Psyllid ID: psy1520
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 328702417 | 872 | PREDICTED: probable leucyl-tRNA syntheta | 0.813 | 0.099 | 0.609 | 2e-25 | |
| 380021102 | 840 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.757 | 0.096 | 0.629 | 2e-25 | |
| 307178944 | 811 | Probable leucyl-tRNA synthetase, mitocho | 0.766 | 0.101 | 0.609 | 7e-25 | |
| 91078378 | 866 | PREDICTED: similar to Leucyl-tRNA synthe | 0.757 | 0.093 | 0.629 | 1e-24 | |
| 328782776 | 866 | PREDICTED: probable leucyl-tRNA syntheta | 0.757 | 0.093 | 0.617 | 2e-24 | |
| 350398130 | 878 | PREDICTED: probable leucyl-tRNA syntheta | 0.757 | 0.092 | 0.629 | 3e-24 | |
| 332020719 | 745 | Putative leucyl-tRNA synthetase, mitocho | 0.794 | 0.114 | 0.564 | 3e-24 | |
| 443721981 | 892 | hypothetical protein CAPTEDRAFT_228464 [ | 0.700 | 0.084 | 0.653 | 4e-24 | |
| 347967008 | 860 | AGAP002014-PA [Anopheles gambiae str. PE | 0.757 | 0.094 | 0.604 | 6e-24 | |
| 357628256 | 873 | leucyl-tRNA synthetase [Danaus plexippus | 0.794 | 0.097 | 0.6 | 7e-24 |
| >gi|328702417|ref|XP_003241894.1| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 119 bits (298), Expect = 2e-25, Method: Compositional matrix adjust.
Identities = 53/87 (60%), Positives = 65/87 (74%)
Query: 20 NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
N+ F+ A +PVDIY+GGKEHAVLHLYYARF HFLH+ G +P EPFK+LLVQG
Sbjct: 487 NSSQPFDNMLANKMMPVDIYVGGKEHAVLHLYYARFFNHFLHSIGLSPCLEPFKKLLVQG 546
Query: 80 MIMGQTYREKTSGKYLKPDEVFTKGST 106
M+MGQ+++ K +G YLK DEV KG T
Sbjct: 547 MVMGQSFKNKINGTYLKEDEVIKKGKT 573
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380021102|ref|XP_003694413.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine--tRNA ligase, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307178944|gb|EFN67462.1| Probable leucyl-tRNA synthetase, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|91078378|ref|XP_974191.1| PREDICTED: similar to Leucyl-tRNA synthetase CG7479-PA [Tribolium castaneum] gi|270003885|gb|EFA00333.1| hypothetical protein TcasGA2_TC003172 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328782776|ref|XP_624911.2| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like isoform 2 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350398130|ref|XP_003485096.1| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332020719|gb|EGI61124.1| Putative leucyl-tRNA synthetase, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|443721981|gb|ELU11054.1| hypothetical protein CAPTEDRAFT_228464 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|347967008|ref|XP_321043.4| AGAP002014-PA [Anopheles gambiae str. PEST] gi|333469800|gb|EAA01232.5| AGAP002014-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|357628256|gb|EHJ77646.1| leucyl-tRNA synthetase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| FB|FBgn0027085 | 869 | Aats-leu "Leucyl-tRNA syntheta | 0.757 | 0.093 | 0.617 | 2.7e-22 | |
| UNIPROTKB|I3LI93 | 284 | I3LI93 "Uncharacterized protei | 0.794 | 0.299 | 0.558 | 2.4e-21 | |
| ZFIN|ZDB-GENE-070928-3 | 891 | lars2 "leucyl-tRNA synthetase | 0.728 | 0.087 | 0.569 | 9e-21 | |
| UNIPROTKB|E1BXI7 | 906 | LARS2 "Uncharacterized protein | 0.803 | 0.094 | 0.545 | 9.2e-21 | |
| UNIPROTKB|E9PHM2 | 860 | LARS2 "Probable leucine--tRNA | 0.794 | 0.098 | 0.569 | 2.3e-20 | |
| UNIPROTKB|E2RQR3 | 903 | LARS2 "Uncharacterized protein | 0.794 | 0.094 | 0.569 | 2.5e-20 | |
| UNIPROTKB|Q15031 | 903 | LARS2 "Probable leucine--tRNA | 0.794 | 0.094 | 0.569 | 2.5e-20 | |
| UNIPROTKB|F1SNZ5 | 702 | LARS2 "Uncharacterized protein | 0.794 | 0.121 | 0.558 | 2.6e-20 | |
| UNIPROTKB|E1B768 | 903 | LARS2 "Uncharacterized protein | 0.794 | 0.094 | 0.546 | 1.1e-19 | |
| MGI|MGI:2142973 | 902 | Lars2 "leucyl-tRNA synthetase, | 0.766 | 0.090 | 0.535 | 1.3e-18 |
| FB|FBgn0027085 Aats-leu "Leucyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 270 (100.1 bits), Expect = 2.7e-22, P = 2.7e-22
Identities = 50/81 (61%), Positives = 64/81 (79%)
Query: 20 NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
N+E F+T + ++PVD+YIGGKEHAVLHLYYARFI HFLH+ G +P EPF RLLVQG
Sbjct: 480 NSERIFDTALTKKFMPVDLYIGGKEHAVLHLYYARFINHFLHSCGLSPTSEPFSRLLVQG 539
Query: 80 MIMGQTYREKTSGKYLKPDEV 100
M+MG+++R K SG+Y+ EV
Sbjct: 540 MVMGRSFRVKGSGRYVPETEV 560
|
|
| UNIPROTKB|I3LI93 I3LI93 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070928-3 lars2 "leucyl-tRNA synthetase 2, mitochondrial" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BXI7 LARS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PHM2 LARS2 "Probable leucine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RQR3 LARS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15031 LARS2 "Probable leucine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SNZ5 LARS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B768 LARS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2142973 Lars2 "leucyl-tRNA synthetase, mitochondrial" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| PRK00390 | 805 | PRK00390, leuS, leucyl-tRNA synthetase; Validated | 1e-26 | |
| TIGR00396 | 842 | TIGR00396, leuS_bact, leucyl-tRNA synthetase, euba | 4e-25 | |
| cd00812 | 314 | cd00812, LeuRS_core, catalytic core domain of leuc | 5e-22 | |
| COG0495 | 814 | COG0495, LeuS, Leucyl-tRNA synthetase [Translation | 6e-22 | |
| PLN02563 | 963 | PLN02563, PLN02563, aminoacyl-tRNA ligase | 1e-20 |
| >gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
Score = 101 bits (255), Expect = 1e-26
Identities = 35/62 (56%), Positives = 40/62 (64%)
Query: 20 NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
N E F+ + A WLPVD YIGG EHAVLHL YARF L G + EPFK+LL QG
Sbjct: 508 NDEAPFDKEAANYWLPVDQYIGGIEHAVLHLLYARFFTKVLRDLGLVSSDEPFKKLLTQG 567
Query: 80 MI 81
M+
Sbjct: 568 MV 569
|
Length = 805 |
| >gnl|CDD|232956 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family | Back alignment and domain information |
|---|
| >gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| KOG0435|consensus | 876 | 100.0 | ||
| COG0495 | 814 | LeuS Leucyl-tRNA synthetase [Translation, ribosoma | 100.0 | |
| PLN02563 | 963 | aminoacyl-tRNA ligase | 99.97 | |
| TIGR00396 | 842 | leuS_bact leucyl-tRNA synthetase, eubacterial and | 99.96 | |
| PRK00390 | 805 | leuS leucyl-tRNA synthetase; Validated | 99.93 | |
| PF00133 | 601 | tRNA-synt_1: tRNA synthetases class I (I, L, M and | 99.47 | |
| cd00812 | 314 | LeuRS_core catalytic core domain of leucyl-tRNA sy | 99.37 | |
| PRK12300 | 897 | leuS leucyl-tRNA synthetase; Reviewed | 99.34 | |
| PLN02959 | 1084 | aminoacyl-tRNA ligase | 99.32 | |
| PTZ00419 | 995 | valyl-tRNA synthetase-like protein; Provisional | 99.26 | |
| PLN02381 | 1066 | valyl-tRNA synthetase | 99.25 | |
| PRK13208 | 800 | valS valyl-tRNA synthetase; Reviewed | 99.22 | |
| TIGR00392 | 861 | ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA | 99.22 | |
| PRK05743 | 912 | ileS isoleucyl-tRNA synthetase; Reviewed | 99.21 | |
| PRK14900 | 1052 | valS valyl-tRNA synthetase; Provisional | 99.1 | |
| TIGR00395 | 938 | leuS_arch leucyl-tRNA synthetase, archaeal and cyt | 99.06 | |
| PRK06039 | 975 | ileS isoleucyl-tRNA synthetase; Reviewed | 99.05 | |
| PTZ00427 | 1205 | isoleucine-tRNA ligase, putative; Provisional | 98.81 | |
| PRK13804 | 961 | ileS isoleucyl-tRNA synthetase; Provisional | 98.79 | |
| cd00817 | 382 | ValRS_core catalytic core domain of valyl-tRNA syn | 98.73 | |
| TIGR00422 | 861 | valS valyl-tRNA synthetase. The valyl-tRNA synthet | 98.72 | |
| PRK05729 | 874 | valS valyl-tRNA synthetase; Reviewed | 98.71 | |
| cd00668 | 312 | Ile_Leu_Val_MetRS_core catalytic core domain of is | 98.67 | |
| PLN02943 | 958 | aminoacyl-tRNA ligase | 98.6 | |
| COG0060 | 933 | IleS Isoleucyl-tRNA synthetase [Translation, ribos | 98.56 | |
| PLN02882 | 1159 | aminoacyl-tRNA ligase | 98.51 | |
| PLN02843 | 974 | isoleucyl-tRNA synthetase | 98.5 | |
| cd00818 | 338 | IleRS_core catalytic core domain of isoleucyl-tRNA | 98.44 | |
| KOG0433|consensus | 937 | 98.29 | ||
| PRK11893 | 511 | methionyl-tRNA synthetase; Reviewed | 98.27 | |
| PRK12267 | 648 | methionyl-tRNA synthetase; Reviewed | 98.03 | |
| TIGR00398 | 530 | metG methionyl-tRNA synthetase. The methionyl-tRNA | 97.99 | |
| cd00814 | 319 | MetRS_core catalytic core domain of methioninyl-tR | 97.79 | |
| cd00672 | 213 | CysRS_core catalytic core domain of cysteinyl tRNA | 97.74 | |
| TIGR00435 | 465 | cysS cysteinyl-tRNA synthetase. This model finds t | 97.51 | |
| PRK12268 | 556 | methionyl-tRNA synthetase; Reviewed | 97.45 | |
| PRK00260 | 463 | cysS cysteinyl-tRNA synthetase; Validated | 97.39 | |
| COG0525 | 877 | ValS Valyl-tRNA synthetase [Translation, ribosomal | 97.34 | |
| PRK12418 | 384 | cysteinyl-tRNA synthetase; Provisional | 97.28 | |
| PRK00133 | 673 | metG methionyl-tRNA synthetase; Reviewed | 97.02 | |
| TIGR03447 | 411 | mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- | 96.97 | |
| PLN02224 | 616 | methionine-tRNA ligase | 96.95 | |
| KOG0432|consensus | 995 | 96.32 | ||
| PRK00750 | 510 | lysK lysyl-tRNA synthetase; Reviewed | 96.19 | |
| PTZ00399 | 651 | cysteinyl-tRNA-synthetase; Provisional | 96.14 | |
| PF09334 | 391 | tRNA-synt_1g: tRNA synthetases class I (M); InterP | 94.95 | |
| cd00674 | 353 | LysRS_core_class_I catalytic core domain of class | 94.92 | |
| PRK01611 | 507 | argS arginyl-tRNA synthetase; Reviewed | 94.9 | |
| TIGR00456 | 566 | argS arginyl-tRNA synthetase. This model recognize | 94.26 | |
| KOG0437|consensus | 1080 | 94.21 | ||
| PF01406 | 300 | tRNA-synt_1e: tRNA synthetases class I (C) catalyt | 94.04 | |
| PRK14536 | 490 | cysS cysteinyl-tRNA synthetase; Provisional | 93.81 | |
| COG0143 | 558 | MetG Methionyl-tRNA synthetase [Translation, ribos | 93.22 | |
| PRK14534 | 481 | cysS cysteinyl-tRNA synthetase; Provisional | 93.15 | |
| PLN02946 | 557 | cysteine-tRNA ligase | 92.71 | |
| KOG0436|consensus | 578 | 90.05 | ||
| KOG0434|consensus | 1070 | 90.05 | ||
| PLN02610 | 801 | probable methionyl-tRNA synthetase | 89.73 | |
| PF00750 | 354 | tRNA-synt_1d: tRNA synthetases class I (R); InterP | 86.68 | |
| PRK14535 | 699 | cysS cysteinyl-tRNA synthetase; Provisional | 86.56 | |
| cd00802 | 143 | class_I_aaRS_core catalytic core domain of class I | 83.2 | |
| PRK12451 | 562 | arginyl-tRNA synthetase; Reviewed | 81.9 | |
| PF10910 | 125 | DUF2744: Protein of unknown function (DUF2744); In | 81.82 |
| >KOG0435|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-38 Score=279.20 Aligned_cols=92 Identities=52% Similarity=0.859 Sum_probs=89.0
Q ss_pred cccCCCCCCCCCChhhhcccccceEEeecchhHHHHHHHHHHHHHHHHhcCCCCCCCccccccccceeecCeeeecCCCc
Q psy1520 14 TKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGK 93 (107)
Q Consensus 14 ~~~dp~n~~~~fd~~~~~~WmPVD~YIGGiEHAilHLLYaRF~~K~L~D~G~v~~~EPF~~Ll~QGMV~~~~~k~ks~Gn 93 (107)
.|+||+|...|||++.+.+|||||+||||+|||||||||||||+|||+|+|++++.|||++|++||||+|++|+.++.|+
T Consensus 506 RylDpkN~e~~~d~a~a~k~MPVDvYIGG~EHAvlHLlYaRF~~kFl~di~~~~t~EPF~~Li~QGmV~G~tf~~~~sG~ 585 (876)
T KOG0435|consen 506 RYLDPKNPEEPFDKAKAKKNMPVDVYIGGKEHAVLHLLYARFIAKFLKDIGVVSTAEPFTKLITQGMVRGKTFRTKESGK 585 (876)
T ss_pred eecCCCCcccccchhhhhccCceeEEeccHHHHHHHHHHHHHHHHHHhhcCCCcCCCcHHHHHhhhcccceEEecCCCCc
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeCCCceeecCC
Q psy1520 94 YLKPDEVFTKGS 105 (107)
Q Consensus 94 ~v~p~ev~~~~~ 105 (107)
||.|+||...|+
T Consensus 586 yl~~~ev~~~nd 597 (876)
T KOG0435|consen 586 YLGPEEVQQVND 597 (876)
T ss_pred cCCHHHhhhhcC
Confidence 999999987765
|
|
| >COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02563 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family | Back alignment and domain information |
|---|
| >PRK00390 leuS leucyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >PRK12300 leuS leucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02959 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PTZ00419 valyl-tRNA synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02381 valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK13208 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00392 ileS isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK14900 valS valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family | Back alignment and domain information |
|---|
| >PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00427 isoleucine-tRNA ligase, putative; Provisional | Back alignment and domain information |
|---|
| >PRK13804 ileS isoleucyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases | Back alignment and domain information |
|---|
| >TIGR00422 valS valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK05729 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases | Back alignment and domain information |
|---|
| >PLN02943 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02882 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PLN02843 isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >KOG0433|consensus | Back alignment and domain information |
|---|
| >PRK11893 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12267 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00398 metG methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00435 cysS cysteinyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12268 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK00260 cysS cysteinyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12418 cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00133 metG methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase | Back alignment and domain information |
|---|
| >PLN02224 methionine-tRNA ligase | Back alignment and domain information |
|---|
| >KOG0432|consensus | Back alignment and domain information |
|---|
| >PRK00750 lysK lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00399 cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase | Back alignment and domain information |
|---|
| >PRK01611 argS arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00456 argS arginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG0437|consensus | Back alignment and domain information |
|---|
| >PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK14536 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14534 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02946 cysteine-tRNA ligase | Back alignment and domain information |
|---|
| >KOG0436|consensus | Back alignment and domain information |
|---|
| >KOG0434|consensus | Back alignment and domain information |
|---|
| >PLN02610 probable methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK14535 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12451 arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF10910 DUF2744: Protein of unknown function (DUF2744); InterPro: IPR021226 This entry is represented by Mycobacteriophage D29, Gp29 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 107 | ||||
| 3ziu_A | 637 | Crystal Structure Of Mycoplasma Mobile Leucyl-trna | 3e-16 | ||
| 2v0c_A | 878 | Leucyl-Trna Synthetase From Thermus Thermophilus Co | 2e-15 | ||
| 1obh_A | 878 | Leucyl-Trna Synthetase From Thermus Thermophilus Co | 2e-15 | ||
| 4aq7_A | 880 | Ternary Complex Of E. Coli Leucyl-Trna Synthetase, | 1e-12 |
| >pdb|3ZIU|A Chain A, Crystal Structure Of Mycoplasma Mobile Leucyl-trna Synthetase With Leu-ams In The Active Site Length = 637 | Back alignment and structure |
|
| >pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 | Back alignment and structure |
| >pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 | Back alignment and structure |
| >pdb|4AQ7|A Chain A, Ternary Complex Of E. Coli Leucyl-Trna Synthetase, Trna(Leu) And Leucyl-Adenylate Analogue In The Aminoacylation Conformation Length = 880 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| 4arc_A | 880 | Leucine--tRNA ligase; ligase-RNA complex, nucleoti | 5e-31 | |
| 2v0c_A | 878 | Aminoacyl-tRNA synthetase; ligase, nucleotide-bind | 3e-29 | |
| 1wkb_A | 810 | Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e | 2e-17 | |
| 1wz2_A | 967 | Leucyl-tRNA synthetase; ligase, riken structural g | 2e-09 |
| >4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 | Back alignment and structure |
|---|
Score = 113 bits (286), Expect = 5e-31
Identities = 31/87 (35%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
Query: 20 NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
E +++ A WLPVDIYIGG EHA++HL Y RF + G + EP K+LL QG
Sbjct: 528 YKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQG 587
Query: 80 MIMGQTYR---EKTSGKYLKPDEVFTK 103
M++ + E ++ P + +
Sbjct: 588 MVLADAFYYVGENGERNWVSPVDAIVE 614
|
| >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 | Back alignment and structure |
|---|
| >1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 | Back alignment and structure |
|---|
| >1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| 4arc_A | 880 | Leucine--tRNA ligase; ligase-RNA complex, nucleoti | 100.0 | |
| 2v0c_A | 878 | Aminoacyl-tRNA synthetase; ligase, nucleotide-bind | 99.96 | |
| 1wkb_A | 810 | Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e | 99.4 | |
| 1wz2_A | 967 | Leucyl-tRNA synthetase; ligase, riken structural g | 99.38 | |
| 1gax_A | 862 | Valrs, valyl-tRNA synthetase; protein-RNA complex, | 99.25 | |
| 1ile_A | 821 | Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s | 99.22 | |
| 2d5b_A | 500 | Methionyl-tRNA synthetase; rossmann fold, class 1A | 99.12 | |
| 2csx_A | 497 | Methionyl-tRNA synthetase; ligase, riken structura | 99.08 | |
| 1ffy_A | 917 | Isoleucyl-tRNA synthetase; protein-RNA complex, me | 99.07 | |
| 2x1l_A | 524 | Methionyl-tRNA synthetase; nucleotide-binding, pro | 99.05 | |
| 3c8z_A | 414 | Cysteinyl-tRNA synthetase; cysteine ligase, rossma | 98.82 | |
| 4dlp_A | 536 | Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA | 98.72 | |
| 3kfl_A | 564 | Methionyl-tRNA synthetase; parasite, aminoacyl-tRN | 98.65 | |
| 3u1f_A | 542 | Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta | 98.65 | |
| 3h99_A | 560 | Methionyl-tRNA synthetase; rossmann fold, aminoacy | 98.61 | |
| 3sp1_A | 501 | Cysteinyl-tRNA synthetase; structural genomics, se | 98.3 | |
| 1rqg_A | 722 | Methionyl-tRNA synthetase; translation, dimerizati | 97.78 | |
| 1li5_A | 461 | Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys | 97.61 | |
| 3tqo_A | 462 | Cysteinyl-tRNA synthetase; protein synthesis, liga | 97.09 | |
| 3fnr_A | 464 | Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX | 96.48 | |
| 1irx_A | 523 | Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin | 95.37 | |
| 1iq0_A | 592 | Arginyl-tRNA synthetase; riken structural genomics | 93.05 | |
| 2zue_A | 629 | Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase | 92.95 | |
| 2cyb_A | 323 | Tyrosyl-tRNA synthetase; rossmann-fold, structural | 85.63 | |
| 1f7u_A | 607 | Arginyl-tRNA synthetase; RNA-protein complex, amin | 84.95 |
| >4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-34 Score=256.51 Aligned_cols=91 Identities=34% Similarity=0.664 Sum_probs=84.9
Q ss_pred ccccCCCCCCCCCChhhhcccccceEEeecchhHHHHHHHHHHHHHHHHhcCCCCCCCccccccccceeecCee------
Q psy1520 13 KTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTY------ 86 (107)
Q Consensus 13 ~~~~dp~n~~~~fd~~~~~~WmPVD~YIGGiEHAilHLLYaRF~~K~L~D~G~v~~~EPF~~Ll~QGMV~~~~~------ 86 (107)
-+|+||+|++++||++++++|||||+||||+||||+||||||||+++|+|+|+++.+|||++|++||||+++++
T Consensus 521 ~r~~~p~~~~~~~~~~~~~~~~PvD~yigG~EHailHllyaRf~~~~L~~~g~~~~~ePFk~ll~qGmVl~~~~~~~d~~ 600 (880)
T 4arc_A 521 ARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYYVGEN 600 (880)
T ss_dssp HHTTSTTCCSSSCCHHHHHHHCSEEEEECCGGGTTTHHHHHHHHHHHHHHTTSCCCSCSEEEEECCCCEEEEEEEEECTT
T ss_pred HhhcCCCccccccChHHHhccCCceEeecchhhHHHHHHHHHHHHHHHHHhhcccCCCChHHeEEeceEeecceeccccC
Confidence 35789999999999999999999999999999999999999999999999999999999999999999986655
Q ss_pred --------------------------------------ee-cCCCceeCCCceeec
Q psy1520 87 --------------------------------------RE-KTSGKYLKPDEVFTK 103 (107)
Q Consensus 87 --------------------------------------k~-ks~Gn~v~p~ev~~~ 103 (107)
|| ||+||+|+|+|++.+
T Consensus 601 G~~~~~~~~~v~~~~~~~~~~~~~~~~~G~~v~~~~~eKMSKSkGNvVdP~diIek 656 (880)
T 4arc_A 601 GERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVER 656 (880)
T ss_dssp SCEEEECSTTCEEEECTTCCEEEEECTTCCBCEEEEEEECCTTTTCCCCHHHHHHH
T ss_pred CcccccCHHHhccccccccccccccccCCccccccccccccCcCCCCCCHHHHHHH
Confidence 75 999999999998753
|
| >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* | Back alignment and structure |
|---|
| >1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A | Back alignment and structure |
|---|
| >1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* | Back alignment and structure |
|---|
| >2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A | Back alignment and structure |
|---|
| >2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* | Back alignment and structure |
|---|
| >1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* | Back alignment and structure |
|---|
| >2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* | Back alignment and structure |
|---|
| >3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* | Back alignment and structure |
|---|
| >3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A | Back alignment and structure |
|---|
| >3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 | Back alignment and structure |
|---|
| >1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B | Back alignment and structure |
|---|
| >3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 | Back alignment and structure |
|---|
| >1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 | Back alignment and structure |
|---|
| >2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A | Back alignment and structure |
|---|
| >2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 107 | ||||
| d1ivsa4 | 425 | c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase | 2e-08 | |
| d1h3na3 | 494 | c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas | 2e-07 | |
| d1ffya3 | 450 | c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe | 2e-05 | |
| d1ilea3 | 452 | c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe | 0.001 |
| >d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Valyl-tRNA synthetase (ValRS) species: Thermus thermophilus [TaxId: 274]
Score = 48.0 bits (113), Expect = 2e-08
Identities = 18/81 (22%), Positives = 40/81 (49%), Gaps = 8/81 (9%)
Query: 25 FNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQ 84
T+ + + P D+ + G + +L L+ +R H G+ PFK +L+ G+++ +
Sbjct: 318 EETEDLKAFYPGDVLVTG--YDILFLWVSRMEVSGYHFMGE----RPFKTVLLHGLVLDE 371
Query: 85 TYRE--KTSGKYLKPDEVFTK 103
++ K+ G + P E+ +
Sbjct: 372 KGQKMSKSKGNVIDPLEMVER 392
|
| >d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 | Back information, alignment and structure |
|---|
| >d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 | Back information, alignment and structure |
|---|
| >d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| d1h3na3 | 494 | Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil | 99.18 | |
| d1ffya3 | 450 | Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus | 98.98 | |
| d1ivsa4 | 425 | Valyl-tRNA synthetase (ValRS) {Thermus thermophilu | 98.71 | |
| d1ilea3 | 452 | Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop | 98.65 | |
| d1pfva2 | 350 | Methionyl-tRNA synthetase (MetRS) {Escherichia col | 97.79 | |
| d1rqga2 | 361 | Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys | 97.71 | |
| d1irxa2 | 317 | Class I lysyl-tRNA synthetase {Archaeon Pyrococcus | 97.54 | |
| d2d5ba2 | 348 | Methionyl-tRNA synthetase (MetRS) {Thermus thermop | 97.28 | |
| d1li5a2 | 315 | Cysteinyl-tRNA synthetase (CysRS) {Escherichia col | 95.98 | |
| d1p9ka_ | 79 | Hypothetical protein YbcJ {Escherichia coli [TaxId | 83.73 | |
| d1f7ua2 | 348 | Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa | 80.78 |
| >d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Leucyl-tRNA synthetase (LeuRS) species: Thermus thermophilus [TaxId: 274]
Probab=99.18 E-value=4.7e-12 Score=98.34 Aligned_cols=71 Identities=46% Similarity=0.885 Sum_probs=64.0
Q ss_pred cccCCCCCCCCCChhhhcccccceEEeecchhHHHHHHHHHHHHHHHHhcCCCCCCCccccccccceeecC
Q psy1520 14 TKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQ 84 (107)
Q Consensus 14 ~~~dp~n~~~~fd~~~~~~WmPVD~YIGGiEHAilHLLYaRF~~K~L~D~G~v~~~EPF~~Ll~QGMV~~~ 84 (107)
.+.+......+.......+|.|||++.+|.++.+.+.+++|++.++..+.|.....+||++.++||+|+..
T Consensus 318 ~~~~~~~~~~~~~~~~~~~~~~vd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~G~v~~~ 388 (494)
T d1h3na3 318 RYTDPHNDRLPFDPEKANAWMPVDQYIGGVEHAVLHLLYSRFFTKFLHDLGMVKVEEPFQGLFTQGMVLAW 388 (494)
T ss_dssp HTTSTTCSSSSSCHHHHHHHCSBSEEECCGGGTTTHHHHHHHHHHHHHHTTSCSCSCSBSBEECCCCEEEE
T ss_pred hhcccccccccccccccccccCceecccccceeeeeeecccchhhhhhcccccccchhcccccccCcEecC
Confidence 34555666777888888999999999999999999999999999999999999999999999999999864
|
| >d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ka_ d.66.1.6 (A:) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|