e-10
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 9e-10
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 1e-09
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 1e-09
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 3e-09
cd11329477 cd11329, AmyAc_maltase-like, Alpha amylase catalyt 3e-09
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 4e-09
TIGR02456539 TIGR02456, treS_nterm, trehalose synthase 4e-09
cd11313336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 4e-09
cd11331450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 6e-09
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 8e-09
cd11359456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 1e-08
cd11330472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 1e-08
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 1e-08
TIGR02403 543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 3e-08
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 8e-08
TIGR02456539 TIGR02456, treS_nterm, trehalose synthase 1e-07
PRK10933551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 1e-07
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 1e-07
TIGR02456 539 TIGR02456, treS_nterm, trehalose synthase 7e-07
TIGR02403543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 1e-06
cd11350390 cd11350, AmyAc_4, Alpha amylase catalytic domain f 2e-06
COG3280 889 COG3280, TreY, Maltooligosyl trehalose synthase [C 2e-06
PRK09505683 PRK09505, malS, alpha-amylase; Reviewed 5e-06
cd11345326 cd11345, AmyAc_SLC3A2, Alpha amylase catalytic dom 5e-06
TIGR02401 825 TIGR02401, trehalose_TreY, malto-oligosyltrehalose 6e-06
cd11337328 cd11337, AmyAc_CMD_like, Alpha amylase catalytic d 8e-06
cd11319375 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d 1e-05
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 2e-05
cd11336 660 cd11336, AmyAc_MTSase, Alpha amylase catalytic dom 2e-05
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 5e-05
PRK14511 879 PRK14511, PRK14511, maltooligosyl trehalose syntha 5e-05
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 6e-05
PRK10785598 PRK10785, PRK10785, maltodextrin glucosidase; Prov 6e-05
cd11332481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 7e-05
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 7e-05
cd11345326 cd11345, AmyAc_SLC3A2, Alpha amylase catalytic dom 7e-05
cd11353366 cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase cat 9e-05
COG0296628 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [ 1e-04
cd11348429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 8e-04
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 0.001
cd11344355 cd11344, AmyAc_GlgE_like, Alpha amylase catalytic 0.001
PRK14507 1693 PRK14507, PRK14507, putative bifunctional 4-alpha- 0.002
cd11329477 cd11329, AmyAc_maltase-like, Alpha amylase catalyt 0.003
cd11354357 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalyt 0.003
cd11325436 cd11325, AmyAc_GTHase, Alpha amylase catalytic dom 0.003
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
 Score =  248 bits (635), Expect = 1e-72
 Identities = 97/224 (43%), Positives = 141/224 (62%), Gaps = 5/224 (2%)

Query: 781  REVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATS 840
            REV+            ++M  TEAYS SL+   KYYG   T G H   N+E++      S
Sbjct: 251  REVLDEYAKENNGDTRVMM--TEAYS-SLDNTMKYYGNETTYGAHFPFNFELITNLNKNS 307

Query: 841  NAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPDLVDAMNMLTLLLPGTAVTF 900
            NA D +++++ +L ++P G+ ++W++G H   R+A+R+  + VD MNML++LLPG AVT+
Sbjct: 308  NATDFKDLIDKWLDNMPEGQTANWVLGNHDNPRVASRFGEERVDGMNMLSMLLPGVAVTY 367

Query: 901  AGDELGMESPILRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKA-KSWL 959
             G+E+GME   + +ED  DP     G +NY    RD +R PFQW+D +NAGFS A K+WL
Sbjct: 368  YGEEIGMEDTTISWEDTVDPPACNAGPENYEAYSRDPARTPFQWDDSKNAGFSTANKTWL 427

Query: 960  PVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYK 1003
            PV+PNY TLN +A+KK   SHY++YK L  LR +   +R GD +
Sbjct: 428  PVNPNYKTLNLEAQKKDPRSHYNIYKKLAQLRKSPTFLR-GDLE 470


Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470

>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins Back     alignment and domain information
>gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200463 cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase Back     alignment and domain information
>gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200489 cd11352, AmyAc_5, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|225819 COG3280, TreY, Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236543 PRK09505, malS, alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|200483 cd11345, AmyAc_SLC3A2, Alpha amylase catalytic domain found in solute carrier family 3 member 2 proteins Back     alignment and domain information
>gnl|CDD|233849 TIGR02401, trehalose_TreY, malto-oligosyltrehalose synthase Back     alignment and domain information
>gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|200475 cd11336, AmyAc_MTSase, Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase) Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|237740 PRK14511, PRK14511, maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200483 cd11345, AmyAc_SLC3A2, Alpha amylase catalytic domain found in solute carrier family 3 member 2 proteins Back     alignment and domain information
>gnl|CDD|200490 cd11353, AmyAc_euk_bac_CMD_like, Alpha amylase catalytic domain found in eukaryotic and bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|223373 COG0296, GlgB, 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|200482 cd11344, AmyAc_GlgE_like, Alpha amylase catalytic domain found in GlgE-like proteins Back     alignment and domain information
>gnl|CDD|237737 PRK14507, PRK14507, putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase Back     alignment and domain information
>gnl|CDD|200491 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200464 cd11325, AmyAc_GTHase, Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1065
PRK10933551 trehalose-6-phosphate hydrolase; Provisional 100.0
TIGR02403543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
TIGR02456539 treS_nterm trehalose synthase. Trehalose synthase 100.0
PRK10785598 maltodextrin glucosidase; Provisional 100.0
PRK09505683 malS alpha-amylase; Reviewed 100.0
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 100.0
PRK10933551 trehalose-6-phosphate hydrolase; Provisional 100.0
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 100.0
KOG0471|consensus545 100.0
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 100.0
TIGR02403543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
PRK13840495 sucrose phosphorylase; Provisional 100.0
PRK12313633 glycogen branching enzyme; Provisional 100.0
TIGR02100688 glgX_debranch glycogen debranching enzyme GlgX. Th 100.0
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 100.0
PRK05402726 glycogen branching enzyme; Provisional 100.0
PRK14706639 glycogen branching enzyme; Provisional 100.0
PRK03705658 glycogen debranching enzyme; Provisional 100.0
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 100.0
PRK12568730 glycogen branching enzyme; Provisional 100.0
KOG0471|consensus545 100.0
COG0366505 AmyA Glycosidases [Carbohydrate transport and meta 100.0
PRK09441479 cytoplasmic alpha-amylase; Reviewed 100.0
TIGR02456539 treS_nterm trehalose synthase. Trehalose synthase 100.0
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 100.0
PRK147051224 glycogen branching enzyme; Provisional 100.0
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 100.0
PLN02960897 alpha-amylase 100.0
PLN00196428 alpha-amylase; Provisional 100.0
PRK10785598 maltodextrin glucosidase; Provisional 100.0
PLN02877970 alpha-amylase/limit dextrinase 100.0
TIGR02103898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 100.0
PLN02447758 1,4-alpha-glucan-branching enzyme 100.0
TIGR02455688 TreS_stutzeri trehalose synthase, Pseudomonas stut 100.0
COG0366505 AmyA Glycosidases [Carbohydrate transport and meta 100.0
PRK09505683 malS alpha-amylase; Reviewed 100.0
PLN02361401 alpha-amylase 100.0
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 99.98
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.97
COG1523697 PulA Type II secretory pathway, pullulanase PulA a 99.97
TIGR02455688 TreS_stutzeri trehalose synthase, Pseudomonas stut 99.96
PLN02784894 alpha-amylase 99.96
TIGR02401825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.96
PRK12313633 glycogen branching enzyme; Provisional 99.95
PRK14511879 maltooligosyl trehalose synthase; Provisional 99.94
PLN03244872 alpha-amylase; Provisional 99.93
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 99.92
PRK09441479 cytoplasmic alpha-amylase; Reviewed 99.92
PRK05402726 glycogen branching enzyme; Provisional 99.92
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 99.92
KOG0470|consensus757 99.92
PRK12568730 glycogen branching enzyme; Provisional 99.92
PRK13840495 sucrose phosphorylase; Provisional 99.91
TIGR02100688 glgX_debranch glycogen debranching enzyme GlgX. Th 99.91
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 99.91
PRK03705658 glycogen debranching enzyme; Provisional 99.91
PRK14706639 glycogen branching enzyme; Provisional 99.91
PLN02960897 alpha-amylase 99.9
PRK147051224 glycogen branching enzyme; Provisional 99.9
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 99.88
PLN00196428 alpha-amylase; Provisional 99.87
smart00642166 Aamy Alpha-amylase domain. 99.87
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 99.87
PRK145101221 putative bifunctional 4-alpha-glucanotransferase/g 99.87
TIGR021021111 pullulan_Gpos pullulanase, extracellular, Gram-pos 99.86
PLN02447758 1,4-alpha-glucan-branching enzyme 99.86
PLN02361401 alpha-amylase 99.84
PLN02784894 alpha-amylase 99.82
TIGR02103898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 99.81
COG1523697 PulA Type II secretory pathway, pullulanase PulA a 99.78
PLN02877970 alpha-amylase/limit dextrinase 99.78
smart00642166 Aamy Alpha-amylase domain. 99.73
TIGR02401825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.67
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 99.67
KOG0470|consensus757 99.64
PLN03244872 alpha-amylase; Provisional 99.53
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 99.41
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 99.33
PRK14511879 maltooligosyl trehalose synthase; Provisional 99.15
KOG2212|consensus504 99.11
PRK145071693 putative bifunctional 4-alpha-glucanotransferase/m 99.07
KOG2212|consensus504 98.66
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 98.51
PF1194189 DUF3459: Domain of unknown function (DUF3459); Int 98.48
PF14701423 hDGE_amylase: glucanotransferase domain of human g 98.47
COG3280889 TreY Maltooligosyl trehalose synthase [Carbohydrat 98.32
PF14872811 GHL5: Hypothetical glycoside hydrolase 5 98.0
PF14872811 GHL5: Hypothetical glycoside hydrolase 5 97.14
KOG3625|consensus 1521 97.11
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 96.63
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 96.02
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 95.34
PF14701423 hDGE_amylase: glucanotransferase domain of human g 95.14
PF11852168 DUF3372: Domain of unknown function (DUF3372); Int 94.93
PF1043878 Cyc-maltodext_C: Cyclo-malto-dextrinase C-terminal 94.26
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 93.89
PF0280695 Alpha-amylase_C: Alpha amylase, C-terminal all-bet 93.84
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 91.73
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 91.26
COG1649418 Uncharacterized protein conserved in bacteria [Fun 89.9
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 86.68
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 86.3
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 86.13
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 81.76
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 81.69
PRK14508497 4-alpha-glucanotransferase; Provisional 81.14
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-63  Score=598.35  Aligned_cols=418  Identities=30%  Similarity=0.591  Sum_probs=341.6

Q ss_pred             ChhhcccceEEEEecccccCcCCCCCCCCCCcccchhhhcccccccHHhhhHHHHHcCcCEEEeCCCCcCCCCCCCCcCC
Q psy15051        553 QKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDIS  632 (1065)
Q Consensus       553 ~~~ww~~~vIYei~v~~F~d~~~d~~Gdl~g~~~~~~~~~~t~~~Gl~~kLdYLk~LGvnaI~L~PI~~~~~~~~GY~~~  632 (1065)
                      .|.||+++|||||+|++|.+++++++|||+               ||+++|||||+||||+|||+||++++..+|||++.
T Consensus         4 ~~~W~~~~v~Yqi~~~~f~d~~~~~~Gdl~---------------gi~~~ldyl~~lGv~~i~l~P~~~~~~~~~gY~~~   68 (551)
T PRK10933          4 LPHWWQNGVIYQIYPKSFQDTTGSGTGDLR---------------GVTQRLDYLQKLGVDAIWLTPFYVSPQVDNGYDVA   68 (551)
T ss_pred             cchhhhcCeEEEEEchHhhcCCCCCCcCHH---------------HHHHhhHHHHhCCCCEEEECCCCCCCCCCCCCCcc
Confidence            478999999999999999999999999999               99999999999999999999999998878999999


Q ss_pred             CCcccCCCCCCHHHHHHHHHHHHhcCCceeecccccccccccccchhhhhhccccccccccccCccccCCCCCCCccCcc
Q psy15051        633 NHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQ  712 (1065)
Q Consensus       633 dy~~idp~~Gt~edfk~LV~~aH~~Gi~VIlDvv~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~  712 (1065)
                      ||+.|||+|||++||++||++|                                                          
T Consensus        69 d~~~id~~~Gt~~d~~~lv~~~----------------------------------------------------------   90 (551)
T PRK10933         69 NYTAIDPTYGTLDDFDELVAQA----------------------------------------------------------   90 (551)
T ss_pred             cCCCcCcccCCHHHHHHHHHHH----------------------------------------------------------
Confidence            9999999999999999999999                                                          


Q ss_pred             cchhhhhhhcCcEEEEEeccCCCCCCchhhHhhhccCCCCCcceeecCCCCCCCCCC------CCCC--c----------
Q psy15051        713 NRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTP------PNNW--K----------  774 (1065)
Q Consensus       713 ~~~~~~~H~~Gi~vIlDvV~NHts~~~~wf~~~~~~~~~~~d~y~~~~~~dG~p~~~------~~~W--~----------  774 (1065)
                             |++||+||+|+|+||++.+|+||+++....++|.+||+|.++.++.+...      .+.|  .          
T Consensus        91 -------h~~gi~vilD~V~NH~s~~~~wf~~~~~~~~~y~d~y~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~y~~~  163 (551)
T PRK10933         91 -------KSRGIRIILDMVFNHTSTQHAWFREALNKESPYRQFYIWRDGEPETPPNNWRSKFGGSAWRWHAESEQYYLHL  163 (551)
T ss_pred             -------HHCCCEEEEEECCCCccCchhHHHhhcCCCCCCcCceEecCCCCCCCCCcccccCCCccccccCCCCceEeec
Confidence                   99999999999999999999999998767889999999986432221000      0111  1          


Q ss_pred             ------cccCCCHHHHHHHHHHHHh----------------c-------------------------------C------
Q psy15051        775 ------HINITSREVMRSQKDVVQS----------------F-------------------------------P------  795 (1065)
Q Consensus       775 ------~ln~~n~~v~~~l~~~lk~----------------~-------------------------------~------  795 (1065)
                            .||+.||+|+++|.++++.                +                               +      
T Consensus       164 f~~~~pdLn~~np~V~~~l~~~~~~W~~~GvDGfRlDa~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  243 (551)
T PRK10933        164 FAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVVNLISKDQDFPDDLDGDGRRFYTDGPRAHEFLQEMNRDVFTP  243 (551)
T ss_pred             ccccCCccCCCCHHHHHHHHHHHHHHHHCCCcEEEEcchhhcCcCCCCCCCcccccccccCCChHHHHHHHHHHHHhhcc
Confidence                  1999999999999998321                0                               0      


Q ss_pred             CceEEEeecCCCChHHHhhhccCCCCccccccccHHHHHH--hhc------CCChHHHHHHHHHHhhcCCCCCccccccc
Q psy15051        796 LILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNK--FGA------TSNAKDLENVVNAYLKSLPSGKWSSWMVG  867 (1065)
Q Consensus       796 ~~~~ligE~~~~~~~~~~~y~~~~~~~~~d~~~~~~~~~~--~~~------~~~~~~l~~~l~~~~~~~~~~~~~~~fle  867 (1065)
                      ++++++||.|..+++....|.... ...+++.|+|.....  +.+      ..+...++..+..+...+....+..+|++
T Consensus       244 ~~~~~vgE~~~~~~~~~~~y~~~~-~~~~~~~fnf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fl~  322 (551)
T PRK10933        244 RGLMTVGEMSSTSLEHCQRYAALT-GSELSMTFNFHHLKVDYPNGEKWTLAKPDFVALKTLFRHWQQGMHNVAWNALFWC  322 (551)
T ss_pred             cCcEEEEeecCCCHHHHHHhhccc-CCeeeeEecHHHhhhhhccCCcccccccCHHHHHHHHHHHHHhhcccCeeccccC
Confidence            035799999986666666664321 245677777754321  111      12345667777777666666678888999


Q ss_pred             CCChhhHhhhcCHH------HHHHHHHHHHhCCCeEEEEcccccCccCCC-CccCCCCCccccccccc------------
Q psy15051        868 GHSITRIATRYSPD------LVDAMNMLTLLLPGTAVTFAGDELGMESPI-LRYEDQRDPEGYIFGKD------------  928 (1065)
Q Consensus       868 nHD~~Rl~s~~~~~------~~kla~~ll~tlpGiP~IyyGdE~G~~~~~-~~~~~~~Dp~~~~~~~~------------  928 (1065)
                      |||++|+++++|.+      .++++++++||+||+|+||||||+||.+.. ...++++|+++.+....            
T Consensus       323 NHD~~R~~sr~g~~~~~~~~~aklla~ll~tlpG~P~IYyGeEiGm~~~~~~~~~~~~D~~~~~~~~~~~~~g~~~~~~~  402 (551)
T PRK10933        323 NHDQPRIVSRFGDEGEYRVPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPHFTRITDYRDVESLNMFAELRNDGRDADELL  402 (551)
T ss_pred             CCCcccHHHHcCCchhHHHHHHHHHHHHHHhCCCceEEEeecccCCCCCCCCCHHHhcCHHHHHHHHHHhhcCCCHHHHH
Confidence            99999999999743      367788999999999999999999999853 23456777776554321            


Q ss_pred             -cccccccCCCCCcCCCCcccccCCCCCCCCCCCCCCcccccHHHhhcCCCcHHHHHHHHHHHHHhcccccCCCeEEEcc
Q psy15051        929 -NYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTP 1007 (1065)
Q Consensus       929 -~~~~~~rd~~R~~m~W~~~~~~gFs~~~~wl~~~~~~~~~~~~~~~~~~~~l~~~~r~Li~LRk~~paL~~G~~~~l~~ 1007 (1065)
                       .....+||++|.||+|++..++|||+++||++++++|..+|++.|...+.+++++||+||+|||++|+|+.|+++.+..
T Consensus       403 ~~~~~~~Rd~~RtPMqW~~~~~~GFs~~~pwl~~~~~~~~inv~~Q~~~~~Sll~~yk~Li~lRk~~~aL~~G~~~~~~~  482 (551)
T PRK10933        403 AILASKSRDNSRTPMQWDNGDNAGFTQGEPWIGLCDNYQEINVEAALADEDSVFYTYQKLIALRKQEPVLTWGDYQDLLP  482 (551)
T ss_pred             hhhhccCCCCCccccccCCCCCCCCCCCCCCCCCCcccccccHHHHhcCcccHHHHHHHHHHHhhcChhhccceeEEecc
Confidence             1334589999999999999999999999999999999999999999999999999999999999999999999998764


Q ss_pred             -CCcEEEEEEEcCCcEEEEEEECCCCcEEEEcCCCccCCCcEEEEEcc
Q psy15051       1008 -NNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSS 1054 (1065)
Q Consensus      1008 -~~~viaf~R~~~~~~vlVv~N~s~~~~~v~l~~~~~~~~~~~v~~~s 1054 (1065)
                       ++.|++|.|+.+++.++||+|+++++++++++.   +.+.+++++++
T Consensus       483 ~~~~v~af~R~~~~~~~lvv~N~s~~~~~~~~~~---~~~~~~~~l~~  527 (551)
T PRK10933        483 NHPSLWCYRREWQGQTLLVIANLSREPQPWQPGQ---MRGNWQLLMHN  527 (551)
T ss_pred             CCCcEEEEEEEcCCcEEEEEEECCCCCeeeecCc---ccCCceEEeec
Confidence             457999999988899999999999999998873   22455666665



>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PF11941 DUF3459: Domain of unknown function (DUF3459); InterPro: IPR022567 This functionally uncharacterised domain is found in bacteria Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>KOG3625|consensus Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>PF11852 DUF3372: Domain of unknown function (DUF3372); InterPro: IPR024561 This entry represents the uncharacterised C-terminal domain of secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants Back     alignment and domain information
>PF10438 Cyc-maltodext_C: Cyclo-malto-dextrinase C-terminal domain; InterPro: IPR019492 This domain is at the very C terminus of cyclo-malto-dextrinase proteins and consists of 8 beta strands, is largely globular and appears to help stabilise the active sites created by upstream domains, IPR015171 from INTERPRO, and IPR006047 from INTERPRO Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF02806 Alpha-amylase_C: Alpha amylase, C-terminal all-beta domain; InterPro: IPR006048 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PRK14508 4-alpha-glucanotransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1065
1uok_A558 Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas 2e-41
2ze0_A555 Alpha-glucosidase Gsj Length = 555 3e-40
1m53_A570 Crystal Structure Of Isomaltulose Synthase (Pali) F 5e-24
1m53_A570 Crystal Structure Of Isomaltulose Synthase (Pali) F 1e-16
4gin_A584 Crystal Structure Of The Mutb R284c Mutant From Cry 2e-22
4gin_A584 Crystal Structure Of The Mutb R284c Mutant From Cry 6e-21
4gi6_A557 Crystal Structure Of The Mutb F164l Mutant In Compl 2e-22
4gi6_A557 Crystal Structure Of The Mutb F164l Mutant In Compl 7e-21
2pwg_A556 Crystal Structure Of The Trehalulose Synthase Mutb 2e-22
2pwg_A556 Crystal Structure Of The Trehalulose Synthase Mutb 6e-21
2pwf_A556 Crystal Structure Of The Mutb D200a Mutant In Compl 2e-22
2pwf_A556 Crystal Structure Of The Mutb D200a Mutant In Compl 7e-21
1zja_A557 Crystal Structure Of The Trehalulose Synthase Mutb 2e-22
1zja_A557 Crystal Structure Of The Trehalulose Synthase Mutb 7e-21
2pwe_A556 Crystal Structure Of The Mutb E254q Mutant In Compl 2e-22
2pwe_A556 Crystal Structure Of The Mutb E254q Mutant In Compl 7e-21
4h2c_A557 Trehalulose Synthase Mutb R284c Mutant Length = 557 2e-22
4h2c_A557 Trehalulose Synthase Mutb R284c Mutant Length = 557 7e-21
3gbd_A558 Crystal Structure Of The Isomaltulose Synthase Smua 2e-21
3gbd_A558 Crystal Structure Of The Isomaltulose Synthase Smua 8e-15
4aie_A549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 6e-20
4aie_A549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 1e-13
3axh_A589 Crystal Structure Of Isomaltase In Complex With Iso 9e-19
3axh_A589 Crystal Structure Of Isomaltase In Complex With Iso 1e-05
3a47_A589 Crystal Structure Of Isomaltase From Saccharomyces 1e-18
3a47_A589 Crystal Structure Of Isomaltase From Saccharomyces 1e-05
2zid_A543 Crystal Structure Of Dextran Glucosidase E236q Comp 5e-18
2zid_A543 Crystal Structure Of Dextran Glucosidase E236q Comp 1e-17
2zic_A543 Crystal Structure Of Streptococcus Mutans Dextran G 6e-18
2zic_A543 Crystal Structure Of Streptococcus Mutans Dextran G 2e-17
1wza_A488 Crystal Structure Of Alpha-Amylase From H.Orenii Le 2e-15
3k8k_A 669 Crystal Structure Of Susg Length = 669 1e-12
3k8l_A 669 Crystal Structure Of Susg-D498n Mutant With Maltohe 2e-12
4aee_A696 Crystal Structure Of Maltogenic Amylase From S.Mari 1e-11
1lwh_A441 Crystal Structure Of T. Maritima 4-Alpha-Glucanotra 2e-09
1sma_A588 Crystal Structure Of A Maltogenic Amylase Length = 2e-09
1g1y_A585 Crystal Structure Of Alpha-Amylase Ii (Tvaii) From 5e-09
1jf5_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 5e-09
1wzk_A585 Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T 5e-09
1wzl_A585 Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T 5e-09
1vfm_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 5e-09
1jl8_A585 Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoact 5e-09
1jf6_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 5e-09
1wzm_A585 Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (t 5e-09
1bvz_A585 Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vul 5e-09
1j0h_A588 Crystal Structure Of Bacillus Stearothermophilus Ne 1e-07
1j0j_A588 Crystal Structure Of Neopullulanase E357q Complex W 3e-07
1gvi_A588 Thermus Maltogenic Amylase In Complex With Beta-Cd 2e-06
2wc7_A488 Crystal Structure Of Nostoc Punctiforme Debranching 3e-06
1mvy_A628 Amylosucrase Mutant E328q Co-Crystallized With Malt 8e-06
1jgi_A628 Crystal Structure Of The Active Site Mutant Glu328g 8e-06
4fls_A628 Crystal Structure Of Amylosucrase Inactive Double M 3e-05
4flo_A628 Crystal Structure Of Amylosucrase Double Mutant A28 3e-05
4flr_A628 Crystal Structure Of Amylosucrase Double Mutant A28 3e-05
4flq_A628 Crystal Structure Of Amylosucrase Double Mutant A28 3e-05
1g5a_A628 Amylosucrase From Neisseria Polysaccharea Length = 3e-05
3ueq_A632 Crystal Structure Of Amylosucrase From Neisseria Po 3e-05
3ucq_A655 Crystal Structure Of Amylosucrase From Deinococcus 7e-05
1ea9_C583 Cyclomaltodextrinase Length = 583 1e-04
1qho_A 686 Five-Domain Alpha-Amylase From Bacillus Stearotherm 2e-04
>pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 Back     alignment and structure

Iteration: 1

Score = 168 bits (425), Expect = 2e-41, Method: Compositional matrix adjust. Identities = 150/554 (27%), Positives = 238/554 (42%), Gaps = 96/554 (17%) Query: 553 QKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVE 612 +K+WWK +V+YQI SF DSN DGIGDLRG II K+DYLKELG++ Sbjct: 2 EKQWWKESVVYQIYPRSFMDSNGDGIGDLRG---------------IISKLDYLKELGID 46 Query: 613 TLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSH 672 +WL+P Y PN D GYDIS++ ++ +FGTMED+DEL+ +H + + + + S Sbjct: 47 VIWLSPVYESPNDDNGYDISDYCKIMNEFGTMEDWDELLHEMHERNMKLMMDLVVNHTSD 106 Query: 673 QLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVP 732 + + +K+ + ++ P G NW A A + L F Sbjct: 107 EHNWFIESRKSKDNKYRDYYIW-RPGKEGKEPNNWGAAFSGSAWQYDEMTDEYYLHLFSK 165 Query: 733 NHSSNKHDWFIKSAQKIDPYTNYYVW-KDGLNG-----------KPGTP----------- 769 D + D Y W + G++G + G P Sbjct: 166 KQPDLNWD---NEKVRQDVYEMMKFWLEKGIDGFRMDVINFISKEEGLPTVETEEEGYVS 222 Query: 770 --------PNNWKHINITSREVMRSQKDVVQSFPLILMIITEAYSPSLEKVAKYYGTGDT 821 PN K+++ + EV+ S D+ M + E + E+ AK Y + Sbjct: 223 GHKHFMNGPNIHKYLHEMNEEVL-SHYDI--------MTVGEMPGVTTEE-AKLYTGEER 272 Query: 822 QGTHLSVNYEIMNKFGATSNAKD--------LENVVNAYLKSLPSGKWSSWMVGGHSITR 873 + + +E M+ D L+ + + K+L W+S H R Sbjct: 273 KELQMVFQFEHMDLDSGEGGKWDVKPCSLLTLKENLTKWQKALEHTGWNSLYWNNHDQPR 332 Query: 874 IATRYSPD---LVDAMNMLTLLL---PGTAVTFAGDELGMESPILRYE---DQRDPEGYI 924 + +R+ D +++ ML +L GT + G+E+GM + +R+E + RD E Sbjct: 333 VVSRFGNDGMYRIESAKMLATVLHMMKGTPYIYQGEEIGMTN--VRFESIDEYRDIETLN 390 Query: 925 FGKDN---------------YLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLN 969 K+ Y+K RD +R P QW+DQ +AGF+ + W+ V+PNY +N Sbjct: 391 MYKEKVMERGEDIEKVMQSIYIK-GRDNARTPMQWDDQNHAGFTTGEPWITVNPNYKEIN 449 Query: 970 AQAEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNN-YVFILTRTEGSTSVYLIIN 1028 + + K S + YK L LR + V G Y + NN +F RT G + +I N Sbjct: 450 VKQAIQNKDSIFYYYKKLIELRKNNEIVVYGSYDLILENNPSIFAYVRTYGVEKLLVIAN 509 Query: 1029 LNSRTETVDLSDCI 1042 + +L + I Sbjct: 510 FTAEECIFELPEDI 523
>pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 Back     alignment and structure
>pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 Back     alignment and structure
>pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 Back     alignment and structure
>pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 Back     alignment and structure
>pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 Back     alignment and structure
>pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 Back     alignment and structure
>pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 Back     alignment and structure
>pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 Back     alignment and structure
>pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 Back     alignment and structure
>pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 Back     alignment and structure
>pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 Back     alignment and structure
>pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 Back     alignment and structure
>pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 Back     alignment and structure
>pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 Back     alignment and structure
>pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 Back     alignment and structure
>pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 Back     alignment and structure
>pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 Back     alignment and structure
>pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 Back     alignment and structure
>pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure
>pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 Back     alignment and structure
>pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 Back     alignment and structure
>pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 Back     alignment and structure
>pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 Back     alignment and structure
>pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 Back     alignment and structure
>pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 Back     alignment and structure
>pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 Back     alignment and structure
>pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 Back     alignment and structure
>pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 Back     alignment and structure
>pdb|3K8K|A Chain A, Crystal Structure Of Susg Length = 669 Back     alignment and structure
>pdb|3K8L|A Chain A, Crystal Structure Of Susg-D498n Mutant With Maltoheptaose Length = 669 Back     alignment and structure
>pdb|4AEE|A Chain A, Crystal Structure Of Maltogenic Amylase From S.Marinus Length = 696 Back     alignment and structure
>pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 Back     alignment and structure
>pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 Back     alignment and structure
>pdb|1G1Y|A Chain A, Crystal Structure Of Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R-47 And Beta-Cyclodextrin Complex Length = 585 Back     alignment and structure
>pdb|1JF5|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2 Mutant F286a Length = 585 Back     alignment and structure
>pdb|1WZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt D465n Length = 585 Back     alignment and structure
>pdb|1WZL|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt R469l Length = 585 Back     alignment and structure
>pdb|1VFM|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2ALPHA-Cyclodextrin Complex Length = 585 Back     alignment and structure
>pdb|1JL8|A Chain A, Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoactinomyces Vulgaris R-47 With Beta-Cyclodextrin Based On A Co- Crystallization With Methyl Beta-Cyclodextrin Length = 585 Back     alignment and structure
>pdb|1JF6|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase Mutant F286y Length = 585 Back     alignment and structure
>pdb|1WZM|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (tva Ii) Mutatnt R469k Length = 585 Back     alignment and structure
>pdb|1BVZ|A Chain A, Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R- 47 Length = 585 Back     alignment and structure
>pdb|1J0H|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Neopullulanase Length = 588 Back     alignment and structure
>pdb|1J0J|A Chain A, Crystal Structure Of Neopullulanase E357q Complex With Maltotetraose Length = 588 Back     alignment and structure
>pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 Back     alignment and structure
>pdb|2WC7|A Chain A, Crystal Structure Of Nostoc Punctiforme Debranching Enzyme( Npde)(Acarbose Soaked) Length = 488 Back     alignment and structure
>pdb|1MVY|A Chain A, Amylosucrase Mutant E328q Co-Crystallized With Maltoheptaose. Length = 628 Back     alignment and structure
>pdb|1JGI|A Chain A, Crystal Structure Of The Active Site Mutant Glu328gln Of Amylosucrase From Neisseria Polysaccharea In Complex With The Natural Substrate Sucrose Length = 628 Back     alignment and structure
>pdb|4FLS|A Chain A, Crystal Structure Of Amylosucrase Inactive Double Mutant F290k-E328q From Neisseria Polysaccharea In Complex With Sucrose Length = 628 Back     alignment and structure
>pdb|4FLO|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290c From Neisseria Polysaccharea Length = 628 Back     alignment and structure
>pdb|4FLR|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290l From Neisseria Polysaccharea Length = 628 Back     alignment and structure
>pdb|4FLQ|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290i From Neisseria Polysaccharea Length = 628 Back     alignment and structure
>pdb|1G5A|A Chain A, Amylosucrase From Neisseria Polysaccharea Length = 628 Back     alignment and structure
>pdb|3UEQ|A Chain A, Crystal Structure Of Amylosucrase From Neisseria Polysaccharea In Complex With Turanose Length = 632 Back     alignment and structure
>pdb|3UCQ|A Chain A, Crystal Structure Of Amylosucrase From Deinococcus Geothermalis Length = 655 Back     alignment and structure
>pdb|1EA9|C Chain C, Cyclomaltodextrinase Length = 583 Back     alignment and structure
>pdb|1QHO|A Chain A, Five-Domain Alpha-Amylase From Bacillus Stearothermophilus, MaltoseACARBOSE COMPLEX Length = 686 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1065
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 1e-75
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 2e-10
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 4e-65
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 7e-35
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 2e-08
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 3e-47
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 6e-36
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 1e-11
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 2e-40
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 6e-32
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 4e-15
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 1e-12
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 2e-40
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 4e-32
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 4e-15
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 2e-12
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 2e-04
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 2e-40
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 4e-29
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 1e-12
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 2e-12
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 3e-40
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 6e-31
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 5e-15
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 3e-12
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 4e-40
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 5e-32
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 3e-15
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 3e-12
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 5e-40
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 5e-24
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 6e-14
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 4e-12
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 6e-04
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 1e-38
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 8e-38
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 4e-37
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 3e-32
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 4e-13
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 9e-12
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 1e-07
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 5e-28
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 3e-27
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 4e-24
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 6e-04
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 2e-23
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 1e-11
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 1e-22
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 6e-10
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 2e-07
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 8e-05
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 5e-22
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 1e-10
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 8e-05
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 9e-22
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 2e-15
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 1e-21
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 5e-11
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 4e-21
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 1e-13
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 6e-21
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 5e-09
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 3e-08
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 2e-20
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 5e-11
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 2e-04
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 2e-20
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 2e-09
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 9e-20
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 2e-09
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 6e-05
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 2e-19
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 2e-09
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 2e-19
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 3e-08
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 6e-19
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 6e-11
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 7e-19
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 6e-10
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 2e-18
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 1e-05
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 4e-18
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 3e-11
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 2e-17
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 2e-07
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 3e-17
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 6e-15
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 3e-16
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 5e-05
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 6e-05
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 9e-16
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 1e-04
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 7e-04
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 3e-14
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 2e-13
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 9e-05
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 2e-13
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 1e-04
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 5e-13
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 2e-04
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 4e-12
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 7e-12
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 1e-09
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 6e-04
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 3e-06
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
 Score =  255 bits (652), Expect = 1e-75
 Identities = 75/489 (15%), Positives = 157/489 (32%), Gaps = 126/489 (25%)

Query: 553  QKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVE 612
             ++WW    +Y+I     +     G G+L G               +  ++DYL  L V+
Sbjct: 9    AQKWWHTGALYRI--GDLQAFQGHGAGNLAG---------------LKGRLDYLSSLKVK 51

Query: 613  TLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSH 672
             L L P +     D+    ++  ++  +FG+ EDFD L++    K               
Sbjct: 52   GLVLGPIHKNQKDDVAQ--TDLLQIDPNFGSKEDFDSLLQSAKKKS-------------- 95

Query: 673  QLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVP 732
                   +  I           L+      G  +W                       V 
Sbjct: 96   -------IRVI-----------LDLTPNYRGENSW-------------------FSTQVD 118

Query: 733  NHSSNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINITSREVMRSQKDVVQ 792
              ++   D                 W     G  G    + +++   S   +   +++ +
Sbjct: 119  TVATKVKDA-------------LEFWLQA--GVDGFQVRDIENLKDAS-SFLAEWQNITK 162

Query: 793  SFPLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKFGATSNAKDLENVVNAY 852
             F    ++I    S  L+++     +       L +    ++   + S  +  +++V  Y
Sbjct: 163  GFSEDRLLIAGTNSSDLQQILSLLESNK----DLLLTSSYLSD--SGSTGEHTKSLVTQY 216

Query: 853  LKSLPSGKWSSWMVGGHSITRIATRYSPD-LVDAMNMLTLLLPGTAVTFAGDELGMESPI 911
            L +  +  W SW +      R+ T + P  L+    ++   LPGT V   GDE+G+++  
Sbjct: 217  LNATGNR-WCSWSLSQA---RLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAA 272

Query: 912  LRYEDQRDPEGYIFGKDNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQ 971
            L  +    P                       W++            +P       +  +
Sbjct: 273  LPGQPMEAP--------------------VMLWDESSFP-------DIPG-AVSANMTVK 304

Query: 972  AEKKTKPSHYSVYKDLTTLRATSGAVRMGDYKISTPNNYVFILTRTEGSTSVYLII-NLN 1030
             + +   S  S+++ L+  R+   ++  GD+   +    +F   R       +L++ N  
Sbjct: 305  GQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFG 364

Query: 1031 SRTETVDLS 1039
                +  L 
Sbjct: 365  DVGLSAGLQ 373


>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1065
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
4aie_A549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 100.0
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 100.0
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 100.0
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 100.0
4aio_A884 Limit dextrinase; hydrolase, pullulanase, glycosid 100.0
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 100.0
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 100.0
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 100.0
4aie_A549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 100.0
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 100.0
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 100.0
2fhf_A1083 Pullulanase; multiple domain, beta-alpha-barrel, a 100.0
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 100.0
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 100.0
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 100.0
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 100.0
3faw_A877 Reticulocyte binding protein; TIM barrel, beta bar 100.0
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 100.0
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 100.0
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 100.0
2ya1_A1014 Putative alkaline amylopullulanase; hydrolase, gly 100.0
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 100.0
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 100.0
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 100.0
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 100.0
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 100.0
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 100.0
3k8k_A669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 100.0
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 100.0
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 100.0
3ucq_A655 Amylosucrase; thermostability, amylose synthesis, 100.0
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 100.0
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 99.97
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 99.97
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.97
1r7a_A504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.97
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.97
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 99.97
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.96
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.96
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.96
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.96
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 99.96
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.96
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.95
3klk_A1039 Glucansucrase; native form, open conformation, mul 99.95
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 99.95
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.95
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.95
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 99.95
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 99.95
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.95
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 99.94
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.94
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.94
3aml_A755 OS06G0726400 protein; starch-branching, transferas 99.94
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 99.94
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 99.93
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.93
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 99.92
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 99.92
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.91
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.9
3faw_A877 Reticulocyte binding protein; TIM barrel, beta bar 99.89
2fhf_A1083 Pullulanase; multiple domain, beta-alpha-barrel, a 99.89
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 99.89
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.88
2ya1_A1014 Putative alkaline amylopullulanase; hydrolase, gly 99.87
1iv8_A720 Maltooligosyl trehalose synthase; beta alpha barre 99.84
4aio_A884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.83
3hje_A704 704AA long hypothetical glycosyltransferase; treha 99.81
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.73
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.68
3klk_A1039 Glucansucrase; native form, open conformation, mul 99.59
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.54
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 94.71
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 94.55
3mi6_A745 Alpha-galactosidase; NESG, structural genomics, PS 94.22
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 93.33
1zy9_A564 Alpha-galactosidase; TM1192, struc genomics, joint 92.66
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 91.88
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 90.3
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 87.77
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 87.28
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 87.17
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 86.65
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 86.37
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 85.98
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 85.68
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 85.62
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 85.41
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 84.78
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 84.03
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 83.89
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 83.71
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 83.18
4fnq_A729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 82.58
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 81.75
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 81.69
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 81.09
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 80.93
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 80.84
4fnq_A729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 80.77
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 80.32
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 80.09
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 80.07
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
Probab=100.00  E-value=2.8e-64  Score=611.84  Aligned_cols=418  Identities=34%  Similarity=0.663  Sum_probs=349.0

Q ss_pred             hhhcccceEEEEecccccCcCCCCCCCCCCcccchhhhcccccccHHhhhHHHHHcCcCEEEeCCCCcCCCCCCCCcCCC
Q psy15051        554 KEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDISN  633 (1065)
Q Consensus       554 ~~ww~~~vIYei~v~~F~d~~~d~~Gdl~g~~~~~~~~~~t~~~Gl~~kLdYLk~LGvnaI~L~PI~~~~~~~~GY~~~d  633 (1065)
                      |+||+++|||||+|++|++++++++|||+               ||+++|||||+||||+|||+||++++..+|||+++|
T Consensus         3 ~~w~~~~viYqi~~~~F~d~~~dg~Gdl~---------------gi~~~ldyl~~LGv~~I~l~Pi~~~~~~~~GYd~~d   67 (558)
T 1uok_A            3 KQWWKESVVYQIYPRSFMDSNGDGIGDLR---------------GIISKLDYLKELGIDVIWLSPVYESPNDDNGYDISD   67 (558)
T ss_dssp             CCHHHHCCEEEECGGGTCCSSSSSSCCHH---------------HHHTTHHHHHHHTCCEEEECCCEECCCTTTTSSCSE
T ss_pred             chhhhcCeEEEEecHHhcCCCCCCcCCHH---------------HHHHHHHHHHHcCCCEEEECCcccCCCCCCCCCccc
Confidence            68999999999999999999999999999               999999999999999999999999998889999999


Q ss_pred             CcccCCCCCCHHHHHHHHHHHHhcCCceeecccccccccccccchhhhhhccccccccccccCccccCCCCCCCccCccc
Q psy15051        634 HTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQN  713 (1065)
Q Consensus       634 y~~idp~~Gt~edfk~LV~~aH~~Gi~VIlDvv~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~  713 (1065)
                      |++|||+|||++||++||++|                                                           
T Consensus        68 y~~id~~~Gt~~df~~lv~~~-----------------------------------------------------------   88 (558)
T 1uok_A           68 YCKIMNEFGTMEDWDELLHEM-----------------------------------------------------------   88 (558)
T ss_dssp             EEEECGGGCCHHHHHHHHHHH-----------------------------------------------------------
T ss_pred             ccccCcccCCHHHHHHHHHHH-----------------------------------------------------------
Confidence            999999999999999999999                                                           


Q ss_pred             chhhhhhhcCcEEEEEeccCCCCCCchhhHhhhc-cCCCCCcceeecCCCCCCCCCCCCC---------Cc---------
Q psy15051        714 RAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQ-KIDPYTNYYVWKDGLNGKPGTPPNN---------WK---------  774 (1065)
Q Consensus       714 ~~~~~~H~~Gi~vIlDvV~NHts~~~~wf~~~~~-~~~~~~d~y~~~~~~dG~p~~~~~~---------W~---------  774 (1065)
                            |++||+||+|+|+||+|.+|+||.++.. ..++|.+||+|.+..+|.   ++++         |.         
T Consensus        89 ------h~~Gi~VilD~V~NH~s~~~~wf~~~~~~~~~~y~d~y~~~~~~~g~---~p~~~~~~f~~~~w~~~~~~~~~y  159 (558)
T 1uok_A           89 ------HERNMKLMMDLVVNHTSDEHNWFIESRKSKDNKYRDYYIWRPGKEGK---EPNNWGAAFSGSAWQYDEMTDEYY  159 (558)
T ss_dssp             ------HHTTCEEEEEECCSBCCTTSHHHHHHTTCTTCTTGGGBCEECCSSSS---CSSCBBCTTSSBSEEEETTTTEEE
T ss_pred             ------HHCCCEEEEEEecccccccchHHHHHhcCCCCCcccceEeccCcCCC---CCccccccCCCccccccCCcCcEE
Confidence                  9999999999999999999999998764 477899999998765553   2222         21         


Q ss_pred             ---------cccCCCHHHHHHHHHHHHh----------------c-----------------------------------
Q psy15051        775 ---------HINITSREVMRSQKDVVQS----------------F-----------------------------------  794 (1065)
Q Consensus       775 ---------~ln~~n~~v~~~l~~~lk~----------------~-----------------------------------  794 (1065)
                               .||+.||+|+++|.++++.                +                                   
T Consensus       160 ~~~f~~~~pdLn~~np~Vr~~i~~~~~~W~~~gvDGfRlDa~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  239 (558)
T 1uok_A          160 LHLFSKKQPDLNWDNEKVRQDVYEMMKFWLEKGIDGFRMDVINFISKEEGLPTVETEEEGYVSGHKHFMNGPNIHKYLHE  239 (558)
T ss_dssp             ECSSCTTSCBBCTTSHHHHHHHHHHHHHHHHTTCCEEEETTGGGSCCCTTCCCCCCCCSSCBCCGGGTTTCTTHHHHHHH
T ss_pred             eeccccccccccCCCHHHHHHHHHHHHHHHHcCCCEEEEccccccccccccCCCCCcccccccccccccCChHHHHHHHH
Confidence                     1999999999999998322                0                                   


Q ss_pred             -------CCceEEEeecCCCChHHHhhhccCCCCccccccccHHHHHH-------hh-cCCChHHHHHHHHHHhhcCCCC
Q psy15051        795 -------PLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNK-------FG-ATSNAKDLENVVNAYLKSLPSG  859 (1065)
Q Consensus       795 -------~~~~~ligE~~~~~~~~~~~y~~~~~~~~~d~~~~~~~~~~-------~~-~~~~~~~l~~~l~~~~~~~~~~  859 (1065)
                             .++++++||.|...+.....|.+.+ ..+++++|+|.+...       +. ...+...+...+..+....+..
T Consensus       240 ~~~~~~~~~~~~~vgE~~~~~~~~~~~y~~~~-~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~  318 (558)
T 1uok_A          240 MNEEVLSHYDIMTVGEMPGVTTEEAKLYTGEE-RKELQMVFQFEHMDLDSGEGGKWDVKPCSLLTLKENLTKWQKALEHT  318 (558)
T ss_dssp             HHHHTGGGSCCEEEEECTTCCHHHHHHHHCGG-GCSCSCEECCGGGSTTEETTEEEEECCCCHHHHHHHHHHHHHHTSSS
T ss_pred             HHHHhhccCCeEEEEeccCCCHHHHHHHhccC-CCccceEEehhhhhcccccccccccCCCCHHHHHHHHHHHHHhcccC
Confidence                   0157999999976677777777632 245788888765421       11 2345678888888777666655


Q ss_pred             CcccccccCCChhhHhhhcCHH------HHHHHHHHHHhCCCeEEEEcccccCccCCC-CccCCCCCccccccccc----
Q psy15051        860 KWSSWMVGGHSITRIATRYSPD------LVDAMNMLTLLLPGTAVTFAGDELGMESPI-LRYEDQRDPEGYIFGKD----  928 (1065)
Q Consensus       860 ~~~~~flenHD~~Rl~s~~~~~------~~kla~~ll~tlpGiP~IyyGdE~G~~~~~-~~~~~~~Dp~~~~~~~~----  928 (1065)
                      .+..+|++|||+.|+.++++.+      +++++++++|++||+|+||||||+|+.+.. ..++++.||+.++..++    
T Consensus       319 ~~~~~fl~NHD~~R~~~~~g~~~~~~~~~~k~~~~~llt~pG~P~iy~G~E~G~~~~~~~~~~~~~d~~~~~~~~~~~~~  398 (558)
T 1uok_A          319 GWNSLYWNNHDQPRVVSRFGNDGMYRIESAKMLATVLHMMKGTPYIYQGEEIGMTNVRFESIDEYRDIETLNMYKEKVME  398 (558)
T ss_dssp             SCCEECSCCTTSCCHHHHTSCSSTTHHHHHHHHHHHHHTSSSEEEEETTGGGTCCCCCCSSGGGCCCHHHHHHHHHHHHT
T ss_pred             CccceeecCCCccchhhhcCCchhhhHHHHHHHHHHHHhCCCceEEEechhcCccCCCCCCHHhhcChhhhcchhhhhhh
Confidence            6777899999999999998753      589999999999999999999999999864 23567788876553321    


Q ss_pred             ----------cccccccCCCCCcCCCCcccccCCCCCCCCCCCCCCcccccHHHhhcCCCcHHHHHHHHHHHHHhccccc
Q psy15051        929 ----------NYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVR  998 (1065)
Q Consensus       929 ----------~~~~~~rd~~R~~m~W~~~~~~gFs~~~~wl~~~~~~~~~~~~~~~~~~~~l~~~~r~Li~LRk~~paL~  998 (1065)
                                .....+||++|.||+|+...++||++++||+|++++|..+|++.|..++.+++++||+|++||+++|+|+
T Consensus       399 ~g~~~~~~~~~~~~~sRd~~R~pm~W~~~~~agFs~~~pwl~~~~~~~~~nv~~q~~~~~s~~~~y~~Li~lRk~~~~l~  478 (558)
T 1uok_A          399 RGEDIEKVMQSIYIKGRDNARTPMQWDDQNHAGFTTGEPWITVNPNYKEINVKQAIQNKDSIFYYYKKLIELRKNNEIVV  478 (558)
T ss_dssp             SCCCHHHHHHHHHHHCGGGGTSCCCCCSSTTTTSCSSCCSSCCCGGGGTSSHHHHHHCTTSHHHHHHHHHHHHHHCHHHH
T ss_pred             cCCcHHHhhhhhccccCCCCcCCccCCCcCCCCCcCCCCCCcCCccccccCHHHHhhccccHHHHHHHHHHHHccCcccc
Confidence                      1233468999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeEEEc-cCCcEEEEEEEcCCcEEEEEEECCCCcEEEEcCCCccCCCcEEEEEccCC
Q psy15051        999 MGDYKIST-PNNYVFILTRTEGSTSVYLIINLNSRTETVDLSDCIENGGDVAIFTSSVN 1056 (1065)
Q Consensus       999 ~G~~~~l~-~~~~viaf~R~~~~~~vlVv~N~s~~~~~v~l~~~~~~~~~~~v~~~s~~ 1056 (1065)
                      .|+++.+. .+++|+||.|..++++++||+|+++++++++++..... +.+++++++..
T Consensus       479 ~G~~~~~~~~~~~v~a~~R~~~~~~~lvv~N~s~~~~~~~l~~~~~~-~~~~~ll~~~~  536 (558)
T 1uok_A          479 YGSYDLILENNPSIFAYVRTYGVEKLLVIANFTAEECIFELPEDISY-SEVELLIHNYD  536 (558)
T ss_dssp             HCEEEEESTTCSSEEEEEEEETTEEEEEEEECSSSCEEEECCTTCCC-SCEEEEEESSC
T ss_pred             ccceEEeecCCCCEEEEEEEeCCcEEEEEEECCCCCEEEeccccccc-ccceEEecCCC
Confidence            99999875 45689999999999999999999999999999753211 23567777653



>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1065
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 3e-66
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 6e-09
d1m53a2478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 1e-61
d1m53a2478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 3e-08
d1lwha2391 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther 3e-47
d1lwha2391 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther 3e-05
d1wzaa2409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 9e-46
d1wzaa2409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 3e-07
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 2e-33
d1h3ga3422 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d 7e-31
d2bhua3420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 3e-29
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 3e-27
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 4e-04
d1qhoa4407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 4e-27
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 5e-27
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 2e-26
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 0.001
d1ea9c3382 c.1.8.1 (C:122-503) Maltogenic amylase, central do 3e-26
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 1e-25
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 0.001
d1ji1a3432 c.1.8.1 (A:123-554) Maltogenic amylase, central do 3e-25
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 1e-24
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 0.002
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 2e-24
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 1e-08
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 6e-06
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 3e-24
d1r7aa2434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 7e-24
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 6e-23
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 0.002
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 5e-22
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 7e-22
d1g5aa2554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 7e-22
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 5e-21
d1bf2a3475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 5e-21
d1bf2a3475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 2e-04
d2fhfa5563 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p 1e-20
d2fhfa5563 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p 2e-13
d2fhfa5563 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p 5e-04
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 1e-19
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 2e-19
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 1e-09
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 2e-16
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 4e-16
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 1e-14
d1g94a2354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 3e-09
d1hx0a2403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 3e-08
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 1e-07
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Oligo-1,6, glucosidase
species: Bacillus cereus [TaxId: 1396]
 Score =  229 bits (583), Expect = 3e-66
 Identities = 120/486 (24%), Positives = 197/486 (40%), Gaps = 63/486 (12%)

Query: 553 QKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVE 612
           +K+WWK +V+YQI   SF DSN DGIGDLRG               II K+DYLKELG++
Sbjct: 2   EKQWWKESVVYQIYPRSFMDSNGDGIGDLRG---------------IISKLDYLKELGID 46

Query: 613 TLWLTPFYSGPNGDIGYDISNHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSH 672
            +WL+P Y  PN D GYDIS++ ++  +FGTMED+DEL+  +H +  + +      + S 
Sbjct: 47  VIWLSPVYESPNDDNGYDISDYCKIMNEFGTMEDWDELLHEMHERNMKLMMDLVVNHTSD 106

Query: 673 QLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQNRAESMEHRAGMKILVEFVP 732
           +    +       +K+  + ++  P   G    NW A     A   +       L  F  
Sbjct: 107 EHNWFIESRKSKDNKYRDYYIW-RPGKEGKEPNNWGAAFSGSAWQYDEMTDEYYLHLFSK 165

Query: 733 NHS--------------SNKHDWFIKSAQKIDPYTNYYVWKDGLNGKPGTPPNNWKHINI 778
                                 W  K           ++ K+       T    +   + 
Sbjct: 166 KQPDLNWDNEKVRQDVYEMMKFWLEKGIDGFRMDVINFISKEEGLPTVETEEEGYVSGHK 225

Query: 779 TSREVMRSQKDVVQSFPLIL-----MIITEAYSPSLEKVAKYYGTGDT------QGTHLS 827
                    K + +    +L     M + E    + E+   Y G          Q  H+ 
Sbjct: 226 HFMNGPNIHKYLHEMNEEVLSHYDIMTVGEMPGVTTEEAKLYTGEERKELQMVFQFEHMD 285

Query: 828 VNYEIMNKFGATS-NAKDLENVVNAYLKSLPSGKWSSWMVGGHSITRIATRYSPD----- 881
           ++     K+     +   L+  +  + K+L    W+S     H   R+ +R+  D     
Sbjct: 286 LDSGEGGKWDVKPCSLLTLKENLTKWQKALEHTGWNSLYWNNHDQPRVVSRFGNDGMYRI 345

Query: 882 -LVDAMNMLTLLLPGTAVTFAGDELGMES-PILRYEDQRDPEGYIFGKDNYLK------- 932
                +  +  ++ GT   + G+E+GM +      ++ RD E     K+  ++       
Sbjct: 346 ESAKMLATVLHMMKGTPYIYQGEEIGMTNVRFESIDEYRDIETLNMYKEKVMERGEDIEK 405

Query: 933 -------VCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYK 985
                    RD +R P QW+DQ +AGF+  + W+ V+PNY  +N +   + K S +  YK
Sbjct: 406 VMQSIYIKGRDNARTPMQWDDQNHAGFTTGEPWITVNPNYKEINVKQAIQNKDSIFYYYK 465

Query: 986 DLTTLR 991
            L  LR
Sbjct: 466 KLIELR 471


>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1065
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 100.0
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 100.0
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 100.0
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 100.0
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.97
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.97
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 99.97
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 99.97
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.97
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.96
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 99.96
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 99.96
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.96
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.95
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.95
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.95
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.94
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 99.94
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.94
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.94
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 99.93
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.91
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.9
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.88
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.87
d1iv8a2653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.8
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.74
d1uoka179 Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 139 97.62
d1wzla283 Maltogenic amylase {Thermoactinomyces vulgaris, TV 97.51
d1m53a178 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 97.47
d1j0ha283 Neopullulanase {Bacillus stearothermophilus [TaxId 97.38
d1ea9c280 Maltogenic amylase {Bacillus sp., cyclomaltodextri 97.21
d1ji1a283 Maltogenic amylase {Thermoactinomyces vulgaris, TV 96.79
d1m7xa2106 1,4-alpha-glucan branching enzyme {Escherichia col 96.25
d1g5aa174 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 94.81
d3bmva389 Cyclodextrin glycosyltransferase {Thermoanaerobact 94.3
d1h3ga283 Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId 93.67
d1cxla390 Cyclodextrin glycosyltransferase {Bacillus circula 93.66
d1cyga389 Cyclodextrin glycosyltransferase {Bacillus stearot 93.57
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 92.7
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 91.03
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 90.94
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 90.65
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 90.59
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 90.41
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 89.77
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 88.67
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 88.55
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 88.4
d1wzaa179 Bacterial alpha-Amylase {Halothermothrix orenii [T 88.11
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 87.73
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 86.72
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 86.58
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 84.61
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 84.19
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 84.07
d1eswa_500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 83.84
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 83.27
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 82.98
d1nowa1353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 82.88
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 81.35
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 81.21
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Isomaltulose synthase PalI
species: Klebsiella sp., lx3 [TaxId: 576]
Probab=100.00  E-value=1.9e-57  Score=537.34  Aligned_cols=362  Identities=33%  Similarity=0.671  Sum_probs=290.8

Q ss_pred             ChhhcccceEEEEecccccCcCCCCCCCCCCcccchhhhcccccccHHhhhHHHHHcCcCEEEeCCCCcCCCCCCCCcCC
Q psy15051        553 QKEWWKNTVIYQILVPSFKDSNNDGIGDLRGKNVRKRYLELTLGLGIIEKIDYLKELGVETLWLTPFYSGPNGDIGYDIS  632 (1065)
Q Consensus       553 ~~~ww~~~vIYei~v~~F~d~~~d~~Gdl~g~~~~~~~~~~t~~~Gl~~kLdYLk~LGvnaI~L~PI~~~~~~~~GY~~~  632 (1065)
                      .|+||+++|||||||++|++++++++|||+               ||++||||||+||||+||||||++++..+|||++.
T Consensus         2 ~P~W~~~~viYei~~~~F~d~~~~~~Gd~~---------------Gi~~kLdyLk~LGv~~I~L~Pi~~~~~~~~GY~~~   66 (478)
T d1m53a2           2 YPAWWKEAVFYQIYPRSFKDTNDDGIGDIR---------------GIIEKLDYLKSLGIDAIWINPHYDSPNTDNGYDIS   66 (478)
T ss_dssp             CCCHHHHCCEEEECGGGTCCSSSSSSCCHH---------------HHHHTHHHHHHHTCCEEEECCCEECCCTTTTSSCS
T ss_pred             CCcccccCeEEEEecchhcCCCCCCccCHH---------------HHHHhhHHHHHcCCCEEEECCCCCCCCCCCCcCcc
Confidence            489999999999999999999999999999               99999999999999999999999999888999999


Q ss_pred             CCcccCCCCCCHHHHHHHHHHHHhcCCceeecccccccccccccchhhhhhccccccccccccCccccCCCCCCCccCcc
Q psy15051        633 NHTEVGKDFGTMEDFDELVKLVHSKGKQKISQKQTKNRSHQLYCHMYMYAICADKFAIHSVYLNPVYAGSGNQNWRAGNQ  712 (1065)
Q Consensus       633 dy~~idp~~Gt~edfk~LV~~aH~~Gi~VIlDvv~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~  712 (1065)
                      ||++|||+|||++|||+||++|                                                          
T Consensus        67 d~~~vd~~~Gt~~df~~Lv~~a----------------------------------------------------------   88 (478)
T d1m53a2          67 NYRQIMKEYGTMEDFDSLVAEM----------------------------------------------------------   88 (478)
T ss_dssp             EEEEECGGGCCHHHHHHHHHHH----------------------------------------------------------
T ss_pred             CCCCcCcccCCHHHHHHHHHHH----------------------------------------------------------
Confidence            9999999999999999999999                                                          


Q ss_pred             cchhhhhhhcCcEEEEEeccCCCCCCchhhHhhhcc-CCCCCcceeecCCCCCCCCCCCCCCc-----------------
Q psy15051        713 NRAESMEHRAGMKILVEFVPNHSSNKHDWFIKSAQK-IDPYTNYYVWKDGLNGKPGTPPNNWK-----------------  774 (1065)
Q Consensus       713 ~~~~~~~H~~Gi~vIlDvV~NHts~~~~wf~~~~~~-~~~~~d~y~~~~~~dG~p~~~~~~W~-----------------  774 (1065)
                             |++||+||||+|+||++.+|+||...... ..++.++|.+.++....   ++.+|.                 
T Consensus        89 -------H~~Gi~VilD~V~NH~~~~~~~f~~~~~~~~~~~~~~~~~~d~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  158 (478)
T d1m53a2          89 -------KKRNMRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGKDNQ---PPNNYPSFFGGSAWQKDAKSGQY  158 (478)
T ss_dssp             -------HHTTCEEEEEECCSBCCTTSHHHHHHHHCTTCTTGGGBCEECCSSSS---CSSCCBCTTSSBSEEECTTTCCE
T ss_pred             -------HHCCCEEEeccccccccccCchhhhcccCCCCCccccccccCCCcCC---CCccccccCCCCccccccccCcc
Confidence                   99999999999999999999999887654 66788888877654221   111110                 


Q ss_pred             ----------cccCCCHHHHHHHHHHHHh----------------c----------------------------------
Q psy15051        775 ----------HINITSREVMRSQKDVVQS----------------F----------------------------------  794 (1065)
Q Consensus       775 ----------~ln~~n~~v~~~l~~~lk~----------------~----------------------------------  794 (1065)
                                .+|+.+++|+++|.++++.                +                                  
T Consensus       159 ~~~~~~~~~~dln~~~~~V~~~i~~~~~~w~e~gvDGfR~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (478)
T d1m53a2         159 YLHYFARQQPDLNWDNPKVREDLYAMLRFWLDKGVSGMRFDTVATYSKIPGFPNLTPEQQKNFAEQYTMGPNIHRYIQEM  238 (478)
T ss_dssp             EECSSCTTCCBBCTTSHHHHHHHHHHHHHHHTTTCCEEEETTGGGSSCCTTCCCCCHHHHHTHHHHTTCCTTHHHHHHHH
T ss_pred             cccCcCCCCCcccchhHHHHHHHHHHHHHHHhcCCceeccccceeecccccccccchhhhhccchhhccchhHHHHHHHH
Confidence                      0899999999999998321                0                                  


Q ss_pred             ------CCceEEEeecCCCChHHHhhhccCCCCccccccccHHHHHHh--------hcCCChHHHHHHHHHHhhcCCCCC
Q psy15051        795 ------PLILMIITEAYSPSLEKVAKYYGTGDTQGTHLSVNYEIMNKF--------GATSNAKDLENVVNAYLKSLPSGK  860 (1065)
Q Consensus       795 ------~~~~~ligE~~~~~~~~~~~y~~~~~~~~~d~~~~~~~~~~~--------~~~~~~~~l~~~l~~~~~~~~~~~  860 (1065)
                            .++.+++||.+.........+.... ...++..+++.+....        ........+...+.......+...
T Consensus       239 ~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (478)
T d1m53a2         239 NRKVLSRYDVATAGEIFGVPLDRSSQFFDRR-RHELNMAFMFDLIRLDRDSNERWRHKSWSLSQFRQIISKMDVTVGKYG  317 (478)
T ss_dssp             HHHTGGGSCCEEEEECTTCCGGGTHHHHCGG-GCSCSEEECCTTTTTTBCSSCTTCBCCCCHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHhhccccceeeeecCCCHHHHHhhhccc-CCccccccchhhhhhhhhhhhhhccccccHHHHHHHHHHHHhhhcccc
Confidence                  1257889999987555444444322 2344555555544322        123456677777777666667777


Q ss_pred             cccccccCCChhhHhhhcCH-------HHHHHHHHHHHhCCCeEEEEcccccCccCCC-CccCCCCCcccccccc-----
Q psy15051        861 WSSWMVGGHSITRIATRYSP-------DLVDAMNMLTLLLPGTAVTFAGDELGMESPI-LRYEDQRDPEGYIFGK-----  927 (1065)
Q Consensus       861 ~~~~flenHD~~Rl~s~~~~-------~~~kla~~ll~tlpGiP~IyyGdE~G~~~~~-~~~~~~~Dp~~~~~~~-----  927 (1065)
                      +..++++|||+.|+.+.++.       .+.+++++++||+||+||||||||+||.+.. ...++..|++..+...     
T Consensus       318 ~~~~~~~nhd~~R~~~~~~~~~~~~~~~~~~~~~~lllt~pGiP~iyyGdEiG~~~~~~~~~~~~~d~~~~~~~~~~~~~  397 (478)
T d1m53a2         318 WNTFFLDNHDNPRAVSHFGDDRPQWREASAKALATITLTQRATPFIYQGSELGMTNYPFRQLNEFDDIEVKGFWQDYVQS  397 (478)
T ss_dssp             CBEECSCCTTSCCHHHHHSCCSTTTHHHHHHHHHHHHTSSSSEEEEETTTTTTCCCCCCCSGGGCCCHHHHHHHHHHTTT
T ss_pred             cceeeccCCCCcccccccCCchHHHHHHHHHHHHHHHHhCCCCCEEecccccCCcCCCcccccccCChhhhhhhHHHHhc
Confidence            77889999999999998763       3577888999999999999999999998754 2233444544222111     


Q ss_pred             ---------ccccccccCCCCCcCCCCcccccCCCCCCCCCCCCCCcccccHHHhhcCCCcHHHHHHHHHHHHHhccccc
Q psy15051        928 ---------DNYLKVCRDGSRVPFQWNDQENAGFSKAKSWLPVHPNYWTLNAQAEKKTKPSHYSVYKDLTTLRATSGAVR  998 (1065)
Q Consensus       928 ---------~~~~~~~rd~~R~~m~W~~~~~~gFs~~~~wl~~~~~~~~~~~~~~~~~~~~l~~~~r~Li~LRk~~paL~  998 (1065)
                               +.....+||++|.||+|++..++|||.++||+++++++..+|++.|...+.+++++||+||+|||++|||.
T Consensus       398 ~~~~~~~~~~~~~~~~rd~~R~Pm~W~~~~~~GFs~~~~wl~~~~~~~~~nv~~q~~~~~S~l~~yr~Li~lRk~~paL~  477 (478)
T d1m53a2         398 GKVTATEFLDNVRLTSRDNSRTPFQWNDTLNAGFTRGKPWFHINPNYVEINAEREETREDSVLNYYKKMIQLRHHIPALV  477 (478)
T ss_dssp             TSSCHHHHHHHHHHHCGGGGCSCCCCSSSGGGGSCSSCCSSCCCGGGGTSCHHHHHHCTTSHHHHHHHHHHHHHHCHHHH
T ss_pred             ccCchHHHHhhccccCCCCCCCCCCCCCCCCCCCCCCCcCCcCCcchhhhhHHHHhhCcccHHHHHHHHHHHHhhCchhc
Confidence                     12234568999999999999999999999999999999999999999999999999999999999999984



>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1uoka1 b.71.1.1 (A:480-558) Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wzla2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1m53a1 b.71.1.1 (A:521-598) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1j0ha2 b.71.1.1 (A:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ea9c2 b.71.1.1 (C:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1ji1a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1m7xa2 b.71.1.1 (A:623-728) 1,4-alpha-glucan branching enzyme {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g5aa1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d3bmva3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1h3ga2 b.71.1.1 (A:518-600) Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1cxla3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} Back     information, alignment and structure
>d1cyga3 b.71.1.1 (A:403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1wzaa1 b.71.1.1 (A:437-515) Bacterial alpha-Amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure