Psyllid ID: psy15482


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSGIVVPSASSSSSNGQSSNSLSDDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLAKSLIF
cEEEEEEccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEEccEEcccccccHHHcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEEEcccccccccHHHHHHcccHHHHHHccccEEEEEcccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHcc
cEEEEEEcccccEEEEEccccccHHHHHHHHHHHccccHHcEEEEEcccccccccccHHHcccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcEEEEEEEEEEEEcccEEEEEEcccccHEEccHHHHHHcccHHHHHHHHccEEEcccccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHcc
mkvtvstqhtnecflldvseDLELENFKAFCevqsgypaheIAIEFQGVLLQDNkktlkthgiqdgDLVLLKHlgsyhatpaavipnfdfsgivvpsasssssngqssnslsddpaTVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMlnahpfdtEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKvngypvkafidsgaqTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLAKSLIF
mkvtvstqhtnecflLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSGIVVPSASSSSSNGQSSNSLSDDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAEltnfngdkKKALAALLAKSLIF
MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSGIVVPsasssssngqssnslsDDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERIlrqqyeerekreqlrlrmlNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDkkkalaallakslIF
*********TNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSGIVV*****************************************************************************************LIAEEI***NIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLA*****
MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVL****************************************************************************SPEDFE*********************************IAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLAKSLIF
********HTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSGIVVP******************PATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLAKSLIF
MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGS***********************************SDDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLAKSLIF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSGIVVPSASSSSSNGQSSNSLSDDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGDKKKALAALLAKSLIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
Q7ZYA7393 Protein DDI1 homolog 2 OS N/A N/A 0.874 0.671 0.534 2e-81
Q497D6394 Protein DDI1 homolog 2 OS yes N/A 0.874 0.670 0.532 1e-79
Q5TDH0399 Protein DDI1 homolog 2 OS yes N/A 0.874 0.661 0.526 1e-78
A2ADY9399 Protein DDI1 homolog 2 OS yes N/A 0.874 0.661 0.516 2e-77
Q6TH22411 Protein DDI1 homolog 2 OS yes N/A 0.870 0.639 0.503 5e-77
Q8WTU0396 Protein DDI1 homolog 1 OS no N/A 0.874 0.666 0.491 7e-72
Q95JI3396 Protein DDI1 homolog 1 OS N/A N/A 0.874 0.666 0.487 6e-71
A0JPP7408 Protein DDI1 homolog 1 OS no N/A 0.887 0.656 0.464 9e-71
Q9DAF3408 Protein DDI1 homolog 1 OS no N/A 0.887 0.656 0.461 1e-69
Q2T9Z1396 Protein DDI1 homolog 1 OS no N/A 0.874 0.666 0.480 9e-69
>sp|Q7ZYA7|DDI2_XENLA Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1 Back     alignment and function desciption
 Score =  302 bits (774), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 147/275 (53%), Positives = 195/275 (70%), Gaps = 11/275 (4%)

Query: 14  FLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKH 73
           F L+V  D ELENF+A CE++SG PA +  I +    L DN+++L ++G++DGD+V+L+ 
Sbjct: 17  FSLEVDGDFELENFRALCELESGIPASDTLIVYAERPLTDNQRSLASYGLKDGDVVILRQ 76

Query: 74  LGSYHATPAAVIPNFDFSGIVVPSASSSSS-----------NGQSSNSLSDDPATVRQLL 122
             +    PAA  P  DFS I VP ASS              +  S     D+PA +RQ+L
Sbjct: 77  KEAPETRPAAPFPGLDFSTIAVPGASSQPDPSQPQAPPPPPDTSSFPQGLDNPALLRQML 136

Query: 123 LDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEA 182
           L NP E++LL++ NP LA+ALL+G  E F ++L++Q +ER +REQ R+R+ +A PFD +A
Sbjct: 137 LANPHELSLLKERNPPLAEALLSGDLEKFTKVLQEQQQERARREQERIRLYSADPFDLDA 196

Query: 183 QKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSL 242
           Q  I E+I+++NIE NM  AME  PE+FG VVMLYINCKVNGYPVKAF+DSGAQ TIMS 
Sbjct: 197 QAKIEEDIRQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGYPVKAFVDSGAQMTIMSQ 256

Query: 243 ACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMA 277
           ACAER +IMRL+D RWAGIAKGVG QKI+GR+H+A
Sbjct: 257 ACAERCHIMRLVDRRWAGIAKGVGTQKIIGRVHLA 291





Xenopus laevis (taxid: 8355)
>sp|Q497D6|DDI2_XENTR Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q5TDH0|DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1 Back     alignment and function description
>sp|A2ADY9|DDI2_MOUSE Protein DDI1 homolog 2 OS=Mus musculus GN=Ddi2 PE=1 SV=1 Back     alignment and function description
>sp|Q6TH22|DDI2_DANRE Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q8WTU0|DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens GN=DDI1 PE=1 SV=1 Back     alignment and function description
>sp|Q95JI3|DDI1_MACFA Protein DDI1 homolog 1 OS=Macaca fascicularis GN=DDI1 PE=2 SV=1 Back     alignment and function description
>sp|A0JPP7|DDI1_RAT Protein DDI1 homolog 1 OS=Rattus norvegicus GN=Ddi1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DAF3|DDI1_MOUSE Protein DDI1 homolog 1 OS=Mus musculus GN=Ddi1 PE=1 SV=1 Back     alignment and function description
>sp|Q2T9Z1|DDI1_BOVIN Protein DDI1 homolog 1 OS=Bos taurus GN=DDI1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
270007166 448 hypothetical protein TcasGA2_TC013702 [T 0.900 0.607 0.663 1e-104
322799330 459 hypothetical protein SINV_11449 [Solenop 0.937 0.616 0.624 1e-104
189237227 452 PREDICTED: similar to DNA-damage inducib 0.900 0.601 0.657 1e-103
307188581 456 Protein DDI1-like protein 2 [Camponotus 0.937 0.620 0.632 1e-101
332021102 453 Protein DDI1-like protein 2 [Acromyrmex 0.937 0.624 0.629 1e-101
307191967399 Protein DDI1-like protein 2 [Harpegnatho 0.923 0.699 0.626 1e-101
114051417389 DNA-damage inducible protein [Bombyx mor 0.907 0.704 0.618 1e-100
332374366399 unknown [Dendroctonus ponderosae] 0.910 0.689 0.632 2e-99
340729851 467 PREDICTED: protein DDI1 homolog 2-like [ 0.923 0.597 0.581 8e-96
380020373 465 PREDICTED: protein DDI1 homolog 2-like [ 0.923 0.6 0.578 2e-95
>gi|270007166|gb|EFA03614.1| hypothetical protein TcasGA2_TC013702 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  385 bits (989), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 229/282 (81%), Gaps = 10/282 (3%)

Query: 1   MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKT 60
           MKVTV+T  T+  F+LDVSEDLELENFKAFCEV++G+PA EI I + G+ L DNKK+LK 
Sbjct: 1   MKVTVTT-LTDFIFVLDVSEDLELENFKAFCEVETGFPATEIVIAYNGMPLMDNKKSLKE 59

Query: 61  HGIQDGDLVLLKHLGSYHATPAAV----IPNFDFSGIVVPSASSSS--SNGQSSNSLSDD 114
           HGI+DGD V L+H+  + A+ ++     +P  DFSGI VP+++  +  S G+ S    DD
Sbjct: 60  HGIRDGDAVCLQHMLQHGASQSSFDLQGVPRLDFSGIQVPNSTRGNQVSPGRPSE---DD 116

Query: 115 PATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLN 174
           P  +R + L NP ++ALL+QNNPRLADALL G+ + F  +LR+Q + R++REQ RLRMLN
Sbjct: 117 PVLIRDMFLANPDQLALLKQNNPRLADALLTGNIDTFASVLREQVQARQEREQQRLRMLN 176

Query: 175 AHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSG 234
           A PFDTEAQ+LIAEEI++ NIEANMEAAMEYNPE+FGTVVMLYINC+VNGYPVKAFIDSG
Sbjct: 177 ADPFDTEAQRLIAEEIRQKNIEANMEAAMEYNPESFGTVVMLYINCRVNGYPVKAFIDSG 236

Query: 235 AQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHM 276
           AQTTIMS +CAER NIMRL+DTRWAGIAKGVGVQKI+GRIHM
Sbjct: 237 AQTTIMSSSCAERCNIMRLVDTRWAGIAKGVGVQKIIGRIHM 278




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322799330|gb|EFZ20718.1| hypothetical protein SINV_11449 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|189237227|ref|XP_969775.2| PREDICTED: similar to DNA-damage inducible protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307188581|gb|EFN73309.1| Protein DDI1-like protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332021102|gb|EGI61489.1| Protein DDI1-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307191967|gb|EFN75357.1| Protein DDI1-like protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|114051417|ref|NP_001040314.1| DNA-damage inducible protein [Bombyx mori] gi|87248309|gb|ABD36207.1| DNA-damage inducible protein [Bombyx mori] Back     alignment and taxonomy information
>gi|332374366|gb|AEE62324.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|340729851|ref|XP_003403208.1| PREDICTED: protein DDI1 homolog 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380020373|ref|XP_003694061.1| PREDICTED: protein DDI1 homolog 2-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
FB|FBgn0030753 458 rngo "rings lost" [Drosophila 0.566 0.373 0.584 7.7e-66
UNIPROTKB|E2QUJ5399 DDI2 "Uncharacterized protein" 0.559 0.423 0.585 7.7e-64
UNIPROTKB|F1SUU7399 DDI2 "Uncharacterized protein" 0.559 0.423 0.585 2e-63
UNIPROTKB|E1B9T9399 DDI2 "Uncharacterized protein" 0.559 0.423 0.585 2.6e-63
UNIPROTKB|Q5TDH0399 DDI2 "Protein DDI1 homolog 2" 0.559 0.423 0.579 2.6e-63
ZFIN|ZDB-GENE-031030-15411 ddi2 "DNA-damage inducible pro 0.559 0.411 0.573 4.2e-63
MGI|MGI:1917244399 Ddi2 "DNA-damage inducible pro 0.559 0.423 0.568 1.1e-62
UNIPROTKB|F1MAK5399 Ddi2 "Protein Ddi2" [Rattus no 0.559 0.423 0.568 2.9e-62
UNIPROTKB|F1SV49401 DDI1 "Uncharacterized protein" 0.546 0.411 0.563 1.3e-61
UNIPROTKB|E1C2C2332 DDI2 "Uncharacterized protein" 0.887 0.807 0.462 1.2e-60
FB|FBgn0030753 rngo "rings lost" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 7.7e-66, Sum P(2) = 7.7e-66
 Identities = 100/171 (58%), Positives = 121/171 (70%)

Query:   113 DDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERIXXXXXXXXXXXXXXXXXX 172
             DDP TVRQ+ L +P+ ++LL+Q NP LA+A+ +G  E F R+                  
Sbjct:   138 DDPETVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHRMRM 197

Query:   173 XNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFID 232
              NA PFD E Q+LIAEEIK+ NI+ NM AA+EYNPE FGTV MLYINCKVNG PVKAF+D
Sbjct:   198 LNADPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVD 257

Query:   233 SGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTN 283
             SGAQTTIMS  CAER ++ RL+DTRW G+AKGVG Q ILGRIHM   ++ N
Sbjct:   258 SGAQTTIMSKDCAERCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIEN 308


GO:0004190 "aspartic-type endopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0043130 "ubiquitin binding" evidence=IDA
GO:0007301 "female germline ring canal formation" evidence=IMP
GO:0070628 "proteasome binding" evidence=IPI
UNIPROTKB|E2QUJ5 DDI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUU7 DDI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9T9 DDI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TDH0 DDI2 "Protein DDI1 homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031030-15 ddi2 "DNA-damage inducible protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1917244 Ddi2 "DNA-damage inducible protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAK5 Ddi2 "Protein Ddi2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV49 DDI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2C2 DDI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6TH22DDI2_DANRENo assigned EC number0.50340.87080.6399yesN/A
Q5TDH0DDI2_HUMANNo assigned EC number0.52660.87410.6616yesN/A
Q6CFI3DDI1_YARLINo assigned EC number0.33920.87740.6675yesN/A
Q4WGS4DDI1_ASPFUNo assigned EC number0.38990.81450.6074yesN/A
A2ADY9DDI2_MOUSENo assigned EC number0.51600.87410.6616yesN/A
Q2USD7DDI1_ASPORNo assigned EC number0.40150.81450.6119yesN/A
Q497D6DDI2_XENTRNo assigned EC number0.53260.87410.6700yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
pfam09668124 pfam09668, Asp_protease, Aspartyl protease 3e-55
cd05479124 cd05479, RP_DDI, RP_DDI; retropepsin-like domain o 4e-48
cd0179671 cd01796, DDI1_N, DNA damage inducible protein 1 ub 2e-20
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 3e-08
cd0030392 cd00303, retropepsin_like, Retropepsins; pepsin-li 7e-07
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 6e-06
pfam1365089 pfam13650, Asp_protease_2, Aspartyl protease 2e-04
smart0021372 smart00213, UBQ, Ubiquitin homologues 8e-04
>gnl|CDD|118200 pfam09668, Asp_protease, Aspartyl protease Back     alignment and domain information
 Score =  175 bits (445), Expect = 3e-55
 Identities = 61/86 (70%), Positives = 72/86 (83%)

Query: 192 KNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIM 251
           + N++ N+E AME+ PE FG V MLYINC+VNG PVKAF+DSGAQT+IMS  CAER  IM
Sbjct: 1   QENVDENLEHAMEHTPEAFGRVTMLYINCEVNGVPVKAFVDSGAQTSIMSPRCAERCGIM 60

Query: 252 RLLDTRWAGIAKGVGVQKILGRIHMA 277
           RLLDTR+AGIA+GVG  KILGR+HMA
Sbjct: 61  RLLDTRFAGIARGVGTAKILGRVHMA 86


This family of eukaryotic aspartyl proteases have a fold similar to retroviral proteases which implies they function proteolytically during regulated protein turnover. Length = 124

>gnl|CDD|133146 cd05479, RP_DDI, RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>gnl|CDD|176391 cd01796, DDI1_N, DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
KOG0012|consensus380 100.0
PF09668124 Asp_protease: Aspartyl protease; InterPro: IPR0191 100.0
cd05480103 NRIP_C NRIP_C; putative nuclear receptor interacti 99.97
KOG0010|consensus 493 99.91
cd05479124 RP_DDI RP_DDI; retropepsin-like domain of DNA dama 99.81
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.79
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.75
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.74
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.73
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.73
PTZ0004476 ubiquitin; Provisional 99.72
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.72
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.7
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.7
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.7
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.7
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.69
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.69
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.69
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.67
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.65
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.65
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.64
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.64
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.61
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.6
KOG0011|consensus340 99.6
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.59
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.59
KOG0003|consensus128 99.52
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.52
KOG0005|consensus70 99.51
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.5
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.42
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.42
KOG0004|consensus156 99.4
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.29
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.29
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.2
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.18
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.11
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 99.01
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 98.93
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.93
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 98.85
PF1365090 Asp_protease_2: Aspartyl protease 98.84
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 98.84
PLN02560308 enoyl-CoA reductase 98.82
KOG4248|consensus 1143 98.81
KOG0001|consensus75 98.75
cd0609586 RP_RTVL_H_like Retropepsin of the RTVL_H family of 98.65
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.6
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.59
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 98.5
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.49
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.47
COG3577215 Predicted aspartyl protease [General function pred 98.25
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 98.18
KOG1872|consensus 473 98.14
PF08284135 RVP_2: Retroviral aspartyl protease; InterPro: IPR 97.98
cd0548193 retropepsin_like_LTR_1 Retropepsins_like_LTR; peps 97.9
TIGR03698107 clan_AA_DTGF clan AA aspartic protease, AF_0612 fa 97.85
KOG0006|consensus 446 97.81
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.63
cd0030392 retropepsin_like Retropepsins; pepsin-like asparta 97.62
KOG4495|consensus110 97.45
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.36
KOG3493|consensus73 97.25
COG541781 Uncharacterized small protein [Function unknown] 96.96
KOG1769|consensus99 96.94
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 96.92
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 96.86
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 96.66
KOG1639|consensus297 96.62
KOG3206|consensus234 96.62
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.56
cd0548287 HIV_retropepsin_like Retropepsins, pepsin-like asp 96.52
PF12384177 Peptidase_A2B: Ty3 transposon peptidase; InterPro: 96.46
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.44
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 96.44
PF05585164 DUF1758: Putative peptidase (DUF1758); InterPro: I 96.29
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 96.07
PF1445357 ThiS-like: ThiS-like ubiquitin 95.89
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 95.84
PF13019162 Telomere_Sde2: Telomere stability and silencing 95.68
PRK0643767 hypothetical protein; Provisional 95.08
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 95.05
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 94.65
PRK0836470 sulfur carrier protein ThiS; Provisional 94.38
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 94.36
KOG0013|consensus231 94.28
PRK0648865 sulfur carrier protein ThiS; Validated 94.09
PRK0586365 sulfur carrier protein ThiS; Provisional 94.02
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 93.87
COG5550125 Predicted aspartyl protease [Posttranslational mod 93.44
PRK0565966 sulfur carrier protein ThiS; Validated 92.98
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 92.48
PRK0805366 sulfur carrier protein ThiS; Provisional 92.06
PRK0769667 sulfur carrier protein ThiS; Provisional 91.89
PRK0744070 hypothetical protein; Provisional 91.74
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 91.28
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 90.89
PRK0694465 sulfur carrier protein ThiS; Provisional 90.74
PRK0608384 sulfur carrier protein ThiS; Provisional 90.66
TIGR02958 452 sec_mycoba_snm4 secretion protein snm4. Members of 90.26
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 90.0
PLN0279982 Molybdopterin synthase sulfur carrier subunit 89.93
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 89.91
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 89.51
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 89.1
COG210468 ThiS Sulfur transfer protein involved in thiamine 88.07
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 87.31
KOG4583|consensus391 87.17
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 86.61
cd0609489 RP_Saci_like RP_Saci_like, retropepsin family. Ret 85.87
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 85.86
smart0072741 STI1 Heat shock chaperonin-binding motif. 85.21
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 84.92
PRK0177795 hypothetical protein; Validated 84.89
KOG4250|consensus 732 82.94
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 82.9
cd0641178 PB1_p51 The PB1 domain is present in the p51 prote 82.84
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 82.54
KOG2982|consensus418 81.88
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 80.92
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 80.61
cd0599281 PB1 The PB1 domain is a modular domain mediating s 80.29
>KOG0012|consensus Back     alignment and domain information
Probab=100.00  E-value=7.5e-67  Score=490.01  Aligned_cols=287  Identities=42%  Similarity=0.618  Sum_probs=251.4

Q ss_pred             CEEEEEeCC-CCeEEEEEeCCCccHHHHHHHHHhhhCCCCCCeEEEECCeecCCC-cccccccCCCCCCEEEEEEecCCC
Q psy15482          1 MKVTVSTQH-TNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDN-KKTLKTHGIQDGDLVLLKHLGSYH   78 (302)
Q Consensus         1 MqItV~~~~-~g~~~~leV~~~~TV~dLK~~Ie~e~gIp~~~Q~Li~~Gk~L~D~-~~TL~~~gI~dgd~l~L~~~~~~~   78 (302)
                      |.+||.+.. ....++++|+.+..+.+|+++++.++|++.+..-|+||++++.++ +.+|.++|+++||+|.+..+...+
T Consensus         1 M~~tvs~~l~~~~~~~i~v~~dg~L~nl~aL~~~d~g~~~~~~~li~n~~~l~s~~s~~l~Q~g~~~~dsl~lr~ks~d~   80 (380)
T KOG0012|consen    1 MSLTVSVALNFEKKFPIPVTTDGELNNLAALCWKDTGIVYDPSDLIYNPRPLVSNESQGLTQIGLKDGDSLALRCKSSDP   80 (380)
T ss_pred             CeEEEEEEecceeeeccccccccchhhHHHHHHHHhCcccchhhcccCCCccccchhhhhhhcccccceeEeccCCCCCC
Confidence            889998832 567789999999999999999999999999999999999999765 678999999999999998776543


Q ss_pred             --CCCCCCCCCCCCCCcccCCCCCCC---CCC------------CCCCCC-CCCHHHHHHHHhcCHHHHHHHHhcChhHH
Q psy15482         79 --ATPAAVIPNFDFSGIVVPSASSSS---SNG------------QSSNSL-SDDPATVRQLLLDNPKEIALLQQNNPRLA  140 (302)
Q Consensus        79 --~~~~~~~p~~d~s~~~~p~~s~s~---~~s------------~~~~~~-~~npe~iR~~~l~NP~~~~~L~~~NPeLa  140 (302)
                        .-+.+..+..||+++.+|..+...   .++            +...+. .++|+.+|++++++|..+..+++.+|.|+
T Consensus        81 r~~v~~~~~~~~dFat~A~~~fs~q~a~~~~gaq~~rg~~~~di~~a~~~~ldsp~~~Rq~~la~pf~L~~~r~~lp~La  160 (380)
T KOG0012|consen   81 RPIVPIQVRLISDFATIAVPMFSSQRARQLQGAQRTRGRLQTDIPEASSLSLDSPATFRQALLAMPFFLHLDRAYLPPLA  160 (380)
T ss_pred             CccccccceehhcccccccccccchhccccccccccccccccccccccccCcCCHHHHHHHHhcCchhhhhchhhcCccc
Confidence              111233344567666665432111   000            011223 59999999999999999999999999999


Q ss_pred             HHhhcCChHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhhHHHHHHHHHHhCCCCcceeeEEEEEE
Q psy15482        141 DALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINC  220 (302)
Q Consensus       141 ~al~~~d~e~f~~~lr~~~~~~~~~e~~~~~~l~~DP~d~e~Q~~i~e~i~q~~i~~n~~~A~E~~PE~f~~v~mlyi~~  220 (302)
                      .++..+|.+.|.+.+++++..+..++..+.+++++||||+|+|+||+|.|+|++|+|||.+|+||+||.|+.|.||||||
T Consensus       161 ~~l~~g~~~k~~~~~~~~q~d~~rr~~~~~rl~eanPfd~E~q~rIee~irq~~i~eq~~~ai~~~pe~f~~v~ML~iN~  240 (380)
T KOG0012|consen  161 ALLVLGDLEKFDRTLKEMQKDYQRRSVHQRRLLEANPFDLEAQRRIEEKIRQNAIDEQMSHAIEYHPEDFTQVTMLYINC  240 (380)
T ss_pred             hhhcccchhhhhhhhhhhccccchhhhhhHHHHhcCCcchhhhhhhhHHHHHHHHHHHHHHhhhcCccccccceEEEEEE
Confidence            99999999999999998777777778888899999999999999999999999999999999999999999999999999


Q ss_pred             EEcCeeEEEEEcCCCccccCCHHHHHHcCchhhhhccccceecccCcceeeeEEEEeeeeecccccc
Q psy15482        221 KVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGD  287 (302)
Q Consensus       221 ~ing~~v~a~vDsGaq~~i~s~~~a~~~gl~~~~d~~~~~~a~gvg~~~i~G~i~~~~~~ig~~~~~  287 (302)
                      +|||+|||||||||||+||||.+|||||||.+|||+||.|+|+|||+.||+|+||+++++||+.|++
T Consensus       241 ~ing~~VKAfVDsGaq~timS~~Caer~gL~rlid~r~~g~a~gvg~~ki~g~Ih~~~lki~~~~l~  307 (380)
T KOG0012|consen  241 EINGVPVKAFVDSGAQTTIMSAACAERCGLNRLIDKRFQGEARGVGTEKILGRIHQAQLKIEDLYLP  307 (380)
T ss_pred             EECCEEEEEEEcccchhhhhhHHHHHHhChHHHhhhhhhccccCCCcccccceeEEEEEEeccEeec
Confidence            9999999999999999999999999999999999999999999999999999999999999999986



>PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>PF13650 Asp_protease_2: Aspartyl protease Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>COG3577 Predicted aspartyl protease [General function prediction only] Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) Back     alignment and domain information
>cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats Back     alignment and domain information
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>KOG1639|consensus Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases Back     alignment and domain information
>PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>KOG4583|consensus Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>cd06094 RP_Saci_like RP_Saci_like, retropepsin family Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
3s8i_A148 The Retroviral-Like Protease (Rvp) Domain Of Human 9e-28
2i1a_A148 A Retroviral Protease-Like Domain In The Eukaryotic 2e-22
1v5o_A102 Solution Structure Of The Ubiquitin-Like Domain Fro 5e-09
>pdb|3S8I|A Chain A, The Retroviral-Like Protease (Rvp) Domain Of Human Ddi1 Length = 148 Back     alignment and structure

Iteration: 1

Score = 120 bits (301), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 52/71 (73%), Positives = 61/71 (85%) Query: 207 PETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVG 266 P G V MLYINCKVNG+P+KAF+DSGAQ TIMS ACAER NIMRL+D RWAG+AKGVG Sbjct: 16 PRGSGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVG 75 Query: 267 VQKILGRIHMA 277 Q+I+GR+H+A Sbjct: 76 TQRIIGRVHLA 86
>pdb|2I1A|A Chain A, A Retroviral Protease-Like Domain In The Eukaryotic Protein Ddi1 Length = 148 Back     alignment and structure
>pdb|1V5O|A Chain A, Solution Structure Of The Ubiquitin-Like Domain From Mouse Hypothetical 1700011n24rik Protein Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 2e-34
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 1e-29
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 5e-22
3m62_B106 UV excision repair protein RAD23; armadillo-like r 2e-07
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 7e-07
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 1e-06
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 1e-06
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 2e-06
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 3e-06
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 3e-06
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 3e-06
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 4e-06
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 9e-06
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 1e-05
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 2e-05
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 2e-05
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 3e-05
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 3e-05
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 3e-05
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 4e-05
1we6_A111 Splicing factor, putative; structural genomics, ub 4e-05
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 4e-05
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 8e-05
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 8e-05
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 8e-05
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 8e-05
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 9e-05
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 1e-04
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 1e-04
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 2e-04
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 3e-04
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 4e-04
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 4e-04
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 5e-04
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 6e-04
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 9e-04
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Length = 148 Back     alignment and structure
 Score =  121 bits (305), Expect = 2e-34
 Identities = 46/95 (48%), Positives = 65/95 (68%)

Query: 190 IKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVN 249
           +K+  I+  +  A+EY PE F  V MLYIN ++N YPVKAF+D+GAQTTIMS   A++  
Sbjct: 1   MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTG 60

Query: 250 IMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNF 284
           + R++D R+ G A+GVG  KI+GRIH A  ++   
Sbjct: 61  LSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQ 95


>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 99.9
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 99.88
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.77
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.77
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.76
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.76
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.76
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.76
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.75
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.75
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.74
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.74
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.74
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.74
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.73
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.73
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.73
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.72
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.72
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.72
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.72
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.72
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.72
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.72
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.72
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.71
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.71
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.71
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.71
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.71
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.71
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.71
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.71
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.7
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.7
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.69
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.69
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.69
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.68
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.68
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.68
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.5
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.67
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.67
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.67
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.67
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.67
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.66
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.65
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.65
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.64
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.64
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.64
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.64
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.64
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.63
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.63
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.63
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.63
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.63
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.62
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.62
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.62
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.62
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.61
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.61
1we6_A111 Splicing factor, putative; structural genomics, ub 99.61
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.61
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.6
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.6
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.6
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.6
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.58
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.56
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.56
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.55
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.55
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.55
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.53
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.52
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.51
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.49
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.48
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.47
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.45
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.41
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.4
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.38
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.34
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.3
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.3
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.26
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.21
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.19
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.15
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.1
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.04
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.99
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.66
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.54
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.47
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.42
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.22
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.06
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.06
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 97.96
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.91
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 97.84
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.71
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.69
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 97.65
3slz_A132 GAG-Pro-POL polyprotein; beta sheet and dimer, pro 97.6
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.48
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 97.34
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.34
2hs1_A99 HIV-1 protease; ultra-high resolution active site 97.21
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.14
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 97.07
2hah_A116 Protease, retropepsin; retroviral, aspartyl, hydro 96.97
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.88
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 96.43
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 96.43
3ka2_A 203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 96.36
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.24
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 96.14
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 96.09
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 95.94
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 95.83
3sqf_A114 Protease; folded monomer, retropepsin, D-type retr 95.83
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 95.33
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 94.81
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 94.72
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 94.37
3liy_A116 Protease; hydrolase, hydrolase-hydrolase inhibitor 94.32
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 94.28
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 94.06
2rsp_A124 RSV protease; hydrolase(aspartyl proteinase); 2.00 93.99
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 93.83
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 93.77
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 93.28
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 93.0
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 92.93
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 92.71
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 92.3
2jys_A107 Protease/reverse transcriptase; retroviral proteas 91.38
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 90.96
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 90.47
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 88.4
2cu3_A64 Unknown function protein; thermus thermophilus HB8 87.42
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 87.11
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 85.89
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 85.87
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 85.71
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 85.42
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 85.31
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 84.62
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 84.24
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 82.35
3kuz_A126 Plexin-C1; structural genomics, structural genomic 81.77
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 80.38
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.90  E-value=2.4e-24  Score=181.29  Aligned_cols=97  Identities=47%  Similarity=0.793  Sum_probs=62.0

Q ss_pred             HHHhhHHHHHHHHHHhCCCCcceeeEEEEEEEEcCeeEEEEEcCCCccccCCHHHHHHcCchhhhhccccceecccCcce
Q psy15482        190 IKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQK  269 (302)
Q Consensus       190 i~q~~i~~n~~~A~E~~PE~f~~v~mlyi~~~ing~~v~a~vDsGaq~~i~s~~~a~~~gl~~~~d~~~~~~a~gvg~~~  269 (302)
                      |||++|+|||++|+|++||.|.+..++||+|+|||++++|+|||||+.++||.++|++|||....+.++.+.+.|+|..+
T Consensus         1 ~~~~~i~~~~~~a~e~~p~~~~~~~~~~v~v~InG~~~~~LvDTGAs~s~is~~~a~~lgl~~~~~~~~~~~a~g~g~~~   80 (148)
T 2i1a_A            1 MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTGLSRMIDKRFIGEARGVGTGK   80 (148)
T ss_dssp             ----------------------CCCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHHTGGGGCBCCCC----------
T ss_pred             CcHHHHHHHHHhhhhhCchhhcccceEEEEEEECCEEEEEEEECCCCccccCHHHHHHcCCCccCCcceEEEEecCCCcc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999888


Q ss_pred             eeeEEEEeeeeeccccc
Q psy15482        270 ILGRIHMAIAELTNFNG  286 (302)
Q Consensus       270 i~G~i~~~~~~ig~~~~  286 (302)
                      +.|+++...++||++..
T Consensus        81 ~~~~~~~~~i~ig~~~~   97 (148)
T 2i1a_A           81 IIGRIHQAQVKIETQYI   97 (148)
T ss_dssp             -CEEEEEEEEEETTEEE
T ss_pred             cccEEEEEEEEECCEEe
Confidence            99999999999999874



>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure
>2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 9e-11
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 3e-09
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 2e-08
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 4e-08
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 1e-07
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 1e-07
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 2e-07
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 2e-07
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 2e-07
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-07
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 7e-07
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 1e-06
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 1e-06
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 2e-06
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 3e-06
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 5e-06
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 8e-06
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 3e-05
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 3e-05
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 4e-05
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 4e-05
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 2e-04
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 5e-04
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 5e-04
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 6e-04
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 6e-04
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 0.001
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 0.002
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 0.002
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 0.003
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 0.003
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 0.004
d1we6a_111 d.15.1.1 (A:) Splicing factor 3 subunit 1, C-termi 0.004
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: 1700011n24rik protein
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 55.8 bits (134), Expect = 9e-11
 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 3/95 (3%)

Query: 1   MKVTVSTQH---TNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKT 57
           M +TV       T   F L V+ D EL NF+  CE++SG PA E  I +   LL D+  +
Sbjct: 8   MLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCS 67

Query: 58  LKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSG 92
           L ++G++DGD+V+L    +         P+   SG
Sbjct: 68  LGSYGLKDGDMVVLLQKDNVGLRTPGRTPSGPSSG 102


>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.83
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.82
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.81
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.81
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.8
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.8
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.79
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.79
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.79
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.78
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.78
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.77
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.76
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.76
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.74
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.71
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.71
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.71
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.7
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.7
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.69
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.66
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.65
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.63
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.63
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.62
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.62
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.62
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.59
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.55
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.48
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.36
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.35
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.25
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.22
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.49
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d2fmba_104 EIAV protease {Equine infectious anemia virus [Tax 97.36
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.2
d4fiva_113 Feline immunodeficiency virus (FIV) protease {Feli 97.15
d1nsoa_107 Mason-Pfizer monkey virus protease {Simian retrovi 97.08
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.82
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.54
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 96.45
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 95.75
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 95.47
d2nmza199 Human immunodeficiency virus type 1 protease {Huma 94.81
d3ecga199 Human immunodeficiency virus type 2 (HIV-2) protea 94.65
d2rspa_124 Rous sarcoma virus protease {Rous sarcoma virus, s 94.34
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 94.32
d1hvca_ 203 Human immunodeficiency virus type 1 protease {Huma 93.65
d1ryja_70 Hypothetical protein MTH1743 {Archaeon Methanobact 87.93
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 86.74
d1x3zb157 Rad23 STI1 domain {Baker's yeast (Saccharomyces ce 86.72
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 85.83
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 85.79
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 84.04
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 80.5
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: 2'-5'-oligoadenylate synthetase-like protein, OASL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=1.2e-20  Score=144.48  Aligned_cols=75  Identities=28%  Similarity=0.377  Sum_probs=72.1

Q ss_pred             CEEEEEeCCCCeEEEEEeCCCccHHHHHHHHHhhhCCCCCCeEEEECCeecCCCcccccccCCCCCCEEEEEEecCC
Q psy15482          1 MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSY   77 (302)
Q Consensus         1 MqItV~~~~~g~~~~leV~~~~TV~dLK~~Ie~e~gIp~~~Q~Li~~Gk~L~D~~~TL~~~gI~dgd~l~L~~~~~~   77 (302)
                      |+|+|++ .+|++++|+|++++||.+||++|+.++|||+++|+|+|+||+|+|+ +||++|||++|++|||+.+...
T Consensus         8 mqI~Vk~-~~g~~~~l~v~~~~tV~~lK~~I~~~~gip~~~qrLi~~Gk~L~d~-~tL~~y~I~~~stl~l~~r~~~   82 (87)
T d1wh3a_           8 IQVFVKN-PDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDW-LGLGIYGIQDSDTLILSKKKGS   82 (87)
T ss_dssp             EEEEEEE-TTTEEEEEEECSSSBHHHHHHHHHHHTCCCTTTEEEEETTEECCSS-SBHHHHTCCTTEEEEEEECSCC
T ss_pred             EEEEEEC-CCCCEEEEEECCcCcHHHHHHHHHHHHCcChHHeEEEeeceEcCCC-CcHHHcCCCCCCEEEEEecCCC
Confidence            8999999 9999999999999999999999999999999999999999999986 9999999999999999988754



>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure