Psyllid ID: psy15482
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| 270007166 | 448 | hypothetical protein TcasGA2_TC013702 [T | 0.900 | 0.607 | 0.663 | 1e-104 | |
| 322799330 | 459 | hypothetical protein SINV_11449 [Solenop | 0.937 | 0.616 | 0.624 | 1e-104 | |
| 189237227 | 452 | PREDICTED: similar to DNA-damage inducib | 0.900 | 0.601 | 0.657 | 1e-103 | |
| 307188581 | 456 | Protein DDI1-like protein 2 [Camponotus | 0.937 | 0.620 | 0.632 | 1e-101 | |
| 332021102 | 453 | Protein DDI1-like protein 2 [Acromyrmex | 0.937 | 0.624 | 0.629 | 1e-101 | |
| 307191967 | 399 | Protein DDI1-like protein 2 [Harpegnatho | 0.923 | 0.699 | 0.626 | 1e-101 | |
| 114051417 | 389 | DNA-damage inducible protein [Bombyx mor | 0.907 | 0.704 | 0.618 | 1e-100 | |
| 332374366 | 399 | unknown [Dendroctonus ponderosae] | 0.910 | 0.689 | 0.632 | 2e-99 | |
| 340729851 | 467 | PREDICTED: protein DDI1 homolog 2-like [ | 0.923 | 0.597 | 0.581 | 8e-96 | |
| 380020373 | 465 | PREDICTED: protein DDI1 homolog 2-like [ | 0.923 | 0.6 | 0.578 | 2e-95 |
| >gi|270007166|gb|EFA03614.1| hypothetical protein TcasGA2_TC013702 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 385 bits (989), Expect = e-104, Method: Compositional matrix adjust.
Identities = 187/282 (66%), Positives = 229/282 (81%), Gaps = 10/282 (3%)
Query: 1 MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKT 60
MKVTV+T T+ F+LDVSEDLELENFKAFCEV++G+PA EI I + G+ L DNKK+LK
Sbjct: 1 MKVTVTT-LTDFIFVLDVSEDLELENFKAFCEVETGFPATEIVIAYNGMPLMDNKKSLKE 59
Query: 61 HGIQDGDLVLLKHLGSYHATPAAV----IPNFDFSGIVVPSASSSS--SNGQSSNSLSDD 114
HGI+DGD V L+H+ + A+ ++ +P DFSGI VP+++ + S G+ S DD
Sbjct: 60 HGIRDGDAVCLQHMLQHGASQSSFDLQGVPRLDFSGIQVPNSTRGNQVSPGRPSE---DD 116
Query: 115 PATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERILRQQYEEREKREQLRLRMLN 174
P +R + L NP ++ALL+QNNPRLADALL G+ + F +LR+Q + R++REQ RLRMLN
Sbjct: 117 PVLIRDMFLANPDQLALLKQNNPRLADALLTGNIDTFASVLREQVQARQEREQQRLRMLN 176
Query: 175 AHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSG 234
A PFDTEAQ+LIAEEI++ NIEANMEAAMEYNPE+FGTVVMLYINC+VNGYPVKAFIDSG
Sbjct: 177 ADPFDTEAQRLIAEEIRQKNIEANMEAAMEYNPESFGTVVMLYINCRVNGYPVKAFIDSG 236
Query: 235 AQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHM 276
AQTTIMS +CAER NIMRL+DTRWAGIAKGVGVQKI+GRIHM
Sbjct: 237 AQTTIMSSSCAERCNIMRLVDTRWAGIAKGVGVQKIIGRIHM 278
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322799330|gb|EFZ20718.1| hypothetical protein SINV_11449 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|189237227|ref|XP_969775.2| PREDICTED: similar to DNA-damage inducible protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307188581|gb|EFN73309.1| Protein DDI1-like protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332021102|gb|EGI61489.1| Protein DDI1-like protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307191967|gb|EFN75357.1| Protein DDI1-like protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|114051417|ref|NP_001040314.1| DNA-damage inducible protein [Bombyx mori] gi|87248309|gb|ABD36207.1| DNA-damage inducible protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|332374366|gb|AEE62324.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|340729851|ref|XP_003403208.1| PREDICTED: protein DDI1 homolog 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380020373|ref|XP_003694061.1| PREDICTED: protein DDI1 homolog 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| FB|FBgn0030753 | 458 | rngo "rings lost" [Drosophila | 0.566 | 0.373 | 0.584 | 7.7e-66 | |
| UNIPROTKB|E2QUJ5 | 399 | DDI2 "Uncharacterized protein" | 0.559 | 0.423 | 0.585 | 7.7e-64 | |
| UNIPROTKB|F1SUU7 | 399 | DDI2 "Uncharacterized protein" | 0.559 | 0.423 | 0.585 | 2e-63 | |
| UNIPROTKB|E1B9T9 | 399 | DDI2 "Uncharacterized protein" | 0.559 | 0.423 | 0.585 | 2.6e-63 | |
| UNIPROTKB|Q5TDH0 | 399 | DDI2 "Protein DDI1 homolog 2" | 0.559 | 0.423 | 0.579 | 2.6e-63 | |
| ZFIN|ZDB-GENE-031030-15 | 411 | ddi2 "DNA-damage inducible pro | 0.559 | 0.411 | 0.573 | 4.2e-63 | |
| MGI|MGI:1917244 | 399 | Ddi2 "DNA-damage inducible pro | 0.559 | 0.423 | 0.568 | 1.1e-62 | |
| UNIPROTKB|F1MAK5 | 399 | Ddi2 "Protein Ddi2" [Rattus no | 0.559 | 0.423 | 0.568 | 2.9e-62 | |
| UNIPROTKB|F1SV49 | 401 | DDI1 "Uncharacterized protein" | 0.546 | 0.411 | 0.563 | 1.3e-61 | |
| UNIPROTKB|E1C2C2 | 332 | DDI2 "Uncharacterized protein" | 0.887 | 0.807 | 0.462 | 1.2e-60 |
| FB|FBgn0030753 rngo "rings lost" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 511 (184.9 bits), Expect = 7.7e-66, Sum P(2) = 7.7e-66
Identities = 100/171 (58%), Positives = 121/171 (70%)
Query: 113 DDPATVRQLLLDNPKEIALLQQNNPRLADALLNGSPEDFERIXXXXXXXXXXXXXXXXXX 172
DDP TVRQ+ L +P+ ++LL+Q NP LA+A+ +G E F R+
Sbjct: 138 DDPETVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHRMRM 197
Query: 173 XNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFID 232
NA PFD E Q+LIAEEIK+ NI+ NM AA+EYNPE FGTV MLYINCKVNG PVKAF+D
Sbjct: 198 LNADPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVD 257
Query: 233 SGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTN 283
SGAQTTIMS CAER ++ RL+DTRW G+AKGVG Q ILGRIHM ++ N
Sbjct: 258 SGAQTTIMSKDCAERCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIEN 308
|
|
| UNIPROTKB|E2QUJ5 DDI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUU7 DDI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B9T9 DDI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5TDH0 DDI2 "Protein DDI1 homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031030-15 ddi2 "DNA-damage inducible protein 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917244 Ddi2 "DNA-damage inducible protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAK5 Ddi2 "Protein Ddi2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SV49 DDI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C2C2 DDI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| pfam09668 | 124 | pfam09668, Asp_protease, Aspartyl protease | 3e-55 | |
| cd05479 | 124 | cd05479, RP_DDI, RP_DDI; retropepsin-like domain o | 4e-48 | |
| cd01796 | 71 | cd01796, DDI1_N, DNA damage inducible protein 1 ub | 2e-20 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 3e-08 | |
| cd00303 | 92 | cd00303, retropepsin_like, Retropepsins; pepsin-li | 7e-07 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 6e-06 | |
| pfam13650 | 89 | pfam13650, Asp_protease_2, Aspartyl protease | 2e-04 | |
| smart00213 | 72 | smart00213, UBQ, Ubiquitin homologues | 8e-04 |
| >gnl|CDD|118200 pfam09668, Asp_protease, Aspartyl protease | Back alignment and domain information |
|---|
Score = 175 bits (445), Expect = 3e-55
Identities = 61/86 (70%), Positives = 72/86 (83%)
Query: 192 KNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIM 251
+ N++ N+E AME+ PE FG V MLYINC+VNG PVKAF+DSGAQT+IMS CAER IM
Sbjct: 1 QENVDENLEHAMEHTPEAFGRVTMLYINCEVNGVPVKAFVDSGAQTSIMSPRCAERCGIM 60
Query: 252 RLLDTRWAGIAKGVGVQKILGRIHMA 277
RLLDTR+AGIA+GVG KILGR+HMA
Sbjct: 61 RLLDTRFAGIARGVGTAKILGRVHMA 86
|
This family of eukaryotic aspartyl proteases have a fold similar to retroviral proteases which implies they function proteolytically during regulated protein turnover. Length = 124 |
| >gnl|CDD|133146 cd05479, RP_DDI, RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >gnl|CDD|176391 cd01796, DDI1_N, DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
| >gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| KOG0012|consensus | 380 | 100.0 | ||
| PF09668 | 124 | Asp_protease: Aspartyl protease; InterPro: IPR0191 | 100.0 | |
| cd05480 | 103 | NRIP_C NRIP_C; putative nuclear receptor interacti | 99.97 | |
| KOG0010|consensus | 493 | 99.91 | ||
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 99.81 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.79 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.75 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.74 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.73 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 99.73 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.72 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.72 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.7 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.7 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.7 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.7 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.69 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.69 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.69 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.67 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.65 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.65 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.64 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.64 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.61 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.6 | |
| KOG0011|consensus | 340 | 99.6 | ||
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.59 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.59 | |
| KOG0003|consensus | 128 | 99.52 | ||
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 99.52 | |
| KOG0005|consensus | 70 | 99.51 | ||
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.5 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.42 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.42 | |
| KOG0004|consensus | 156 | 99.4 | ||
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 99.29 | |
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 99.29 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 99.2 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 99.18 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 99.11 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 99.01 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 98.93 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.93 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 98.85 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 98.84 | |
| PF13975 | 72 | gag-asp_proteas: gag-polyprotein putative aspartyl | 98.84 | |
| PLN02560 | 308 | enoyl-CoA reductase | 98.82 | |
| KOG4248|consensus | 1143 | 98.81 | ||
| KOG0001|consensus | 75 | 98.75 | ||
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 98.65 | |
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.6 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 98.59 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 98.5 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 98.49 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 98.47 | |
| COG3577 | 215 | Predicted aspartyl protease [General function pred | 98.25 | |
| PF00077 | 100 | RVP: Retroviral aspartyl protease The Prosite entr | 98.18 | |
| KOG1872|consensus | 473 | 98.14 | ||
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 97.98 | |
| cd05481 | 93 | retropepsin_like_LTR_1 Retropepsins_like_LTR; peps | 97.9 | |
| TIGR03698 | 107 | clan_AA_DTGF clan AA aspartic protease, AF_0612 fa | 97.85 | |
| KOG0006|consensus | 446 | 97.81 | ||
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 97.63 | |
| cd00303 | 92 | retropepsin_like Retropepsins; pepsin-like asparta | 97.62 | |
| KOG4495|consensus | 110 | 97.45 | ||
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 97.36 | |
| KOG3493|consensus | 73 | 97.25 | ||
| COG5417 | 81 | Uncharacterized small protein [Function unknown] | 96.96 | |
| KOG1769|consensus | 99 | 96.94 | ||
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 96.92 | |
| PF09280 | 59 | XPC-binding: XPC-binding domain; InterPro: IPR0153 | 96.86 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 96.66 | |
| KOG1639|consensus | 297 | 96.62 | ||
| KOG3206|consensus | 234 | 96.62 | ||
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 96.56 | |
| cd05482 | 87 | HIV_retropepsin_like Retropepsins, pepsin-like asp | 96.52 | |
| PF12384 | 177 | Peptidase_A2B: Ty3 transposon peptidase; InterPro: | 96.46 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 96.44 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 96.44 | |
| PF05585 | 164 | DUF1758: Putative peptidase (DUF1758); InterPro: I | 96.29 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 96.07 | |
| PF14453 | 57 | ThiS-like: ThiS-like ubiquitin | 95.89 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 95.84 | |
| PF13019 | 162 | Telomere_Sde2: Telomere stability and silencing | 95.68 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 95.08 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 95.05 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 94.65 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 94.38 | |
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 94.36 | |
| KOG0013|consensus | 231 | 94.28 | ||
| PRK06488 | 65 | sulfur carrier protein ThiS; Validated | 94.09 | |
| PRK05863 | 65 | sulfur carrier protein ThiS; Provisional | 94.02 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 93.87 | |
| COG5550 | 125 | Predicted aspartyl protease [Posttranslational mod | 93.44 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 92.98 | |
| COG5227 | 103 | SMT3 Ubiquitin-like protein (sentrin) [Posttransla | 92.48 | |
| PRK08053 | 66 | sulfur carrier protein ThiS; Provisional | 92.06 | |
| PRK07696 | 67 | sulfur carrier protein ThiS; Provisional | 91.89 | |
| PRK07440 | 70 | hypothetical protein; Provisional | 91.74 | |
| PF14836 | 88 | Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A | 91.28 | |
| cd00565 | 65 | ThiS ThiaminS ubiquitin-like sulfur carrier protei | 90.89 | |
| PRK06944 | 65 | sulfur carrier protein ThiS; Provisional | 90.74 | |
| PRK06083 | 84 | sulfur carrier protein ThiS; Provisional | 90.66 | |
| TIGR02958 | 452 | sec_mycoba_snm4 secretion protein snm4. Members of | 90.26 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 90.0 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 89.93 | |
| TIGR01683 | 64 | thiS thiamine biosynthesis protein ThiS. This mode | 89.91 | |
| smart00666 | 81 | PB1 PB1 domain. Phox and Bem1p domain, present in | 89.51 | |
| cd06406 | 80 | PB1_P67 A PB1 domain is present in p67 proteins wh | 89.1 | |
| COG2104 | 68 | ThiS Sulfur transfer protein involved in thiamine | 88.07 | |
| PF09379 | 80 | FERM_N: FERM N-terminal domain ; InterPro: IPR0189 | 87.31 | |
| KOG4583|consensus | 391 | 87.17 | ||
| PF11620 | 88 | GABP-alpha: GA-binding protein alpha chain; InterP | 86.61 | |
| cd06094 | 89 | RP_Saci_like RP_Saci_like, retropepsin family. Ret | 85.87 | |
| cd06407 | 82 | PB1_NLP A PB1 domain is present in NIN like protei | 85.86 | |
| smart00727 | 41 | STI1 Heat shock chaperonin-binding motif. | 85.21 | |
| PF00564 | 84 | PB1: PB1 domain; InterPro: IPR000270 The Phox and | 84.92 | |
| PRK01777 | 95 | hypothetical protein; Validated | 84.89 | |
| KOG4250|consensus | 732 | 82.94 | ||
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 82.9 | |
| cd06411 | 78 | PB1_p51 The PB1 domain is present in the p51 prote | 82.84 | |
| cd06409 | 86 | PB1_MUG70 The MUG70 protein is a product of the me | 82.54 | |
| KOG2982|consensus | 418 | 81.88 | ||
| PF10790 | 76 | DUF2604: Protein of Unknown function (DUF2604); In | 80.92 | |
| TIGR01682 | 80 | moaD molybdopterin converting factor, subunit 1, n | 80.61 | |
| cd05992 | 81 | PB1 The PB1 domain is a modular domain mediating s | 80.29 |
| >KOG0012|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.5e-67 Score=490.01 Aligned_cols=287 Identities=42% Similarity=0.618 Sum_probs=251.4
Q ss_pred CEEEEEeCC-CCeEEEEEeCCCccHHHHHHHHHhhhCCCCCCeEEEECCeecCCC-cccccccCCCCCCEEEEEEecCCC
Q psy15482 1 MKVTVSTQH-TNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDN-KKTLKTHGIQDGDLVLLKHLGSYH 78 (302)
Q Consensus 1 MqItV~~~~-~g~~~~leV~~~~TV~dLK~~Ie~e~gIp~~~Q~Li~~Gk~L~D~-~~TL~~~gI~dgd~l~L~~~~~~~ 78 (302)
|.+||.+.. ....++++|+.+..+.+|+++++.++|++.+..-|+||++++.++ +.+|.++|+++||+|.+..+...+
T Consensus 1 M~~tvs~~l~~~~~~~i~v~~dg~L~nl~aL~~~d~g~~~~~~~li~n~~~l~s~~s~~l~Q~g~~~~dsl~lr~ks~d~ 80 (380)
T KOG0012|consen 1 MSLTVSVALNFEKKFPIPVTTDGELNNLAALCWKDTGIVYDPSDLIYNPRPLVSNESQGLTQIGLKDGDSLALRCKSSDP 80 (380)
T ss_pred CeEEEEEEecceeeeccccccccchhhHHHHHHHHhCcccchhhcccCCCccccchhhhhhhcccccceeEeccCCCCCC
Confidence 889998832 567789999999999999999999999999999999999999765 678999999999999998776543
Q ss_pred --CCCCCCCCCCCCCCcccCCCCCCC---CCC------------CCCCCC-CCCHHHHHHHHhcCHHHHHHHHhcChhHH
Q psy15482 79 --ATPAAVIPNFDFSGIVVPSASSSS---SNG------------QSSNSL-SDDPATVRQLLLDNPKEIALLQQNNPRLA 140 (302)
Q Consensus 79 --~~~~~~~p~~d~s~~~~p~~s~s~---~~s------------~~~~~~-~~npe~iR~~~l~NP~~~~~L~~~NPeLa 140 (302)
.-+.+..+..||+++.+|..+... .++ +...+. .++|+.+|++++++|..+..+++.+|.|+
T Consensus 81 r~~v~~~~~~~~dFat~A~~~fs~q~a~~~~gaq~~rg~~~~di~~a~~~~ldsp~~~Rq~~la~pf~L~~~r~~lp~La 160 (380)
T KOG0012|consen 81 RPIVPIQVRLISDFATIAVPMFSSQRARQLQGAQRTRGRLQTDIPEASSLSLDSPATFRQALLAMPFFLHLDRAYLPPLA 160 (380)
T ss_pred CccccccceehhcccccccccccchhccccccccccccccccccccccccCcCCHHHHHHHHhcCchhhhhchhhcCccc
Confidence 111233344567666665432111 000 011223 59999999999999999999999999999
Q ss_pred HHhhcCChHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhhHHHHHHHHHHhCCCCcceeeEEEEEE
Q psy15482 141 DALLNGSPEDFERILRQQYEEREKREQLRLRMLNAHPFDTEAQKLIAEEIKKNNIEANMEAAMEYNPETFGTVVMLYINC 220 (302)
Q Consensus 141 ~al~~~d~e~f~~~lr~~~~~~~~~e~~~~~~l~~DP~d~e~Q~~i~e~i~q~~i~~n~~~A~E~~PE~f~~v~mlyi~~ 220 (302)
.++..+|.+.|.+.+++++..+..++..+.+++++||||+|+|+||+|.|+|++|+|||.+|+||+||.|+.|.||||||
T Consensus 161 ~~l~~g~~~k~~~~~~~~q~d~~rr~~~~~rl~eanPfd~E~q~rIee~irq~~i~eq~~~ai~~~pe~f~~v~ML~iN~ 240 (380)
T KOG0012|consen 161 ALLVLGDLEKFDRTLKEMQKDYQRRSVHQRRLLEANPFDLEAQRRIEEKIRQNAIDEQMSHAIEYHPEDFTQVTMLYINC 240 (380)
T ss_pred hhhcccchhhhhhhhhhhccccchhhhhhHHHHhcCCcchhhhhhhhHHHHHHHHHHHHHHhhhcCccccccceEEEEEE
Confidence 99999999999999998777777778888899999999999999999999999999999999999999999999999999
Q ss_pred EEcCeeEEEEEcCCCccccCCHHHHHHcCchhhhhccccceecccCcceeeeEEEEeeeeecccccc
Q psy15482 221 KVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNFNGD 287 (302)
Q Consensus 221 ~ing~~v~a~vDsGaq~~i~s~~~a~~~gl~~~~d~~~~~~a~gvg~~~i~G~i~~~~~~ig~~~~~ 287 (302)
+|||+|||||||||||+||||.+|||||||.+|||+||.|+|+|||+.||+|+||+++++||+.|++
T Consensus 241 ~ing~~VKAfVDsGaq~timS~~Caer~gL~rlid~r~~g~a~gvg~~ki~g~Ih~~~lki~~~~l~ 307 (380)
T KOG0012|consen 241 EINGVPVKAFVDSGAQTTIMSAACAERCGLNRLIDKRFQGEARGVGTEKILGRIHQAQLKIEDLYLP 307 (380)
T ss_pred EECCEEEEEEEcccchhhhhhHHHHHHhChHHHhhhhhhccccCCCcccccceeEEEEEEeccEeec
Confidence 9999999999999999999999999999999999999999999999999999999999999999986
|
|
| >PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein | Back alignment and domain information |
|---|
| >KOG0010|consensus | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >KOG0003|consensus | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >KOG0005|consensus | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >KOG0004|consensus | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >KOG4248|consensus | Back alignment and domain information |
|---|
| >KOG0001|consensus | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >COG3577 Predicted aspartyl protease [General function prediction only] | Back alignment and domain information |
|---|
| >PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
| >cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats | Back alignment and domain information |
|---|
| >TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family | Back alignment and domain information |
|---|
| >KOG0006|consensus | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >KOG4495|consensus | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >KOG3493|consensus | Back alignment and domain information |
|---|
| >COG5417 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1769|consensus | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >KOG1639|consensus | Back alignment and domain information |
|---|
| >KOG3206|consensus | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >PF14453 ThiS-like: ThiS-like ubiquitin | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >PF13019 Telomere_Sde2: Telomere stability and silencing | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >KOG0013|consensus | Back alignment and domain information |
|---|
| >PRK06488 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PRK05863 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08053 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK07696 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK07440 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A | Back alignment and domain information |
|---|
| >cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein | Back alignment and domain information |
|---|
| >PRK06944 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK06083 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >TIGR02958 sec_mycoba_snm4 secretion protein snm4 | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
| >TIGR01683 thiS thiamine biosynthesis protein ThiS | Back alignment and domain information |
|---|
| >smart00666 PB1 PB1 domain | Back alignment and domain information |
|---|
| >cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis | Back alignment and domain information |
|---|
| >COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain | Back alignment and domain information |
|---|
| >KOG4583|consensus | Back alignment and domain information |
|---|
| >PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) | Back alignment and domain information |
|---|
| >cd06094 RP_Saci_like RP_Saci_like, retropepsin family | Back alignment and domain information |
|---|
| >cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) | Back alignment and domain information |
|---|
| >smart00727 STI1 Heat shock chaperonin-binding motif | Back alignment and domain information |
|---|
| >PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins | Back alignment and domain information |
|---|
| >PRK01777 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4250|consensus | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein | Back alignment and domain information |
|---|
| >cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function | Back alignment and domain information |
|---|
| >TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal | Back alignment and domain information |
|---|
| >cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 302 | ||||
| 3s8i_A | 148 | The Retroviral-Like Protease (Rvp) Domain Of Human | 9e-28 | ||
| 2i1a_A | 148 | A Retroviral Protease-Like Domain In The Eukaryotic | 2e-22 | ||
| 1v5o_A | 102 | Solution Structure Of The Ubiquitin-Like Domain Fro | 5e-09 |
| >pdb|3S8I|A Chain A, The Retroviral-Like Protease (Rvp) Domain Of Human Ddi1 Length = 148 | Back alignment and structure |
|
| >pdb|2I1A|A Chain A, A Retroviral Protease-Like Domain In The Eukaryotic Protein Ddi1 Length = 148 | Back alignment and structure |
| >pdb|1V5O|A Chain A, Solution Structure Of The Ubiquitin-Like Domain From Mouse Hypothetical 1700011n24rik Protein Length = 102 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 2e-34 | |
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 1e-29 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 5e-22 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 2e-07 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 7e-07 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 1e-06 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 1e-06 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 2e-06 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 3e-06 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 3e-06 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 3e-06 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 4e-06 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 9e-06 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 1e-05 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 2e-05 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 2e-05 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 3e-05 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 3e-05 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 3e-05 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 4e-05 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 4e-05 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 4e-05 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 8e-05 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 8e-05 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 8e-05 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 8e-05 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 9e-05 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 1e-04 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 1e-04 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 2e-04 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 3e-04 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 4e-04 | |
| 3u5c_F | 225 | RP14, S2, YS8, 40S ribosomal protein S5; translati | 4e-04 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 5e-04 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 6e-04 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 7e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 9e-04 |
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Length = 148 | Back alignment and structure |
|---|
Score = 121 bits (305), Expect = 2e-34
Identities = 46/95 (48%), Positives = 65/95 (68%)
Query: 190 IKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVN 249
+K+ I+ + A+EY PE F V MLYIN ++N YPVKAF+D+GAQTTIMS A++
Sbjct: 1 MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTG 60
Query: 250 IMRLLDTRWAGIAKGVGVQKILGRIHMAIAELTNF 284
+ R++D R+ G A+GVG KI+GRIH A ++
Sbjct: 61 LSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQ 95
|
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 | Back alignment and structure |
|---|
| >3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 99.9 | |
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 99.88 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.77 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.77 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.76 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.76 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.76 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.76 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.75 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.75 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.74 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.74 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.74 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.74 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.73 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.73 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.73 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.72 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.72 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.72 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.72 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.72 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.72 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.72 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.72 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 99.71 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.71 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.71 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.71 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.71 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.71 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.71 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.71 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.7 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.7 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.69 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.69 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.69 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.68 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.68 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.68 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 99.5 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.67 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.67 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.67 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.67 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.67 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.66 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.65 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.65 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.64 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.64 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.64 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.64 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.64 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.63 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.63 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.63 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.63 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.63 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.62 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.62 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.62 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.62 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.61 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.61 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.61 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.61 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.6 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.6 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.6 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.6 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.58 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.56 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.56 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.55 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.55 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.55 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.53 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.52 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.51 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.49 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.48 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 99.47 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.45 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 99.41 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 99.4 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.38 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 99.34 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 99.3 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 99.3 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 99.26 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 99.21 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 99.19 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 99.15 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 99.1 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 99.04 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 98.99 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 98.66 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 98.54 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 98.47 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 98.42 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 98.22 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 98.06 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 98.06 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 97.96 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 97.91 | |
| 1fmb_A | 104 | EIAV protease; hydrolase (acid proteinase), RNA-di | 97.84 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 97.71 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 97.69 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 97.65 | |
| 3slz_A | 132 | GAG-Pro-POL polyprotein; beta sheet and dimer, pro | 97.6 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 97.48 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 97.34 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 97.34 | |
| 2hs1_A | 99 | HIV-1 protease; ultra-high resolution active site | 97.21 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 97.14 | |
| 3ec0_A | 99 | Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 | 97.07 | |
| 2hah_A | 116 | Protease, retropepsin; retroviral, aspartyl, hydro | 96.97 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 96.88 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 96.43 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 96.43 | |
| 3ka2_A | 203 | [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro | 96.36 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 96.24 | |
| 1pve_A | 72 | HHR23B, UV excision repair protein RAD23 homolog B | 96.14 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 96.09 | |
| 2f4m_B | 61 | UV excision repair protein RAD23 homolog B; glycop | 95.94 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 95.83 | |
| 3sqf_A | 114 | Protease; folded monomer, retropepsin, D-type retr | 95.83 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 95.33 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 94.81 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 94.72 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 94.37 | |
| 3liy_A | 116 | Protease; hydrolase, hydrolase-hydrolase inhibitor | 94.32 | |
| 4e71_A | 111 | Plexin-B2, MM1; transmembrane, signaling, RBD, str | 94.28 | |
| 3ka2_A | 203 | [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro | 94.06 | |
| 2rsp_A | 124 | RSV protease; hydrolase(aspartyl proteinase); 2.00 | 93.99 | |
| 2kl0_A | 73 | Putative thiamin biosynthesis THis; structural gen | 93.83 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 93.77 | |
| 2k5p_A | 78 | THis protein, thiamine-biosynthesis protein; NESG, | 93.28 | |
| 2daj_A | 91 | KIAA0977 protein, COBL-like 1; ubiquitin-like doma | 93.0 | |
| 1f0z_A | 66 | THis protein; ubiquitin fold, transport protein; N | 92.93 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 92.71 | |
| 1oey_A | 83 | P67-PHOX, neutrophil cytosol factor 2; immune syst | 92.3 | |
| 2jys_A | 107 | Protease/reverse transcriptase; retroviral proteas | 91.38 | |
| 2r2o_A | 138 | Plexin-B1; effector domain, structural genomics, s | 90.96 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 90.47 | |
| 2juo_A | 89 | GA-binding protein alpha chain; OST, ubiquitin, tr | 88.4 | |
| 2cu3_A | 64 | Unknown function protein; thermus thermophilus HB8 | 87.42 | |
| 3h6n_A | 127 | Plexin-D1; structural genomics consortium, SGC, me | 87.11 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 85.89 | |
| 4e74_A | 117 | Plexin-A4; RBD, structural genomics, structural ge | 85.87 | |
| 1y8x_B | 98 | Ubiquitin-activating enzyme E1C; ubiquitin-conjuga | 85.71 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 85.42 | |
| 1wgk_A | 114 | Riken cDNA 2900073H19 protein; THis domain, ubiqut | 85.31 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 84.62 | |
| 2qjl_A | 99 | URM1, ubiquitin-related modifier 1; ubiquitin-like | 84.24 | |
| 3dwg_C | 93 | 9.5 kDa culture filtrate antigen CFP10A; sulfur ca | 82.35 | |
| 3kuz_A | 126 | Plexin-C1; structural genomics, structural genomic | 81.77 | |
| 2hj1_A | 97 | Hypothetical protein; structural genomics, PSI, pr | 80.38 |
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.90 E-value=2.4e-24 Score=181.29 Aligned_cols=97 Identities=47% Similarity=0.793 Sum_probs=62.0
Q ss_pred HHHhhHHHHHHHHHHhCCCCcceeeEEEEEEEEcCeeEEEEEcCCCccccCCHHHHHHcCchhhhhccccceecccCcce
Q psy15482 190 IKKNNIEANMEAAMEYNPETFGTVVMLYINCKVNGYPVKAFIDSGAQTTIMSLACAERVNIMRLLDTRWAGIAKGVGVQK 269 (302)
Q Consensus 190 i~q~~i~~n~~~A~E~~PE~f~~v~mlyi~~~ing~~v~a~vDsGaq~~i~s~~~a~~~gl~~~~d~~~~~~a~gvg~~~ 269 (302)
|||++|+|||++|+|++||.|.+..++||+|+|||++++|+|||||+.++||.++|++|||....+.++.+.+.|+|..+
T Consensus 1 ~~~~~i~~~~~~a~e~~p~~~~~~~~~~v~v~InG~~~~~LvDTGAs~s~is~~~a~~lgl~~~~~~~~~~~a~g~g~~~ 80 (148)
T 2i1a_A 1 MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTGLSRMIDKRFIGEARGVGTGK 80 (148)
T ss_dssp ----------------------CCCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHHTGGGGCBCCCC----------
T ss_pred CcHHHHHHHHHhhhhhCchhhcccceEEEEEEECCEEEEEEEECCCCccccCHHHHHHcCCCccCCcceEEEEecCCCcc
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999888
Q ss_pred eeeEEEEeeeeeccccc
Q psy15482 270 ILGRIHMAIAELTNFNG 286 (302)
Q Consensus 270 i~G~i~~~~~~ig~~~~ 286 (302)
+.|+++...++||++..
T Consensus 81 ~~~~~~~~~i~ig~~~~ 97 (148)
T 2i1a_A 81 IIGRIHQAQVKIETQYI 97 (148)
T ss_dssp -CEEEEEEEEEETTEEE
T ss_pred cccEEEEEEEEECCEEe
Confidence 99999999999999874
|
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... | Back alignment and structure |
|---|
| >2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* | Back alignment and structure |
|---|
| >4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... | Back alignment and structure |
|---|
| >2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A | Back alignment and structure |
|---|
| >2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 | Back alignment and structure |
|---|
| >2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} | Back alignment and structure |
|---|
| >2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E | Back alignment and structure |
|---|
| >3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* | Back alignment and structure |
|---|
| >1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A | Back alignment and structure |
|---|
| >3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A | Back alignment and structure |
|---|
| >3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 302 | ||||
| d1v5oa_ | 102 | d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu | 9e-11 | |
| d2bwfa1 | 73 | d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc | 3e-09 | |
| d1wxva1 | 81 | d.15.1.1 (A:7-87) Bag-family molecular chaperone r | 2e-08 | |
| d1wgga_ | 96 | d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas | 4e-08 | |
| d1wh3a_ | 87 | d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like | 1e-07 | |
| d1ogwa_ | 76 | d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax | 1e-07 | |
| d1bt0a_ | 73 | d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t | 2e-07 | |
| d1wy8a1 | 76 | d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing | 2e-07 | |
| d1wx9a1 | 73 | d.15.1.1 (A:8-80) Large proline-rich protein BAT3 | 2e-07 | |
| d1v6ea_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol | 3e-07 | |
| d1oqya4 | 77 | d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h | 7e-07 | |
| d1v2ya_ | 105 | d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik | 1e-06 | |
| d2faza1 | 76 | d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing | 1e-06 | |
| d1z2ma2 | 76 | d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot | 2e-06 | |
| d2zeqa1 | 78 | d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin | 3e-06 | |
| d1j8ca_ | 103 | d.15.1.1 (A:) Ubiquitin-like N-terminal domain of | 5e-06 | |
| d1uela_ | 95 | d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol | 8e-06 | |
| d1wx8a1 | 83 | d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul | 3e-05 | |
| d1yqba1 | 84 | d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien | 3e-05 | |
| d1wjua_ | 100 | d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human | 4e-05 | |
| d2uyzb1 | 77 | d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human | 4e-05 | |
| d1v86a_ | 95 | d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous | 2e-04 | |
| d1t0ya_ | 90 | d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol | 5e-04 | |
| d1euvb_ | 79 | d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea | 5e-04 | |
| d2c9wb1 | 103 | d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) | 6e-04 | |
| d1uh6a_ | 100 | d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous | 6e-04 | |
| d1wiaa_ | 95 | d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 | 0.001 | |
| d1z2ma1 | 76 | d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei | 0.002 | |
| d1ttna1 | 80 | d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit | 0.002 | |
| d1zkha1 | 86 | d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t | 0.003 | |
| d1m94a_ | 73 | d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 | 0.003 | |
| d1wjna_ | 97 | d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse | 0.004 | |
| d1we6a_ | 111 | d.15.1.1 (A:) Splicing factor 3 subunit 1, C-termi | 0.004 |
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: 1700011n24rik protein species: Mouse (Mus musculus) [TaxId: 10090]
Score = 55.8 bits (134), Expect = 9e-11
Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 3/95 (3%)
Query: 1 MKVTVSTQH---TNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKT 57
M +TV T F L V+ D EL NF+ CE++SG PA E I + LL D+ +
Sbjct: 8 MLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCS 67
Query: 58 LKTHGIQDGDLVLLKHLGSYHATPAAVIPNFDFSG 92
L ++G++DGD+V+L + P+ SG
Sbjct: 68 LGSYGLKDGDMVVLLQKDNVGLRTPGRTPSGPSSG 102
|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.83 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.82 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.81 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.81 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.8 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.8 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.79 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.79 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.79 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.78 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.78 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.77 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.76 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.76 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.74 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.71 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.71 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.71 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.7 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.7 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.69 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.66 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.65 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.63 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.63 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.62 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.62 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.62 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.59 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.55 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.48 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 99.36 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.35 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.25 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 99.22 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 98.49 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.48 | |
| d2fmba_ | 104 | EIAV protease {Equine infectious anemia virus [Tax | 97.36 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 97.2 | |
| d4fiva_ | 113 | Feline immunodeficiency virus (FIV) protease {Feli | 97.15 | |
| d1nsoa_ | 107 | Mason-Pfizer monkey virus protease {Simian retrovi | 97.08 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 96.82 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.54 | |
| d2f4mb1 | 58 | XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu | 96.45 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 95.75 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 95.47 | |
| d2nmza1 | 99 | Human immunodeficiency virus type 1 protease {Huma | 94.81 | |
| d3ecga1 | 99 | Human immunodeficiency virus type 2 (HIV-2) protea | 94.65 | |
| d2rspa_ | 124 | Rous sarcoma virus protease {Rous sarcoma virus, s | 94.34 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 94.32 | |
| d1hvca_ | 203 | Human immunodeficiency virus type 1 protease {Huma | 93.65 | |
| d1ryja_ | 70 | Hypothetical protein MTH1743 {Archaeon Methanobact | 87.93 | |
| d1y8xb1 | 92 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 86.74 | |
| d1x3zb1 | 57 | Rad23 STI1 domain {Baker's yeast (Saccharomyces ce | 86.72 | |
| d1zud21 | 65 | Thiamin biosynthesis sulfur carrier protein ThiS { | 85.83 | |
| d1oeya_ | 82 | Neutrophil cytosol factor 2 (p67phox component of | 85.79 | |
| d1hvca_ | 203 | Human immunodeficiency virus type 1 protease {Huma | 84.04 | |
| d1xo3a_ | 101 | C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 | 80.5 |
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: Ubiquitin-related domain: 2'-5'-oligoadenylate synthetase-like protein, OASL species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83 E-value=1.2e-20 Score=144.48 Aligned_cols=75 Identities=28% Similarity=0.377 Sum_probs=72.1
Q ss_pred CEEEEEeCCCCeEEEEEeCCCccHHHHHHHHHhhhCCCCCCeEEEECCeecCCCcccccccCCCCCCEEEEEEecCC
Q psy15482 1 MKVTVSTQHTNECFLLDVSEDLELENFKAFCEVQSGYPAHEIAIEFQGVLLQDNKKTLKTHGIQDGDLVLLKHLGSY 77 (302)
Q Consensus 1 MqItV~~~~~g~~~~leV~~~~TV~dLK~~Ie~e~gIp~~~Q~Li~~Gk~L~D~~~TL~~~gI~dgd~l~L~~~~~~ 77 (302)
|+|+|++ .+|++++|+|++++||.+||++|+.++|||+++|+|+|+||+|+|+ +||++|||++|++|||+.+...
T Consensus 8 mqI~Vk~-~~g~~~~l~v~~~~tV~~lK~~I~~~~gip~~~qrLi~~Gk~L~d~-~tL~~y~I~~~stl~l~~r~~~ 82 (87)
T d1wh3a_ 8 IQVFVKN-PDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDW-LGLGIYGIQDSDTLILSKKKGS 82 (87)
T ss_dssp EEEEEEE-TTTEEEEEEECSSSBHHHHHHHHHHHTCCCTTTEEEEETTEECCSS-SBHHHHTCCTTEEEEEEECSCC
T ss_pred EEEEEEC-CCCCEEEEEECCcCcHHHHHHHHHHHHCcChHHeEEEeeceEcCCC-CcHHHcCCCCCCEEEEEecCCC
Confidence 8999999 9999999999999999999999999999999999999999999986 9999999999999999988754
|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} | Back information, alignment and structure |
|---|
| >d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|