Psyllid ID: psy1520


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MKYKAKRSQIKTKTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGKYLKPDEVFTKGSTC
ccEEEEEcccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
ccccEccccEccccccccccccccccHHHHHccccccHEEcHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccEEEcccccccccccEccHHHHHHHcccc
mkykakrsqiktktksrdinaevsfntdkaqdwlpvdiyiggKEHAVLHLYYARFIAHFLhaqgktparepFKRLLVQGMIMgqtyrektsgkylkpdevftkgstc
mkykakrsqiktktksrdinaevsfntdkaqdwlPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGqtyrektsgkylkpdevftkgstc
MKYKAKRSQIKTKTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGKYLKPDEVFTKGSTC
************************FNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTY*********************
MKYKAKRSQIKTKTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGKYLKPDEVFTKG***
*****************DINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGKYLKPDE********
******RSQIKTKTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGKYLKPDEVFTKGS*C
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYKAKRSQIKTKTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGKYLKPDEVFTKGSTC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query107 2.2.26 [Sep-21-2011]
Q15031 903 Probable leucine--tRNA li yes N/A 0.803 0.095 0.563 5e-22
Q5RDP4 903 Probable leucine--tRNA li yes N/A 0.803 0.095 0.563 5e-22
Q31LW9 865 Leucine--tRNA ligase OS=S yes N/A 0.757 0.093 0.518 2e-20
Q5N006 865 Leucine--tRNA ligase OS=S yes N/A 0.757 0.093 0.518 3e-20
Q8VDC0 902 Probable leucine--tRNA li yes N/A 0.747 0.088 0.530 8e-20
A5GL71 878 Leucine--tRNA ligase OS=S yes N/A 0.757 0.092 0.506 1e-19
Q7TV01 878 Leucine--tRNA ligase OS=P yes N/A 0.766 0.093 0.487 4e-19
B8DFR1 803 Leucine--tRNA ligase OS=L yes N/A 0.785 0.104 0.5 7e-19
Q8Y6M4 803 Leucine--tRNA ligase OS=L yes N/A 0.785 0.104 0.5 7e-19
Q71Z07 803 Leucine--tRNA ligase OS=L yes N/A 0.785 0.104 0.5 7e-19
>sp|Q15031|SYLM_HUMAN Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens GN=LARS2 PE=1 SV=2 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (68%), Gaps = 1/87 (1%)

Query: 20  NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
           N    FNT  A  W+PVD+YIGGKEHAV+HL+YARF +HF H Q     REPF +LL QG
Sbjct: 538 NPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCHDQKMVKHREPFHKLLAQG 597

Query: 80  MIMGQTYREKTSGKYLKPDEVFTKGST 106
           +I GQT+R   SG+YL+ +EV   GS 
Sbjct: 598 LIKGQTFR-LPSGQYLQREEVDLTGSV 623





Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 4
>sp|Q5RDP4|SYLM_PONAB Probable leucine--tRNA ligase, mitochondrial OS=Pongo abelii GN=LARS2 PE=2 SV=1 Back     alignment and function description
>sp|Q31LW9|SYL_SYNE7 Leucine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q5N006|SYL_SYNP6 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q8VDC0|SYLM_MOUSE Probable leucine--tRNA ligase, mitochondrial OS=Mus musculus GN=Lars2 PE=2 SV=1 Back     alignment and function description
>sp|A5GL71|SYL_SYNPW Leucine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q7TV01|SYL_PROMM Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|B8DFR1|SYL_LISMH Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q8Y6M4|SYL_LISMO Leucine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuS PE=3 SV=1 Back     alignment and function description
>sp|Q71Z07|SYL_LISMF Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
328702417 872 PREDICTED: probable leucyl-tRNA syntheta 0.813 0.099 0.609 2e-25
380021102 840 PREDICTED: LOW QUALITY PROTEIN: probable 0.757 0.096 0.629 2e-25
307178944 811 Probable leucyl-tRNA synthetase, mitocho 0.766 0.101 0.609 7e-25
91078378 866 PREDICTED: similar to Leucyl-tRNA synthe 0.757 0.093 0.629 1e-24
328782776 866 PREDICTED: probable leucyl-tRNA syntheta 0.757 0.093 0.617 2e-24
350398130 878 PREDICTED: probable leucyl-tRNA syntheta 0.757 0.092 0.629 3e-24
332020719 745 Putative leucyl-tRNA synthetase, mitocho 0.794 0.114 0.564 3e-24
443721981 892 hypothetical protein CAPTEDRAFT_228464 [ 0.700 0.084 0.653 4e-24
347967008 860 AGAP002014-PA [Anopheles gambiae str. PE 0.757 0.094 0.604 6e-24
357628256 873 leucyl-tRNA synthetase [Danaus plexippus 0.794 0.097 0.6 7e-24
>gi|328702417|ref|XP_003241894.1| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/87 (60%), Positives = 65/87 (74%)

Query: 20  NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
           N+   F+   A   +PVDIY+GGKEHAVLHLYYARF  HFLH+ G +P  EPFK+LLVQG
Sbjct: 487 NSSQPFDNMLANKMMPVDIYVGGKEHAVLHLYYARFFNHFLHSIGLSPCLEPFKKLLVQG 546

Query: 80  MIMGQTYREKTSGKYLKPDEVFTKGST 106
           M+MGQ+++ K +G YLK DEV  KG T
Sbjct: 547 MVMGQSFKNKINGTYLKEDEVIKKGKT 573




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380021102|ref|XP_003694413.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine--tRNA ligase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|307178944|gb|EFN67462.1| Probable leucyl-tRNA synthetase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91078378|ref|XP_974191.1| PREDICTED: similar to Leucyl-tRNA synthetase CG7479-PA [Tribolium castaneum] gi|270003885|gb|EFA00333.1| hypothetical protein TcasGA2_TC003172 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328782776|ref|XP_624911.2| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350398130|ref|XP_003485096.1| PREDICTED: probable leucyl-tRNA synthetase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332020719|gb|EGI61124.1| Putative leucyl-tRNA synthetase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|443721981|gb|ELU11054.1| hypothetical protein CAPTEDRAFT_228464 [Capitella teleta] Back     alignment and taxonomy information
>gi|347967008|ref|XP_321043.4| AGAP002014-PA [Anopheles gambiae str. PEST] gi|333469800|gb|EAA01232.5| AGAP002014-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357628256|gb|EHJ77646.1| leucyl-tRNA synthetase [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
FB|FBgn0027085 869 Aats-leu "Leucyl-tRNA syntheta 0.757 0.093 0.617 2.7e-22
UNIPROTKB|I3LI93 284 I3LI93 "Uncharacterized protei 0.794 0.299 0.558 2.4e-21
ZFIN|ZDB-GENE-070928-3 891 lars2 "leucyl-tRNA synthetase 0.728 0.087 0.569 9e-21
UNIPROTKB|E1BXI7 906 LARS2 "Uncharacterized protein 0.803 0.094 0.545 9.2e-21
UNIPROTKB|E9PHM2 860 LARS2 "Probable leucine--tRNA 0.794 0.098 0.569 2.3e-20
UNIPROTKB|E2RQR3 903 LARS2 "Uncharacterized protein 0.794 0.094 0.569 2.5e-20
UNIPROTKB|Q15031 903 LARS2 "Probable leucine--tRNA 0.794 0.094 0.569 2.5e-20
UNIPROTKB|F1SNZ5 702 LARS2 "Uncharacterized protein 0.794 0.121 0.558 2.6e-20
UNIPROTKB|E1B768 903 LARS2 "Uncharacterized protein 0.794 0.094 0.546 1.1e-19
MGI|MGI:2142973 902 Lars2 "leucyl-tRNA synthetase, 0.766 0.090 0.535 1.3e-18
FB|FBgn0027085 Aats-leu "Leucyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 270 (100.1 bits), Expect = 2.7e-22, P = 2.7e-22
 Identities = 50/81 (61%), Positives = 64/81 (79%)

Query:    20 NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
             N+E  F+T   + ++PVD+YIGGKEHAVLHLYYARFI HFLH+ G +P  EPF RLLVQG
Sbjct:   480 NSERIFDTALTKKFMPVDLYIGGKEHAVLHLYYARFINHFLHSCGLSPTSEPFSRLLVQG 539

Query:    80 MIMGQTYREKTSGKYLKPDEV 100
             M+MG+++R K SG+Y+   EV
Sbjct:   540 MVMGRSFRVKGSGRYVPETEV 560




GO:0006429 "leucyl-tRNA aminoacylation" evidence=ISS;NAS
GO:0004823 "leucine-tRNA ligase activity" evidence=ISS;NAS
GO:0005739 "mitochondrion" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0002161 "aminoacyl-tRNA editing activity" evidence=IEA
UNIPROTKB|I3LI93 I3LI93 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070928-3 lars2 "leucyl-tRNA synthetase 2, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXI7 LARS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PHM2 LARS2 "Probable leucine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQR3 LARS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15031 LARS2 "Probable leucine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNZ5 LARS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1B768 LARS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2142973 Lars2 "leucyl-tRNA synthetase, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B3WCD5SYL_LACCB6, ., 1, ., 1, ., 40.50600.75700.1008yesN/A
Q8VDC0SYLM_MOUSE6, ., 1, ., 1, ., 40.53080.74760.0886yesN/A
Q5N006SYL_SYNP66, ., 1, ., 1, ., 40.51850.75700.0936yesN/A
Q837N5SYL_ENTFA6, ., 1, ., 1, ., 40.52560.71020.0945yesN/A
Q5RDP4SYLM_PONAB6, ., 1, ., 1, ., 40.56320.80370.0952yesN/A
B7GK53SYL_ANOFW6, ., 1, ., 1, ., 40.50640.70090.0931yesN/A
Q03AT8SYL_LACC36, ., 1, ., 1, ., 40.50600.75700.1008yesN/A
Q38VP5SYL_LACSS6, ., 1, ., 1, ., 40.51280.71020.0941yesN/A
Q3AJU8SYL_SYNSC6, ., 1, ., 1, ., 40.50610.75700.0925yesN/A
P11325SYLM_YEAST6, ., 1, ., 1, ., 40.52940.75700.0906yesN/A
Q65FX8SYL_BACLD6, ., 1, ., 1, ., 40.53330.68220.0907yesN/A
Q31LW9SYL_SYNE76, ., 1, ., 1, ., 40.51850.75700.0936yesN/A
A5GL71SYL_SYNPW6, ., 1, ., 1, ., 40.50610.75700.0922yesN/A
Q15031SYLM_HUMAN6, ., 1, ., 1, ., 40.56320.80370.0952yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
PRK00390 805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 1e-26
TIGR00396 842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, euba 4e-25
cd00812314 cd00812, LeuRS_core, catalytic core domain of leuc 5e-22
COG0495 814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation 6e-22
PLN02563 963 PLN02563, PLN02563, aminoacyl-tRNA ligase 1e-20
>gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
 Score =  101 bits (255), Expect = 1e-26
 Identities = 35/62 (56%), Positives = 40/62 (64%)

Query: 20  NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
           N E  F+ + A  WLPVD YIGG EHAVLHL YARF    L   G   + EPFK+LL QG
Sbjct: 508 NDEAPFDKEAANYWLPVDQYIGGIEHAVLHLLYARFFTKVLRDLGLVSSDEPFKKLLTQG 567

Query: 80  MI 81
           M+
Sbjct: 568 MV 569


Length = 805

>gnl|CDD|232956 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
KOG0435|consensus 876 100.0
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosoma 100.0
PLN02563 963 aminoacyl-tRNA ligase 99.97
TIGR00396 842 leuS_bact leucyl-tRNA synthetase, eubacterial and 99.96
PRK00390 805 leuS leucyl-tRNA synthetase; Validated 99.93
PF00133601 tRNA-synt_1: tRNA synthetases class I (I, L, M and 99.47
cd00812314 LeuRS_core catalytic core domain of leucyl-tRNA sy 99.37
PRK12300 897 leuS leucyl-tRNA synthetase; Reviewed 99.34
PLN02959 1084 aminoacyl-tRNA ligase 99.32
PTZ00419 995 valyl-tRNA synthetase-like protein; Provisional 99.26
PLN02381 1066 valyl-tRNA synthetase 99.25
PRK13208 800 valS valyl-tRNA synthetase; Reviewed 99.22
TIGR00392 861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 99.22
PRK05743 912 ileS isoleucyl-tRNA synthetase; Reviewed 99.21
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 99.1
TIGR00395 938 leuS_arch leucyl-tRNA synthetase, archaeal and cyt 99.06
PRK06039 975 ileS isoleucyl-tRNA synthetase; Reviewed 99.05
PTZ00427 1205 isoleucine-tRNA ligase, putative; Provisional 98.81
PRK13804 961 ileS isoleucyl-tRNA synthetase; Provisional 98.79
cd00817382 ValRS_core catalytic core domain of valyl-tRNA syn 98.73
TIGR00422 861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 98.72
PRK05729 874 valS valyl-tRNA synthetase; Reviewed 98.71
cd00668312 Ile_Leu_Val_MetRS_core catalytic core domain of is 98.67
PLN02943 958 aminoacyl-tRNA ligase 98.6
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribos 98.56
PLN02882 1159 aminoacyl-tRNA ligase 98.51
PLN02843 974 isoleucyl-tRNA synthetase 98.5
cd00818338 IleRS_core catalytic core domain of isoleucyl-tRNA 98.44
KOG0433|consensus 937 98.29
PRK11893 511 methionyl-tRNA synthetase; Reviewed 98.27
PRK12267 648 methionyl-tRNA synthetase; Reviewed 98.03
TIGR00398 530 metG methionyl-tRNA synthetase. The methionyl-tRNA 97.99
cd00814319 MetRS_core catalytic core domain of methioninyl-tR 97.79
cd00672213 CysRS_core catalytic core domain of cysteinyl tRNA 97.74
TIGR00435 465 cysS cysteinyl-tRNA synthetase. This model finds t 97.51
PRK12268 556 methionyl-tRNA synthetase; Reviewed 97.45
PRK00260 463 cysS cysteinyl-tRNA synthetase; Validated 97.39
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal 97.34
PRK12418 384 cysteinyl-tRNA synthetase; Provisional 97.28
PRK00133 673 metG methionyl-tRNA synthetase; Reviewed 97.02
TIGR03447 411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- 96.97
PLN02224 616 methionine-tRNA ligase 96.95
KOG0432|consensus 995 96.32
PRK00750 510 lysK lysyl-tRNA synthetase; Reviewed 96.19
PTZ00399 651 cysteinyl-tRNA-synthetase; Provisional 96.14
PF09334391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 94.95
cd00674353 LysRS_core_class_I catalytic core domain of class 94.92
PRK01611 507 argS arginyl-tRNA synthetase; Reviewed 94.9
TIGR00456 566 argS arginyl-tRNA synthetase. This model recognize 94.26
KOG0437|consensus 1080 94.21
PF01406300 tRNA-synt_1e: tRNA synthetases class I (C) catalyt 94.04
PRK14536 490 cysS cysteinyl-tRNA synthetase; Provisional 93.81
COG0143 558 MetG Methionyl-tRNA synthetase [Translation, ribos 93.22
PRK14534 481 cysS cysteinyl-tRNA synthetase; Provisional 93.15
PLN02946 557 cysteine-tRNA ligase 92.71
KOG0436|consensus 578 90.05
KOG0434|consensus 1070 90.05
PLN02610 801 probable methionyl-tRNA synthetase 89.73
PF00750354 tRNA-synt_1d: tRNA synthetases class I (R); InterP 86.68
PRK14535 699 cysS cysteinyl-tRNA synthetase; Provisional 86.56
cd00802143 class_I_aaRS_core catalytic core domain of class I 83.2
PRK12451 562 arginyl-tRNA synthetase; Reviewed 81.9
PF10910125 DUF2744: Protein of unknown function (DUF2744); In 81.82
>KOG0435|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-38  Score=279.20  Aligned_cols=92  Identities=52%  Similarity=0.859  Sum_probs=89.0

Q ss_pred             cccCCCCCCCCCChhhhcccccceEEeecchhHHHHHHHHHHHHHHHHhcCCCCCCCccccccccceeecCeeeecCCCc
Q psy1520          14 TKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYREKTSGK   93 (107)
Q Consensus        14 ~~~dp~n~~~~fd~~~~~~WmPVD~YIGGiEHAilHLLYaRF~~K~L~D~G~v~~~EPF~~Ll~QGMV~~~~~k~ks~Gn   93 (107)
                      .|+||+|...|||++.+.+|||||+||||+|||||||||||||+|||+|+|++++.|||++|++||||+|++|+.++.|+
T Consensus       506 RylDpkN~e~~~d~a~a~k~MPVDvYIGG~EHAvlHLlYaRF~~kFl~di~~~~t~EPF~~Li~QGmV~G~tf~~~~sG~  585 (876)
T KOG0435|consen  506 RYLDPKNPEEPFDKAKAKKNMPVDVYIGGKEHAVLHLLYARFIAKFLKDIGVVSTAEPFTKLITQGMVRGKTFRTKESGK  585 (876)
T ss_pred             eecCCCCcccccchhhhhccCceeEEeccHHHHHHHHHHHHHHHHHHhhcCCCcCCCcHHHHHhhhcccceEEecCCCCc
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCCceeecCC
Q psy1520          94 YLKPDEVFTKGS  105 (107)
Q Consensus        94 ~v~p~ev~~~~~  105 (107)
                      ||.|+||...|+
T Consensus       586 yl~~~ev~~~nd  597 (876)
T KOG0435|consen  586 YLGPEEVQQVND  597 (876)
T ss_pred             cCCHHHhhhhcC
Confidence            999999987765



>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02563 aminoacyl-tRNA ligase Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02959 aminoacyl-tRNA ligase Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>KOG0433|consensus Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase Back     alignment and domain information
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>PLN02224 methionine-tRNA ligase Back     alignment and domain information
>KOG0432|consensus Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase Back     alignment and domain information
>KOG0437|consensus Back     alignment and domain information
>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02946 cysteine-tRNA ligase Back     alignment and domain information
>KOG0436|consensus Back     alignment and domain information
>KOG0434|consensus Back     alignment and domain information
>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF10910 DUF2744: Protein of unknown function (DUF2744); InterPro: IPR021226 This entry is represented by Mycobacteriophage D29, Gp29 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
3ziu_A 637 Crystal Structure Of Mycoplasma Mobile Leucyl-trna 3e-16
2v0c_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 2e-15
1obh_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 2e-15
4aq7_A 880 Ternary Complex Of E. Coli Leucyl-Trna Synthetase, 1e-12
>pdb|3ZIU|A Chain A, Crystal Structure Of Mycoplasma Mobile Leucyl-trna Synthetase With Leu-ams In The Active Site Length = 637 Back     alignment and structure

Iteration: 1

Score = 80.1 bits (196), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 36/70 (51%), Positives = 50/70 (71%), Gaps = 2/70 (2%) Query: 33 WLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTYRE--KT 90 WLPVD+YIGG+EHAVLHL YARF L+ P +EPF++L+ QGMI+G+ ++ K+ Sbjct: 355 WLPVDLYIGGQEHAVLHLLYARFWHKILYDLKIVPTKEPFQKLINQGMILGKDGQKMSKS 414 Query: 91 SGKYLKPDEV 100 G + PDE+ Sbjct: 415 LGNVVNPDEI 424
>pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 Back     alignment and structure
>pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 Back     alignment and structure
>pdb|4AQ7|A Chain A, Ternary Complex Of E. Coli Leucyl-Trna Synthetase, Trna(Leu) And Leucyl-Adenylate Analogue In The Aminoacylation Conformation Length = 880 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query107
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 5e-31
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 3e-29
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 2e-17
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 2e-09
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 Back     alignment and structure
 Score =  113 bits (286), Expect = 5e-31
 Identities = 31/87 (35%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 20  NAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQG 79
             E   +++ A  WLPVDIYIGG EHA++HL Y RF    +   G   + EP K+LL QG
Sbjct: 528 YKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQG 587

Query: 80  MIMGQTYR---EKTSGKYLKPDEVFTK 103
           M++   +    E     ++ P +   +
Sbjct: 588 MVLADAFYYVGENGERNWVSPVDAIVE 614


>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 100.0
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 99.96
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 99.4
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 99.38
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 99.25
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 99.22
2d5b_A 500 Methionyl-tRNA synthetase; rossmann fold, class 1A 99.12
2csx_A 497 Methionyl-tRNA synthetase; ligase, riken structura 99.08
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 99.07
2x1l_A 524 Methionyl-tRNA synthetase; nucleotide-binding, pro 99.05
3c8z_A 414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 98.82
4dlp_A 536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 98.72
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 98.65
3u1f_A 542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 98.65
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 98.61
3sp1_A 501 Cysteinyl-tRNA synthetase; structural genomics, se 98.3
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 97.78
1li5_A 461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 97.61
3tqo_A 462 Cysteinyl-tRNA synthetase; protein synthesis, liga 97.09
3fnr_A 464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX 96.48
1irx_A 523 Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin 95.37
1iq0_A 592 Arginyl-tRNA synthetase; riken structural genomics 93.05
2zue_A 629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 92.95
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 85.63
1f7u_A 607 Arginyl-tRNA synthetase; RNA-protein complex, amin 84.95
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-34  Score=256.51  Aligned_cols=91  Identities=34%  Similarity=0.664  Sum_probs=84.9

Q ss_pred             ccccCCCCCCCCCChhhhcccccceEEeecchhHHHHHHHHHHHHHHHHhcCCCCCCCccccccccceeecCee------
Q psy1520          13 KTKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQTY------   86 (107)
Q Consensus        13 ~~~~dp~n~~~~fd~~~~~~WmPVD~YIGGiEHAilHLLYaRF~~K~L~D~G~v~~~EPF~~Ll~QGMV~~~~~------   86 (107)
                      -+|+||+|++++||++++++|||||+||||+||||+||||||||+++|+|+|+++.+|||++|++||||+++++      
T Consensus       521 ~r~~~p~~~~~~~~~~~~~~~~PvD~yigG~EHailHllyaRf~~~~L~~~g~~~~~ePFk~ll~qGmVl~~~~~~~d~~  600 (880)
T 4arc_A          521 ARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYYVGEN  600 (880)
T ss_dssp             HHTTSTTCCSSSCCHHHHHHHCSEEEEECCGGGTTTHHHHHHHHHHHHHHTTSCCCSCSEEEEECCCCEEEEEEEEECTT
T ss_pred             HhhcCCCccccccChHHHhccCCceEeecchhhHHHHHHHHHHHHHHHHHhhcccCCCChHHeEEeceEeecceeccccC
Confidence            35789999999999999999999999999999999999999999999999999999999999999999986655      


Q ss_pred             --------------------------------------ee-cCCCceeCCCceeec
Q psy1520          87 --------------------------------------RE-KTSGKYLKPDEVFTK  103 (107)
Q Consensus        87 --------------------------------------k~-ks~Gn~v~p~ev~~~  103 (107)
                                                            || ||+||+|+|+|++.+
T Consensus       601 G~~~~~~~~~v~~~~~~~~~~~~~~~~~G~~v~~~~~eKMSKSkGNvVdP~diIek  656 (880)
T 4arc_A          601 GERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVER  656 (880)
T ss_dssp             SCEEEECSTTCEEEECTTCCEEEEECTTCCBCEEEEEEECCTTTTCCCCHHHHHHH
T ss_pred             CcccccCHHHhccccccccccccccccCCccccccccccccCcCCCCCCHHHHHHH
Confidence                                                  75 999999999998753



>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Back     alignment and structure
>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Back     alignment and structure
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 107
d1ivsa4425 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase 2e-08
d1h3na3494 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas 2e-07
d1ffya3450 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe 2e-05
d1ilea3452 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe 0.001
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Valyl-tRNA synthetase (ValRS)
species: Thermus thermophilus [TaxId: 274]
 Score = 48.0 bits (113), Expect = 2e-08
 Identities = 18/81 (22%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 25  FNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQ 84
             T+  + + P D+ + G  + +L L+ +R      H  G+     PFK +L+ G+++ +
Sbjct: 318 EETEDLKAFYPGDVLVTG--YDILFLWVSRMEVSGYHFMGE----RPFKTVLLHGLVLDE 371

Query: 85  TYRE--KTSGKYLKPDEVFTK 103
             ++  K+ G  + P E+  +
Sbjct: 372 KGQKMSKSKGNVIDPLEMVER 392


>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d1h3na3494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 99.18
d1ffya3450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 98.98
d1ivsa4425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 98.71
d1ilea3452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 98.65
d1pfva2350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 97.79
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 97.71
d1irxa2317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 97.54
d2d5ba2348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 97.28
d1li5a2315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 95.98
d1p9ka_79 Hypothetical protein YbcJ {Escherichia coli [TaxId 83.73
d1f7ua2348 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa 80.78
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Leucyl-tRNA synthetase (LeuRS)
species: Thermus thermophilus [TaxId: 274]
Probab=99.18  E-value=4.7e-12  Score=98.34  Aligned_cols=71  Identities=46%  Similarity=0.885  Sum_probs=64.0

Q ss_pred             cccCCCCCCCCCChhhhcccccceEEeecchhHHHHHHHHHHHHHHHHhcCCCCCCCccccccccceeecC
Q psy1520          14 TKSRDINAEVSFNTDKAQDWLPVDIYIGGKEHAVLHLYYARFIAHFLHAQGKTPAREPFKRLLVQGMIMGQ   84 (107)
Q Consensus        14 ~~~dp~n~~~~fd~~~~~~WmPVD~YIGGiEHAilHLLYaRF~~K~L~D~G~v~~~EPF~~Ll~QGMV~~~   84 (107)
                      .+.+......+.......+|.|||++.+|.++.+.+.+++|++.++..+.|.....+||++.++||+|+..
T Consensus       318 ~~~~~~~~~~~~~~~~~~~~~~vd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~G~v~~~  388 (494)
T d1h3na3         318 RYTDPHNDRLPFDPEKANAWMPVDQYIGGVEHAVLHLLYSRFFTKFLHDLGMVKVEEPFQGLFTQGMVLAW  388 (494)
T ss_dssp             HTTSTTCSSSSSCHHHHHHHCSBSEEECCGGGTTTHHHHHHHHHHHHHHTTSCSCSCSBSBEECCCCEEEE
T ss_pred             hhcccccccccccccccccccCceecccccceeeeeeecccchhhhhhcccccccchhcccccccCcEecC
Confidence            34555666777888888999999999999999999999999999999999999999999999999999864



>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ka_ d.66.1.6 (A:) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure