Psyllid ID: psy15632


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFIGQ
cccHHHHHHHHHHHHHHEEEEEEEcccccccEEEccccccEEcEEEEEEEcccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccEEEEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEcccHHHHHHHHHHHcccccccccHHHHHHccccccccEEccccc
ccHHHHHHHHHHHHHEEEcccEEEEEEcccccccccccccEcccEccccHcccEEEEEEEEEcEccccHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccEEEEEEEEEEccccEEEEEEEEEcEccccHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccEEEEEEcccEEEccccccccHHHHcHccEEEEEccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEEcHHHHHHHHHHHcHHHccccHHHHHHHcccccccHHEccccc
MNAHHLLHLFLYLTVVSIGfckvtnitdfvpevnidklgkVRGRVTMSHWTKRLIYSfqgipyaippvgkmrfqnmnAHHLLHLFLYLTVVSIGfckvtnitdfvpevnidklgkVRGRVTMSHWTKRLIYSfqgipyaippvgkmrfqgvgislptwqgvgrefltfahlptrlIDYISTEALEDClylnvytpmistnvnqteasqkLFPVIFYIHggsfrvgsshsmtphyllEKDVVLVTIQYRLGILGFlsletneipgnmGFLDMLLALEWVNDHIRsfngdkncvtlmgqsaggaAVTFFltsplvrdgeffEIGFIYAFIVTIIKICFIGQ
MNAHHLLHLFLYLTVVSIGFCKVTnitdfvpevnidklgkvrgrVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTnitdfvpevnidklgkvrgrVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFIGQ
MNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFIGQ
****HLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFI**
****HLL*LFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNV***EASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFI**
MNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFIGQ
*NAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICF***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQNMNAHHLLHLFLYLTVVSIGFCKVTNITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAFIVTIIKICFIGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q63880 571 Carboxylesterase 3A OS=Mu no N/A 0.581 0.345 0.413 2e-33
Q8VCU1 568 Carboxylesterase 3B OS=Mu no N/A 0.648 0.387 0.388 2e-33
Q6UWW8 571 Carboxylesterase 3 OS=Hom yes N/A 0.616 0.366 0.375 8e-33
Q5RCL7 569 Carboxylesterase 3 OS=Pon yes N/A 0.584 0.347 0.384 3e-32
B2D0J5 557 Venom carboxylesterase-6 no N/A 0.619 0.377 0.361 3e-32
P35502 564 Esterase FE4 OS=Myzus per N/A N/A 0.637 0.382 0.385 2e-31
Q07085 554 Esterase CM06B1 OS=Caenor no N/A 0.607 0.371 0.373 4e-31
Q04791 557 Fatty acyl-CoA hydrolase N/A N/A 0.587 0.357 0.379 1e-30
P35501 552 Esterase E4 OS=Myzus pers N/A N/A 0.637 0.391 0.381 2e-30
Q64419 561 Liver carboxylesterase OS N/A N/A 0.598 0.361 0.377 5e-29
>sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 120/220 (54%), Gaps = 23/220 (10%)

Query: 106 PEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREF 165
           PEV+   LG+VRGR      T R++  F GIP+A  P+G +RF       P W+GV R+ 
Sbjct: 37  PEVDT-PLGRVRGRQVGVKDTDRMVNVFLGIPFAQAPLGPLRFSAPLPPQP-WEGV-RDA 93

Query: 166 LTFAHLPTRLIDYISTEAL------------EDCLYLNVYTPMISTNVNQTEASQKLFPV 213
                +  + ++ +S                EDCL LN+Y+P   T  ++        PV
Sbjct: 94  SINPPMCLQDVERMSNSRFTLNEKMKIFPISEDCLTLNIYSPTEITAGDKR-------PV 146

Query: 214 IFYIHGGSFRVGSSHSMTPHYLLE-KDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDML 272
           + +IHGGS  VGSS S     L    DVV+VT+QYRLGI GFLS     +PGN GFLD++
Sbjct: 147 MVWIHGGSLLVGSSTSHDGSALAAYGDVVVVTVQYRLGIFGFLSTGDKHMPGNRGFLDVV 206

Query: 273 LALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPL 312
            AL WV  +I  F GD NCVT+ G SAGG  V+  L SP+
Sbjct: 207 AALRWVQGNIAPFGGDPNCVTIFGNSAGGIIVSSLLLSPM 246




Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=2 SV=1 Back     alignment and function description
>sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 Back     alignment and function description
>sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 Back     alignment and function description
>sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 Back     alignment and function description
>sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 Back     alignment and function description
>sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 Back     alignment and function description
>sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 Back     alignment and function description
>sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 Back     alignment and function description
>sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
313667162 621 carboxylesterase [Laodelphax striatella] 0.598 0.326 0.481 2e-45
170034161 570 glutactin [Culex quinquefasciatus] gi|16 0.604 0.359 0.470 2e-43
158287901 591 AGAP010911-PA [Anopheles gambiae str. PE 0.657 0.377 0.442 6e-43
403182384 515 AAEL000862-PA, partial [Aedes aegypti] 0.584 0.384 0.447 3e-42
157111590 562 carboxylesterase [Aedes aegypti] 0.584 0.352 0.447 4e-42
403182383 550 AAEL000889-PA, partial [Aedes aegypti] 0.678 0.418 0.430 5e-42
157111618 519 carboxylesterase [Aedes aegypti] 0.584 0.381 0.457 1e-41
403182387 520 AAEL000898-PA, partial [Aedes aegypti] 0.581 0.378 0.459 1e-41
321467599285 hypothetical protein DAPPUDRAFT_53255 [D 0.646 0.768 0.454 4e-41
157111588 541 carboxylesterase [Aedes aegypti] 0.610 0.382 0.447 7e-41
>gi|313667162|gb|ADR73024.1| carboxylesterase [Laodelphax striatella] gi|313667164|gb|ADR73025.1| carboxylesterase [Laodelphax striatella] Back     alignment and taxonomy information
 Score =  189 bits (480), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 139/220 (63%), Gaps = 17/220 (7%)

Query: 105 VPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGV--- 161
            P +NI +LG + G    S W+   +Y++Q IPYA+PP G  RF+    + P W GV   
Sbjct: 44  CPILNIPELGSLCGTTDTSAWSNITLYNYQNIPYALPPSGHRRFKPPEPAHP-WNGVLDA 102

Query: 162 ---GREFLTFAHLPTRLIDYI----STEALEDCLYLNVYTPMISTNVNQTEASQKLFPVI 214
              G++    A+    L D      S E + DCL LNVYTP+     ++      L  V+
Sbjct: 103 TKFGKK-CPQANTEKELKDLRTRINSGEDVGDCLTLNVYTPVAPGKCDK----HNLLSVM 157

Query: 215 FYIHGGSFRVGSSHSMTPHYLL-EKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLL 273
           FYIHGGSFRVGS+H   P+YLL E D+VL+  QYRLG LGFLSL+T+E+PG+MGF+DM+L
Sbjct: 158 FYIHGGSFRVGSAHDFRPNYLLDEGDIVLIVPQYRLGPLGFLSLQTDELPGDMGFMDMVL 217

Query: 274 ALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLV 313
           AL+W   +I+ F GD + VTL GQSAGGAAVT  + SPLV
Sbjct: 218 ALKWTQKYIKYFCGDSSRVTLFGQSAGGAAVTLMMASPLV 257




Source: Laodelphax striatella

Species: Laodelphax striatella

Genus: Laodelphax

Family: Delphacidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170034161|ref|XP_001844943.1| glutactin [Culex quinquefasciatus] gi|167875455|gb|EDS38838.1| glutactin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158287901|ref|XP_309784.4| AGAP010911-PA [Anopheles gambiae str. PEST] gi|157019411|gb|EAA05504.4| AGAP010911-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|403182384|gb|EAT48034.2| AAEL000862-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|157111590|ref|XP_001651635.1| carboxylesterase [Aedes aegypti] Back     alignment and taxonomy information
>gi|403182383|gb|EAT48033.2| AAEL000889-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|157111618|ref|XP_001651649.1| carboxylesterase [Aedes aegypti] Back     alignment and taxonomy information
>gi|403182387|gb|EAT48048.2| AAEL000898-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|321467599|gb|EFX78588.1| hypothetical protein DAPPUDRAFT_53255 [Daphnia pulex] Back     alignment and taxonomy information
>gi|157111588|ref|XP_001651634.1| carboxylesterase [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
FB|FBgn0037090 559 Est-Q "Esterase Q" [Drosophila 0.569 0.345 0.461 3e-37
ZFIN|ZDB-GENE-041014-96 1657 si:ch211-93f2.1 "si:ch211-93f2 0.569 0.116 0.411 2.8e-36
FB|FBgn0015575 572 alpha-Est7 "alpha-Esterase-7" 0.542 0.321 0.43 1.1e-34
FB|FBgn0032131 564 CG3841 [Drosophila melanogaste 0.610 0.367 0.428 1.3e-34
WB|WBGene00022178 550 Y71H2AM.13 [Caenorhabditis ele 0.560 0.345 0.443 3.8e-34
UNIPROTKB|Q9BL43 550 Y71H2AM.13 "Protein Y71H2AM.13 0.560 0.345 0.443 3.8e-34
UNIPROTKB|O16695 578 T28C12.4 "Protein T28C12.4, is 0.498 0.292 0.417 4e-34
WB|WBGene00020891 658 T28C12.4 [Caenorhabditis elega 0.498 0.256 0.417 9.9e-34
UNIPROTKB|Q4LDP0 658 T28C12.4 "Protein T28C12.4, is 0.498 0.256 0.417 9.9e-34
FB|FBgn0034736 566 CG6018 [Drosophila melanogaste 0.566 0.339 0.411 1.1e-33
FB|FBgn0037090 Est-Q "Esterase Q" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 400 (145.9 bits), Expect = 3.0e-37, P = 3.0e-37
 Identities = 96/208 (46%), Positives = 117/208 (56%)

Query:   114 GKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAH-LP 172
             G V G    + WT R    F+GIP+A PP+ ++RF+      P W G     L F    P
Sbjct:    51 GTVLGNYAYTAWTDRAFMQFRGIPFAEPPIEELRFRPPVARSP-WTGT-LNALNFGQRCP 108

Query:   173 --TRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSM 230
               T L   +S   LEDCL L+VYT  +S       ASQ   PV+FYI+GG F  GSS   
Sbjct:   109 VITNLDSQMSDAELEDCLTLSVYTKNLS-------ASQ---PVMFYIYGGGFYNGSSEDH 158

Query:   231 TPHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKN 290
              P+YLLEKDVVLV  QYR+G LG+LS  T E+PGN    D+L+AL+WV  HI SF GD  
Sbjct:   159 PPNYLLEKDVVLVVPQYRVGALGWLSTYTEELPGNAPIADILMALDWVQMHISSFGGDPQ 218

Query:   291 CVTLMGQSAGGAAVTFFLTSPLVRDGEF 318
              VT+ GQSAG    +  L SP   D  F
Sbjct:   219 KVTIFGQSAGAGVASSLLLSPKTGDNMF 246




GO:0004091 "carboxylesterase activity" evidence=ISS;IBA
ZFIN|ZDB-GENE-041014-96 si:ch211-93f2.1 "si:ch211-93f2.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0015575 alpha-Est7 "alpha-Esterase-7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032131 CG3841 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00022178 Y71H2AM.13 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BL43 Y71H2AM.13 "Protein Y71H2AM.13" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O16695 T28C12.4 "Protein T28C12.4, isoform b" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00020891 T28C12.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q4LDP0 T28C12.4 "Protein T28C12.4, isoform a" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0034736 CG6018 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 9e-73
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 3e-56
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 5e-47
COG0657 312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 2e-10
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 1e-07
pfam07859207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 2e-07
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 3e-05
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 0.004
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
 Score =  233 bits (596), Expect = 9e-73
 Identities = 92/215 (42%), Positives = 117/215 (54%), Gaps = 21/215 (9%)

Query: 106 PEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREF 165
           P V     GKVRG           +Y+F GIPYA PPVG++RF+        W GV  + 
Sbjct: 1   PVVET-SYGKVRGLRVTVDGGP--VYAFLGIPYAKPPVGELRFK-KPQPPEPWTGV-LDA 55

Query: 166 LTFAHLPTRLIDYIS------TEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHG 219
             +     +  D  S      T   EDCLYLNVYTP       +  +  K  PV+ +IHG
Sbjct: 56  TKYGPACPQNNDLGSEMWNKNTGMSEDCLYLNVYTP-------KLASESKKLPVMVWIHG 108

Query: 220 GSFRVGSSHSMT---PHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALE 276
           G F+ GS+       P     +DVV+VTI YRLG LGFLS   +E+PGN G LD +LAL 
Sbjct: 109 GGFQSGSASLDDYDGPDLAASEDVVVVTINYRLGALGFLSTGDSELPGNAGLLDQVLALR 168

Query: 277 WVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSP 311
           WV D+I +F GD + VTL G+SAG A+V+  L SP
Sbjct: 169 WVKDNIAAFGGDPDNVTLFGESAGAASVSLLLLSP 203


Length = 510

>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
PF00135 535 COesterase: Carboxylesterase family The prints ent 100.0
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 100.0
KOG4389|consensus 601 100.0
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 100.0
KOG1516|consensus 545 100.0
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 99.83
KOG1515|consensus 336 99.83
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.75
PRK10162 318 acetyl esterase; Provisional 99.75
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 99.2
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.2
KOG4627|consensus270 99.16
KOG4389|consensus 601 98.99
KOG4388|consensus 880 98.97
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.93
PLN00021 313 chlorophyllase 98.93
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.91
PRK10115 686 protease 2; Provisional 98.85
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.83
KOG2281|consensus867 98.69
PF00326 213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.69
PRK10566249 esterase; Provisional 98.62
KOG2100|consensus 755 98.6
PRK13604 307 luxD acyl transferase; Provisional 98.58
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.57
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.49
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.46
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.42
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.35
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.33
PLN02298 330 hydrolase, alpha/beta fold family protein 98.32
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.31
PLN02442283 S-formylglutathione hydrolase 98.25
KOG1516|consensus 545 98.23
PRK10985 324 putative hydrolase; Provisional 98.21
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.2
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.19
PLN02385 349 hydrolase; alpha/beta fold family protein 98.14
PHA02857 276 monoglyceride lipase; Provisional 98.07
PLN02652 395 hydrolase; alpha/beta fold family protein 98.07
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.04
PRK00870 302 haloalkane dehalogenase; Provisional 98.02
KOG1552|consensus258 97.98
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.98
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.96
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.96
COG4099387 Predicted peptidase [General function prediction o 97.92
KOG2564|consensus 343 97.88
COG4188 365 Predicted dienelactone hydrolase [General function 97.86
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.84
PLN02872 395 triacylglycerol lipase 97.83
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 97.79
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.74
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.73
COG2945210 Predicted hydrolase of the alpha/beta superfamily 97.73
PLN02511 388 hydrolase 97.72
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 97.71
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.68
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 97.67
KOG1838|consensus 409 97.64
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 97.62
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.61
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.57
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 97.57
PRK10749 330 lysophospholipase L2; Provisional 97.56
PLN02211 273 methyl indole-3-acetate methyltransferase 97.56
PRK11460232 putative hydrolase; Provisional 97.53
PRK03204 286 haloalkane dehalogenase; Provisional 97.53
PF12715 390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 97.52
PRK10673 255 acyl-CoA esterase; Provisional 97.49
KOG1455|consensus 313 97.47
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 97.46
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.45
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 97.44
PLN02965 255 Probable pheophorbidase 97.43
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 97.42
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.41
PLN02894 402 hydrolase, alpha/beta fold family protein 97.41
KOG4391|consensus 300 97.36
PLN02824 294 hydrolase, alpha/beta fold family protein 97.35
COG0400207 Predicted esterase [General function prediction on 97.34
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.26
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 97.25
PF05677 365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.24
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.24
PRK05855 582 short chain dehydrogenase; Validated 97.21
COG0429 345 Predicted hydrolase of the alpha/beta-hydrolase fo 97.2
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 97.17
PRK03592 295 haloalkane dehalogenase; Provisional 97.1
PRK06489 360 hypothetical protein; Provisional 97.1
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.08
PF08538 303 DUF1749: Protein of unknown function (DUF1749); In 97.07
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.0
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 96.95
KOG3847|consensus 399 96.94
KOG2237|consensus 712 96.93
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.92
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 96.92
KOG4178|consensus 322 96.89
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 96.88
PLN02679 360 hydrolase, alpha/beta fold family protein 96.82
PRK10349 256 carboxylesterase BioH; Provisional 96.82
PRK07581 339 hypothetical protein; Validated 96.79
PF06342 297 DUF1057: Alpha/beta hydrolase of unknown function 96.78
COG2936 563 Predicted acyl esterases [General function predict 96.71
KOG3101|consensus283 96.7
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 96.64
COG1647 243 Esterase/lipase [General function prediction only] 96.62
PRK11071190 esterase YqiA; Provisional 96.6
COG1770 682 PtrB Protease II [Amino acid transport and metabol 96.56
KOG4409|consensus 365 96.56
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 96.4
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 96.38
PLN02578 354 hydrolase 96.36
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 96.24
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 96.2
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 96.08
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.03
COG2819264 Predicted hydrolase of the alpha/beta superfamily 96.01
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 95.84
PRK08775 343 homoserine O-acetyltransferase; Provisional 95.69
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 95.64
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 95.61
PF06500 411 DUF1100: Alpha/beta hydrolase of unknown function 95.08
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 94.98
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 94.82
PF00975 229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.7
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 94.52
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 94.3
PRK07868 994 acyl-CoA synthetase; Validated 94.28
PF03583 290 LIP: Secretory lipase ; InterPro: IPR005152 This e 93.96
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 93.95
KOG3975|consensus 301 93.71
KOG4840|consensus 299 93.58
COG1505 648 Serine proteases of the peptidase family S9A [Amin 93.28
KOG1454|consensus 326 93.27
COG4757 281 Predicted alpha/beta hydrolase [General function p 93.22
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 92.67
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 92.55
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 92.53
COG3150191 Predicted esterase [General function prediction on 92.45
PF09752 348 DUF2048: Uncharacterized conserved protein (DUF204 91.9
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 91.84
COG0627 316 Predicted esterase [General function prediction on 91.77
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 91.67
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 91.52
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 91.03
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 90.99
PRK04940180 hypothetical protein; Provisional 90.99
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 90.94
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 90.76
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 90.6
KOG2112|consensus206 90.11
KOG2382|consensus 315 89.93
COG3319 257 Thioesterase domains of type I polyketide synthase 89.25
PF08840 213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 89.07
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 88.97
KOG2624|consensus 403 88.81
PLN02408 365 phospholipase A1 88.3
KOG4667|consensus 269 87.74
PRK06765 389 homoserine O-acetyltransferase; Provisional 87.06
PLN02454 414 triacylglycerol lipase 86.73
KOG3967|consensus297 86.17
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 86.07
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 85.67
PF03283 361 PAE: Pectinacetylesterase 85.16
COG4814 288 Uncharacterized protein with an alpha/beta hydrola 84.54
COG1075 336 LipA Predicted acetyltransferases and hydrolases w 84.18
KOG3724|consensus 973 83.7
KOG2183|consensus 492 83.57
PLN02324 415 triacylglycerol lipase 82.73
PLN02802 509 triacylglycerol lipase 82.36
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 82.27
PLN02571 413 triacylglycerol lipase 82.12
PF02273 294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 81.58
PLN02753 531 triacylglycerol lipase 81.29
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 80.98
PLN02761 527 lipase class 3 family protein 80.61
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
Probab=100.00  E-value=2.3e-56  Score=450.20  Aligned_cols=215  Identities=41%  Similarity=0.689  Sum_probs=162.0

Q ss_pred             cCCCCCEEEcCcCceEEEEEeeeecCCcceEEecCCcccCCCCCCCCCCCCCCCCCCccccccccccCCCCCcccccC--
Q psy15632        101 ITDFVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDY--  178 (339)
Q Consensus       101 ~~~~~~~v~~~~~G~~~G~~~~~~~~~~~~~~f~gIPyA~pP~g~~Rf~~~p~~~~~w~~~~~a~~~~~~c~q~~~~~--  178 (339)
                      ...+.++|+|+ +|+|+|+ ......+..+++|+|||||+||+|++||++ |+++.+|+++++|+.+++.|+|.....  
T Consensus        19 ~~~~~~~v~~~-~g~i~G~-~~~~~~~~~v~~f~gIpYA~pP~g~~Rf~~-p~~~~~~~~~~~a~~~~~~C~Q~~~~~~~   95 (535)
T PF00135_consen   19 AQASSPVVTTS-YGKIRGI-RVNTDDGKGVYSFLGIPYAQPPVGELRFRP-PQPPPPWSGVRDATKYGPACPQPPPPGPS   95 (535)
T ss_dssp             CCSTCCEEEET-TEEEEEE-EEEESTCCEEEEEEEEESSE---GGGTTS---EB--S-SSEEETBS---BESCECTTSSH
T ss_pred             ccCCCCEEEEC-CeEEEeE-EEecCCCcceEEEeCcccCCCCCCCccccc-ccccccchhhhhhhhcccccccccccccc
Confidence            33456799999 9999997 333323368999999999999999999999 999999999999999999999987642  


Q ss_pred             ---C-CCCCCCcceEEEEEecccccCCCccccccCCcCEEEEEecCccccCCCCC--C-chhHHhcCCeEEEEECCcCCc
Q psy15632        179 ---I-STEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHS--M-TPHYLLEKDVVLVTIQYRLGI  251 (339)
Q Consensus       179 ---~-~~~~sedcL~l~Iy~P~~~~~~~~~~~~~~~~PViv~iHGGg~~~g~~~~--~-~~~~~~~~g~ivV~~nYRlg~  251 (339)
                         . ....+||||+||||+|.    ....   ..++|||||||||+|..|+.+.  + ....++++++|||++|||||+
T Consensus        96 ~~~~~~~~~sEDCL~LnI~~P~----~~~~---~~~lPV~v~ihGG~f~~G~~~~~~~~~~~~~~~~~vivVt~nYRlg~  168 (535)
T PF00135_consen   96 PGFNPPVGQSEDCLYLNIYTPS----NASS---NSKLPVMVWIHGGGFMFGSGSFPPYDGASLAASKDVIVVTINYRLGA  168 (535)
T ss_dssp             HHCSHSSHBES---EEEEEEET----SSSS---TTSEEEEEEE--STTTSSCTTSGGGHTHHHHHHHTSEEEEE----HH
T ss_pred             cccccccCCCchHHHHhhhhcc----cccc---ccccceEEEeecccccCCCcccccccccccccCCCEEEEEecccccc
Confidence               1 12359999999999997    3222   1279999999999999999843  3 346667899999999999999


Q ss_pred             cCCCCCCCCCCC-CCchHHHHHHHHHHHHHhhhhcCCCCCcEEEEeecchHHHHHHHHhCcCcCCCcccccchhhHH
Q psy15632        252 LGFLSLETNEIP-GNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFIYAF  327 (339)
Q Consensus       252 ~Gf~~~~~~~~~-~n~gl~D~~~Al~wv~~~i~~fggDp~~I~l~G~SaGg~~a~~l~~~~~~~~~~~~~~~~~~~~  327 (339)
                      |||+++++...+ +|.||.||++||+||++||+.|||||+||||+||||||.++..|++++.+++  +|+.+++.|-
T Consensus       169 ~Gfl~~~~~~~~~gN~Gl~Dq~~AL~WV~~nI~~FGGDp~~VTl~G~SAGa~sv~~~l~sp~~~~--LF~raI~~SG  243 (535)
T PF00135_consen  169 FGFLSLGDLDAPSGNYGLLDQRLALKWVQDNIAAFGGDPDNVTLFGQSAGAASVSLLLLSPSSKG--LFHRAILQSG  243 (535)
T ss_dssp             HHH-BSSSTTSHBSTHHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEETHHHHHHHHHHHGGGGTT--SBSEEEEES-
T ss_pred             cccccccccccCchhhhhhhhHHHHHHHHhhhhhcccCCcceeeeeecccccccceeeecccccc--cccccccccc
Confidence            999999888777 9999999999999999999999999999999999999999999999988776  4555554443



Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....

>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 5e-29
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 5e-29
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 6e-29
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 6e-29
2w6c_X 586 Ache In Complex With A Bis-(-)-Nor-Meptazinol Deriv 2e-28
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 3e-28
1fss_A 537 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 3e-28
1ut6_A 537 Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Co 3e-28
1som_A 543 Torpedo Californica Acetylcholinesterase Inhibited 3e-28
3i6m_A 534 3d Structure Of Torpedo Californica Acetylcholinest 3e-28
1gqr_A 532 Acetylcholinesterase (E.C. 3.1.1.7) Complexed With 3e-28
1eea_A 534 Acetylcholinesterase Length = 534 3e-28
2cek_A 535 Conformational Flexibility In The Peripheral Site O 4e-28
3gel_A 532 O-Methylphosphorylated Torpedo Acetylcholinesterase 1e-27
2c58_A 537 Torpedo Californica Acetylcholinesterase In Complex 1e-27
2dfp_A 534 X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluo 1e-27
2j4c_A 529 Structure Of Human Butyrylcholinesterase In Complex 1e-27
1p0i_A 529 Crystal Structure Of Human Butyryl Cholinesterase L 2e-27
2wsl_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 2e-27
2pm8_A 574 Crystal Structure Of Recombinant Full Length Human 2e-27
2wil_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 2e-27
2wif_A 529 Aged Form Of Human Butyrylcholinesterase Inhibited 2e-27
2xqf_A 527 X-Ray Structure Of Human Butyrylcholinesterase Inhi 2e-27
3o9m_A 574 Co-Crystallization Studies Of Full Length Recombina 2e-27
2xmb_A 529 G117h Mutant Of Human Butyrylcholinesterase In Comp 2e-27
2wid_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 2e-27
4aqd_A 531 Crystal Structure Of Fully Glycosylated Human Butyr 3e-27
4axb_A 527 Crystal Structure Of Soman-aged Human Butyrylcholin 6e-27
2y1k_A 529 Structure Of Human Butyrylcholinesterase Inhibited 7e-27
4b0o_A 529 Crystal Structure Of Soman-Aged Human Butyrylcholin 7e-27
3djy_A 529 Nonaged Form Of Human Butyrylcholinesterase Inhibit 7e-27
1f8u_A 583 Crystal Structure Of Mutant E202q Of Human Acetylch 2e-26
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 2e-26
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 3e-26
2fj0_A 551 Crystal Structure Of Juvenile Hormone Esterase From 3e-26
1qe3_A 489 Pnb Esterase Length = 489 6e-26
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 6e-26
3lii_A 540 Recombinant Human Acetylcholinesterase Length = 540 6e-26
4ey4_A 542 Crystal Structure Of Recombinant Human Acetylcholin 6e-26
1b41_A 539 Human Acetylcholinesterase Complexed With Fasciculi 6e-26
1c7j_A 489 Pnb Esterase 56c8 Length = 489 1e-25
2x8b_A 583 Crystal Structure Of Human Acetylcholinesterase Inh 2e-25
1jmy_A 522 Truncated Recombinant Human Bile Salt Stimulated Li 4e-25
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 8e-25
1maa_A 547 Mouse Acetylcholinesterase Catalytic Domain, Glycos 1e-24
1c2o_A 539 Electrophorus Electricus Acetylcholinesterase Lengt 1e-24
2c0p_A 548 Aged Form Of Mouse Acetylcholinesterase Inhibited B 1e-24
1q83_A 580 Crystal Structure Of The Mouse Acetylcholinesterase 1e-24
2xuf_A 544 Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Comple 1e-24
1c2b_A 540 Electrophorus Electricus Acetylcholinesterase Lengt 1e-24
4a16_A 545 Structure Of Mouse Acetylcholinesterase Complex Wit 1e-24
1ku6_A 549 Fasciculin 2-Mouse Acetylcholinesterase Complex Len 1e-24
1n5m_A 541 Crystal Structure Of The Mouse Acetylcholinesterase 1e-24
1mah_A 543 Fasciculin2-Mouse Acetylcholinesterase Complex Leng 1e-24
2xud_A 543 Crystal Structure Of The Y337a Mutant Of Mouse Acet 1e-24
1f6w_A 533 Structure Of The Catalytic Domain Of Human Bile Sal 1e-24
1aql_A 532 Crystal Structure Of Bovine Bile-Salt Activated Lip 1e-24
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 2e-24
1akn_A 579 Structure Of Bile-salt Activated Lipase Length = 57 2e-24
2bce_A 579 Cholesterol Esterase From Bos Taurus Length = 579 2e-24
2ha4_A 543 Crystal Structure Of Mutant S203a Of Mouse Acetylch 2e-24
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 3e-24
2whp_B 548 Crystal Structure Of Acetylcholinesterase, Phosphon 3e-24
2jgf_A 548 Crystal Structure Of Mouse Acetylcholinesterase Inh 4e-24
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 1e-23
3dl7_A 538 Aged Form Of Mouse Acetylcholinesterase Inhibited B 2e-23
2jge_B 533 Crystal Structure Of Mouse Acetylcholinesterase Inh 2e-23
2jgj_B 535 Crystal Structure Of Mouse Acetylcholinesterase Inh 2e-23
3dl7_B 534 Aged Form Of Mouse Acetylcholinesterase Inhibited B 2e-23
2jgj_A 536 Crystal Structure Of Mouse Acetylcholinesterase Inh 2e-23
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 4e-23
1dx4_A 585 Ache From Drosophila Melanogaster Complex With Tacr 2e-21
1lpm_A 549 A Structural Basis For The Chiral Preferences Of Li 5e-18
1crl_A 534 Insights Into Interfacial Activation From An 'open' 5e-18
1ukc_A 522 Crystal Structure Of Aspergillus Niger Esta Length 7e-18
1gz7_A 534 Crystal Structure Of The Closed State Of Lipase 2 F 2e-17
1thg_A 544 1.8 Angstroms Refined Structure Of The Lipase From 4e-17
1cle_A 534 Structure Of Uncomplexed And Linoleate-Bound Candid 8e-17
1llf_A 534 Cholesterol Esterase (Candida Cylindracea) Crystal 8e-17
2hm7_A 310 Crystal Structure Analysis Of The G84s Est2 Mutant 6e-05
3ain_A 323 R267g Mutant Of A Hsl-Like Carboxylesterase From Su 2e-04
3aim_A 323 R267e Mutant Of A Hsl-Like Carboxylesterase From Su 2e-04
3aio_A 323 R267k Mutant Of A Hsl-Like Carboxylesterase From Su 2e-04
3aik_A 323 Crystal Structure Of A Hsl-Like Carboxylesterase Fr 2e-04
1evq_A 310 The Crystal Structure Of The Thermophilic Carboxyle 2e-04
1lzk_A 323 Bacterial Heroin Esterase Complex With Transition S 2e-04
1qz3_A 310 Crystal Structure Of Mutant M211sR215L OF CARBOXYLE 2e-04
1lzl_A 323 Bacterial Heroin Esterase Length = 323 2e-04
2c7b_A 311 The Crystal Structure Of Este1, A New Thermophilic 3e-04
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure

Iteration: 1

Score = 124 bits (312), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 80/216 (37%), Positives = 111/216 (51%), Gaps = 22/216 (10%) Query: 114 GKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVG----------- 162 GKV G+ + + F GIP+A PP+G +RF + P W V Sbjct: 13 GKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEP-WSFVKNATSYPPMCTQ 71 Query: 163 --REFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGG 220 + + L T + I + EDCLYLN+YTP T N+ PV+ +IHGG Sbjct: 72 DPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNR-------LPVMVWIHGG 124 Query: 221 SFRVGSSHSMTPHYLLE-KDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDMLLALEWVN 279 VG++ + L ++VV+VTIQYRLGI GF S GN G LD + AL WV Sbjct: 125 GLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQ 184 Query: 280 DHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRD 315 D+I SF G+ VT+ G+SAGG +V+ + SPL ++ Sbjct: 185 DNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKN 220
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative Length = 586 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|1FSS|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Fasciculin-Ii Length = 537 Back     alignment and structure
>pdb|1UT6|A Chain A, Structure Of Acetylcholinesterase (E.C. 3.1.1.7) Complexed With N-9-(1',2',3',4'-Tetrahydroacridinyl)-1,8- Diaminooctane At 2.4 Angstroms Resolution. Length = 537 Back     alignment and structure
>pdb|1SOM|A Chain A, Torpedo Californica Acetylcholinesterase Inhibited By Nerve Agent Gd (Soman). Length = 543 Back     alignment and structure
>pdb|3I6M|A Chain A, 3d Structure Of Torpedo Californica Acetylcholinesterase Complexed With N-Piperidinopropyl-Galanthamine Length = 534 Back     alignment and structure
>pdb|1GQR|A Chain A, Acetylcholinesterase (E.C. 3.1.1.7) Complexed With Rivastigmine Length = 532 Back     alignment and structure
>pdb|1EEA|A Chain A, Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2CEK|A Chain A, Conformational Flexibility In The Peripheral Site Of Torpedo Californica Acetylcholinesterase Revealed By The Complex Structure With A Bifunctional Inhibitor Length = 535 Back     alignment and structure
>pdb|3GEL|A Chain A, O-Methylphosphorylated Torpedo Acetylcholinesterase Obtained By Reaction With Methyl Paraoxon (Aged) Length = 532 Back     alignment and structure
>pdb|2C58|A Chain A, Torpedo Californica Acetylcholinesterase In Complex With 20mm Acetylthiocholine Length = 537 Back     alignment and structure
>pdb|2DFP|A Chain A, X-Ray Structure Of Aged Di-Isopropyl-Phosphoro-Fluoridate (Dfp) Bound To Acetylcholinesterase Length = 534 Back     alignment and structure
>pdb|2J4C|A Chain A, Structure Of Human Butyrylcholinesterase In Complex With 10mm Hgcl2 Length = 529 Back     alignment and structure
>pdb|1P0I|A Chain A, Crystal Structure Of Human Butyryl Cholinesterase Length = 529 Back     alignment and structure
>pdb|2WSL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta4 Length = 529 Back     alignment and structure
>pdb|2PM8|A Chain A, Crystal Structure Of Recombinant Full Length Human Butyrylcholinesterase Length = 574 Back     alignment and structure
>pdb|2WIL|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta5 Length = 529 Back     alignment and structure
>pdb|2WIF|A Chain A, Aged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|2XQF|A Chain A, X-Ray Structure Of Human Butyrylcholinesterase Inhibited By Racemic Vx Length = 527 Back     alignment and structure
>pdb|3O9M|A Chain A, Co-Crystallization Studies Of Full Length Recombinant Bche With Cocaine Offers Insights Into Cocaine Detoxification Length = 574 Back     alignment and structure
>pdb|2XMB|A Chain A, G117h Mutant Of Human Butyrylcholinesterase In Complex With Sulfate Length = 529 Back     alignment and structure
>pdb|2WID|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Analogue Ta1 Length = 529 Back     alignment and structure
>pdb|4AQD|A Chain A, Crystal Structure Of Fully Glycosylated Human Butyrylcholinesterase Length = 531 Back     alignment and structure
>pdb|4AXB|A Chain A, Crystal Structure Of Soman-aged Human Butyrylcholinesterase In Complex With 2-pam Length = 527 Back     alignment and structure
>pdb|2Y1K|A Chain A, Structure Of Human Butyrylcholinesterase Inhibited By Cbdp ( 12h Soak): Phosphoserine Adduct Length = 529 Back     alignment and structure
>pdb|4B0O|A Chain A, Crystal Structure Of Soman-Aged Human Butyrylcholinesterase In Complex With Benzyl Pyridinium-4-Methyltrichloroacetimidate Length = 529 Back     alignment and structure
>pdb|3DJY|A Chain A, Nonaged Form Of Human Butyrylcholinesterase Inhibited By Tabun Length = 529 Back     alignment and structure
>pdb|1F8U|A Chain A, Crystal Structure Of Mutant E202q Of Human Acetylcholinesterase Complexed With Green Mamba Venom Peptide Fasciculin-ii Length = 583 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|2FJ0|A Chain A, Crystal Structure Of Juvenile Hormone Esterase From Manduca Sexta, With Otfp Covalently Attached Length = 551 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure
>pdb|3LII|A Chain A, Recombinant Human Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|4EY4|A Chain A, Crystal Structure Of Recombinant Human Acetylcholinesterase In The Apo State Length = 542 Back     alignment and structure
>pdb|1B41|A Chain A, Human Acetylcholinesterase Complexed With Fasciculin-Ii, Glycosylated Protein Length = 539 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|2X8B|A Chain A, Crystal Structure Of Human Acetylcholinesterase Inhibited By Aged Tabun And Complexed With Fasciculin-Ii Length = 583 Back     alignment and structure
>pdb|1JMY|A Chain A, Truncated Recombinant Human Bile Salt Stimulated Lipase Length = 522 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1MAA|A Chain A, Mouse Acetylcholinesterase Catalytic Domain, Glycosylated Protein Length = 547 Back     alignment and structure
>pdb|1C2O|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 539 Back     alignment and structure
>pdb|2C0P|A Chain A, Aged Form Of Mouse Acetylcholinesterase Inhibited By Tabun Length = 548 Back     alignment and structure
>pdb|1Q83|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Tz2pa6 Syn Complex Length = 580 Back     alignment and structure
>pdb|2XUF|A Chain A, Crystal Structure Of Mache-Y337a-Tz2pa6 Anti Complex (1 Mth) Length = 544 Back     alignment and structure
>pdb|1C2B|A Chain A, Electrophorus Electricus Acetylcholinesterase Length = 540 Back     alignment and structure
>pdb|4A16|A Chain A, Structure Of Mouse Acetylcholinesterase Complex With Huprine Derivative Length = 545 Back     alignment and structure
>pdb|1KU6|A Chain A, Fasciculin 2-Mouse Acetylcholinesterase Complex Length = 549 Back     alignment and structure
>pdb|1N5M|A Chain A, Crystal Structure Of The Mouse Acetylcholinesterase-Gallamine Complex Length = 541 Back     alignment and structure
>pdb|1MAH|A Chain A, Fasciculin2-Mouse Acetylcholinesterase Complex Length = 543 Back     alignment and structure
>pdb|2XUD|A Chain A, Crystal Structure Of The Y337a Mutant Of Mouse Acetylcholinesterase Length = 543 Back     alignment and structure
>pdb|1F6W|A Chain A, Structure Of The Catalytic Domain Of Human Bile Salt Activated Lipase Length = 533 Back     alignment and structure
>pdb|1AQL|A Chain A, Crystal Structure Of Bovine Bile-Salt Activated Lipase Complexed With Taurocholate Length = 532 Back     alignment and structure
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|1AKN|A Chain A, Structure Of Bile-salt Activated Lipase Length = 579 Back     alignment and structure
>pdb|2BCE|A Chain A, Cholesterol Esterase From Bos Taurus Length = 579 Back     alignment and structure
>pdb|2HA4|A Chain A, Crystal Structure Of Mutant S203a Of Mouse Acetylcholinesterase Complexed With Acetylcholine Length = 543 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|2WHP|B Chain B, Crystal Structure Of Acetylcholinesterase, Phosphonylated By Sarin And In Complex With Hi-6 Length = 548 Back     alignment and structure
>pdb|2JGF|A Chain A, Crystal Structure Of Mouse Acetylcholinesterase Inhibited By Non-Aged Fenamiphos Length = 548 Back     alignment and structure
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure
>pdb|1DX4|A Chain A, Ache From Drosophila Melanogaster Complex With Tacrine Derivative 9-(3-Phenylmethylamino)-1,2,3,4-Tetrahydroacridine Length = 585 Back     alignment and structure
>pdb|1LPM|A Chain A, A Structural Basis For The Chiral Preferences Of Lipases Length = 549 Back     alignment and structure
>pdb|1CRL|A Chain A, Insights Into Interfacial Activation From An 'open' Structure Of Candida Rugosa Lipase Length = 534 Back     alignment and structure
>pdb|1UKC|A Chain A, Crystal Structure Of Aspergillus Niger Esta Length = 522 Back     alignment and structure
>pdb|1GZ7|A Chain A, Crystal Structure Of The Closed State Of Lipase 2 From Candida Rugosa Length = 534 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1CLE|A Chain A, Structure Of Uncomplexed And Linoleate-Bound Candida Cylindracea Cholesterol Esterase Length = 534 Back     alignment and structure
>pdb|1LLF|A Chain A, Cholesterol Esterase (Candida Cylindracea) Crystal Structure At 1.4a Resolution Length = 534 Back     alignment and structure
>pdb|2HM7|A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant Length = 310 Back     alignment and structure
>pdb|3AIN|A Chain A, R267g Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIM|A Chain A, R267e Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIO|A Chain A, R267k Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIK|A Chain A, Crystal Structure Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|1EVQ|A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 Back     alignment and structure
>pdb|1LZK|A Chain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid Length = 323 Back     alignment and structure
>pdb|1QZ3|A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate Length = 310 Back     alignment and structure
>pdb|1LZL|A Chain A, Bacterial Heroin Esterase Length = 323 Back     alignment and structure
>pdb|2C7B|A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 6e-78
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 2e-09
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 1e-74
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 4e-10
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 1e-72
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 1e-07
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 1e-70
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 5e-09
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 3e-70
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 2e-08
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 9e-70
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 3e-08
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 3e-69
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 2e-08
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 3e-64
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 1e-06
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 1e-63
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 2e-06
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 1e-61
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 6e-07
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 3e-61
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 5e-06
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 2e-56
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 1e-05
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 3e-55
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 9e-05
3h04_A 275 Uncharacterized protein; protein with unknown func 8e-13
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 2e-12
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 1e-11
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 2e-10
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 4e-10
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 1e-09
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 2e-09
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 2e-09
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 2e-09
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 3e-09
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 4e-09
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 4e-09
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 7e-09
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 7e-09
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 2e-08
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 2e-08
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 3e-08
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 4e-08
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 1e-07
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 2e-07
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 3e-05
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 5e-05
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 4e-04
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
 Score =  247 bits (633), Expect = 6e-78
 Identities = 72/221 (32%), Positives = 106/221 (47%), Gaps = 24/221 (10%)

Query: 106 PEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGV---- 161
             V   + G +RG    +   K    SF+G+PYA  P+G++RF+     L  WQ      
Sbjct: 8   VVVRT-ESGWIRGLKRRAEGNKS-YASFRGVPYAKQPLGELRFK-ELQPLEPWQDELDAT 64

Query: 162 -------GREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEASQ-KLFPV 213
                    + L    +  R +        E C++ N++ P  +   +  + ++    PV
Sbjct: 65  QEGPVCQQTDVLYGRIMRPRGMS-------EACIHANIHVPYYALPRDAADKNRFAGLPV 117

Query: 214 IFYIHGGSFRVGSSHSMT--PHYLLEKDVVLVTIQYRLGILGFLSLETNEIPGNMGFLDM 271
           + +IHGG F  GS  S    P YL+ KDV+++T  YRL + GFLSL +  +PGN G  DM
Sbjct: 118 LVFIHGGGFAFGSGDSDLHGPEYLVSKDVIVITFNYRLNVYGFLSLNSTSVPGNAGLRDM 177

Query: 272 LLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPL 312
           +  L+WV  +   F G  + VTLMGQSAG AA      S  
Sbjct: 178 VTLLKWVQRNAHFFGGRPDDVTLMGQSAGAAATHILSLSKA 218


>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Length = 326 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 100.0
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 100.0
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 100.0
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 100.0
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 100.0
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 100.0
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 100.0
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 100.0
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 100.0
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 100.0
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 100.0
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 100.0
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 100.0
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 99.9
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 99.83
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.72
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 99.69
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 99.68
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.66
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.65
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.63
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 99.62
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.59
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.58
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.57
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.56
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.55
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 99.52
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.51
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.5
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.49
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 99.48
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 99.44
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 99.41
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.35
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.32
3h04_A 275 Uncharacterized protein; protein with unknown func 99.21
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.16
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.1
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.08
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.04
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.0
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.0
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.97
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.95
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.94
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.93
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.92
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.92
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.92
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.9
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.9
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.87
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.87
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 98.86
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 98.85
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 98.81
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.8
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.78
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.77
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 98.76
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 98.75
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 98.75
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.75
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.75
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.75
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 98.74
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.72
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.72
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.71
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.7
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.7
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.7
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.7
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.7
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.69
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.69
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.67
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.66
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.66
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 98.66
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.66
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.65
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.65
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.64
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.63
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.62
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.61
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.6
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 98.59
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.59
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 98.58
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 98.57
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 98.56
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.56
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.56
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 98.53
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.53
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.53
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.52
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.5
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.49
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 98.48
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.48
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.46
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.45
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.44
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 98.44
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.43
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.42
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.39
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.35
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.34
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.34
3llc_A 270 Putative hydrolase; structural genomics, joint cen 98.3
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 98.3
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.29
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.29
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.28
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 98.28
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 98.27
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.27
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.26
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 98.22
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.21
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.21
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.21
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.21
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.19
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.16
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.16
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 98.15
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.11
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.1
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.1
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.09
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.09
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 98.08
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.07
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 98.05
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 98.04
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.04
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.03
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 98.02
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.01
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 98.01
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.0
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.0
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.0
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.98
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.98
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.98
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.98
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.98
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.97
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.97
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.94
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.94
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 97.93
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.93
4fle_A202 Esterase; structural genomics, PSI-biology, northe 97.93
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.92
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 97.92
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 97.92
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 97.91
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 97.9
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 97.9
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 97.89
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 97.89
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.89
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.89
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 97.89
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 97.88
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.88
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 97.87
1r3d_A 264 Conserved hypothetical protein VC1974; structural 97.87
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.87
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.85
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.85
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.85
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 97.84
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.83
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.83
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 97.83
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.83
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.83
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.82
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 97.8
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 97.79
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.78
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.76
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.76
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 97.75
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 97.74
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 97.74
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.73
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 97.73
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.73
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 97.72
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 97.7
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 97.7
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 97.7
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 97.7
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 97.69
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.68
3pic_A 375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 97.67
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 97.67
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.66
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.65
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.65
1iup_A 282 META-cleavage product hydrolase; aromatic compound 97.65
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 97.63
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.62
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 97.62
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 97.59
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 97.57
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.55
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 97.52
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 97.51
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 97.51
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 97.51
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.5
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 97.5
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 97.5
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 97.49
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.48
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 97.44
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 97.44
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 97.36
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.36
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 96.45
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.33
4g4g_A 433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 97.27
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 97.26
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 97.23
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 97.19
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.16
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.04
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 96.93
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 96.9
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.85
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 96.85
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 96.84
3ds8_A 254 LIN2722 protein; unkonwn function, structural geno 96.72
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 96.49
3fle_A 249 SE_1780 protein; structural genomics, APC61035.1, 96.36
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 96.09
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 95.53
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 95.5
3lp5_A 250 Putative cell surface hydrolase; structural genom 95.44
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 95.39
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 94.91
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 94.76
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 94.45
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 94.28
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 94.16
1ivy_A 452 Human protective protein; carboxypeptidase, serine 93.86
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 93.52
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 93.5
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 93.15
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 92.76
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 90.64
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 89.62
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 89.24
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 88.63
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 87.19
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 81.98
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 80.86
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 80.67
4az3_A 300 Lysosomal protective protein 32 kDa chain; hydrola 80.56
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-49  Score=405.38  Aligned_cols=208  Identities=34%  Similarity=0.619  Sum_probs=172.8

Q ss_pred             CCCEEEcCcCceEEEEEeeeecCCcceEEecCCcccCCCCCCCCCCCCCCCCCCccccccccccCCCCCcccccC-----
Q psy15632        104 FVPEVNIDKLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLIDY-----  178 (339)
Q Consensus       104 ~~~~v~~~~~G~~~G~~~~~~~~~~~~~~f~gIPyA~pP~g~~Rf~~~p~~~~~w~~~~~a~~~~~~c~q~~~~~-----  178 (339)
                      +.++|+|+ +|+|+|. ... ..+..+++|+|||||+||+|++||++ |+|+++|+++++|+.+++.|+|.....     
T Consensus         3 ~~~~V~t~-~G~v~G~-~~~-~~~~~v~~F~GIPYA~pPvG~lRF~~-P~p~~~w~gv~dAt~~g~~C~Q~~~~~~~~~~   78 (585)
T 1dx4_A            3 DRLVVQTS-SGPVRGR-SVT-VQGREVHVYTGIPYAKPPVEDLRFRK-PVPAEPWHGVLDATGLSATCVQERYEYFPGFS   78 (585)
T ss_dssp             CCSEEEET-TEEEECE-EEE-ETTEEEEEEEEEECSCCCCGGGTTSC-CCCCCCCSSCEECSSCCCBCSCCCCCSSTTCH
T ss_pred             CCcEEEeC-CEEEEeE-EEe-cCCceEEEEccCccCCCCCCccCCCC-CcCCCCCcCceeeeecCCCCCCCCcccccccc
Confidence            46799999 9999998 332 24567999999999999999999999 999999999999999999999964211     


Q ss_pred             ------CCCCCCCcceEEEEEecccccCCCc------------------------cccccCCcCEEEEEecCccccCCCC
Q psy15632        179 ------ISTEALEDCLYLNVYTPMISTNVNQ------------------------TEASQKLFPVIFYIHGGSFRVGSSH  228 (339)
Q Consensus       179 ------~~~~~sedcL~l~Iy~P~~~~~~~~------------------------~~~~~~~~PViv~iHGGg~~~g~~~  228 (339)
                            .....+||||+||||+|........                        .....+++|||||||||||..|+..
T Consensus        79 ~~~~~~~~~~~sEDCL~LNV~~P~~~~~~~~~~~~~g~~~~~~~~d~~~~~d~y~p~~~~~~~PV~v~iHGGg~~~g~~~  158 (585)
T 1dx4_A           79 GEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSAT  158 (585)
T ss_dssp             HHHTTSCSSCBCSCCCEEEEEEEC----------------------------------CCSSEEEEEEECCSTTTCCCTT
T ss_pred             ccccccCCCCCCCcCCeEEEEecCcccccccccccccccccccccccccccccccccccCCCCCEEEEECCCcccCCCCC
Confidence                  1234799999999999962100000                        0012357899999999999999987


Q ss_pred             C--CchhHHhc-CCeEEEEECCcCCccCCCCC-------CCCCCCCCchHHHHHHHHHHHHHhhhhcCCCCCcEEEEeec
Q psy15632        229 S--MTPHYLLE-KDVVLVTIQYRLGILGFLSL-------ETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQS  298 (339)
Q Consensus       229 ~--~~~~~~~~-~g~ivV~~nYRlg~~Gf~~~-------~~~~~~~n~gl~D~~~Al~wv~~~i~~fggDp~~I~l~G~S  298 (339)
                      .  +..+.+++ .|++||++|||||+|||+..       .+.+.++|.++.||++||+||++||+.|||||+||+|+|+|
T Consensus       159 ~~~~~~~~l~~~~~~vvv~~nYRlg~~Gfl~~~~~~~~~~~~~~~~n~gl~D~~~al~wv~~ni~~fggDp~~vti~G~S  238 (585)
T 1dx4_A          159 LDIYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGES  238 (585)
T ss_dssp             CGGGCCHHHHHHHTCEEEEECCCCTHHHHCCCGGGSCGGGTTSSCSCHHHHHHHHHHHHHHHSTGGGTEEEEEEEEEEET
T ss_pred             CCCCCchhhhccCCEEEEEecccccchhhcccccccccccCCCCCCcccHHHHHHHHHHHHHHHHHhCCCcceeEEeecc
Confidence            6  56666665 79999999999999999975       24457899999999999999999999999999999999999


Q ss_pred             chHHHHHHHHhCcCcCC
Q psy15632        299 AGGAAVTFFLTSPLVRD  315 (339)
Q Consensus       299 aGg~~a~~l~~~~~~~~  315 (339)
                      |||+++..+++++..++
T Consensus       239 aGg~~v~~~~~~~~~~~  255 (585)
T 1dx4_A          239 AGSSSVNAQLMSPVTRG  255 (585)
T ss_dssp             HHHHHHHHHHHCTTTTT
T ss_pred             hHHHHHHHHHhCCcccc
Confidence            99999999999987765



>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 2e-35
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 7e-07
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 2e-35
d2h7ca1 532 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase 2e-09
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 9e-34
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 3e-06
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 2e-30
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 3e-06
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 7e-30
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 5e-07
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 5e-29
d1ea5a_ 532 c.69.1.1 (A:) Acetylcholinesterase {Pacific electr 2e-06
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 8e-28
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 4e-05
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 1e-26
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 2e-04
d1p0ia_ 526 c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo 2e-26
d1p0ia_ 526 c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo 7e-07
d1qe3a_ 483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 7e-26
d1qe3a_ 483 c.69.1.1 (A:) Thermophilic para-nitrobenzyl estera 1e-06
d1jjia_ 311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 0.001
d1vkha_ 263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 0.004
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Acetylcholinesterase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score =  133 bits (335), Expect = 2e-35
 Identities = 69/245 (28%), Positives = 104/245 (42%), Gaps = 48/245 (19%)

Query: 112 KLGKVRGRVTMSHWTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGV---------- 161
             G VRGR        R ++ + GIPYA PPV  +RF+   +    W GV          
Sbjct: 8   SSGPVRGRSV--TVQGREVHVYTGIPYAKPPVEDLRFRKP-VPAEPWHGVLDATGLSATC 64

Query: 162 -GREFLTFAHLPTRLIDYISTEALEDCLYLNVYTPMISTNVNQTEA-------------- 206
               +  F       I   +T   EDCLY+NV+ P  +   +   A              
Sbjct: 65  VQERYEYFPGFSGEEIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTD 124

Query: 207 ----------SQKLFPVIFYIHGGSFRVGSSHSMTPHYLL---EKDVVLVTIQYRLGILG 253
                     +    P++ +I+GG F  GS+     +  +     +V++ + QYR+G  G
Sbjct: 125 HLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAFG 184

Query: 254 FLSLE-------TNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTF 306
           FL L          E PGN+G  D  LA+ W+ D+  +F G+   +TL G+SAG ++V  
Sbjct: 185 FLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAGSSSVNA 244

Query: 307 FLTSP 311
            L SP
Sbjct: 245 QLMSP 249


>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Length = 532 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Length = 532 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Length = 526 Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Length = 526 Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Length = 483 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 100.0
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 100.0
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 100.0
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 100.0
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 100.0
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 100.0
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 100.0
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 100.0
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 100.0
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 100.0
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.81
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.8
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.77
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.76
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.76
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.62
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.53
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.39
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.14
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.94
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 98.92
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.84
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.8
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 98.78
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 98.77
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.77
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.75
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.72
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.7
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.63
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 98.6
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 98.59
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.59
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.55
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 98.52
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 98.51
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.51
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.49
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 98.4
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 98.4
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 98.4
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.4
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.4
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.35
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.35
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.32
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.32
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.3
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 98.24
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.24
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.22
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.17
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.15
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.12
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.12
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.11
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.06
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.03
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 98.01
d1lnsa3 405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 98.01
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.0
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 97.98
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 97.98
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.98
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.97
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.96
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.95
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.87
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.84
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.82
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.81
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 97.81
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.77
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 97.76
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 97.76
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 97.75
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.71
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.7
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 97.69
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.67
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.55
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.49
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 97.48
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 97.46
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 97.43
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 97.41
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 97.35
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.34
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 97.31
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 97.3
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 97.11
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 96.78
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 96.31
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 96.29
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 95.97
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.63
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 95.24
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 94.51
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 93.53
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 91.34
d2vata1 376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 91.27
d2b61a1 357 Homoserine O-acetyltransferase {Haemophilus influe 90.62
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 87.27
d2pl5a1 362 Homoserine O-acetyltransferase {Leptospira interro 84.98
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 83.02
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 82.51
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 81.75
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 80.44
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Mammalian carboxylesterase (liver carboxylesterase I)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.7e-57  Score=452.09  Aligned_cols=209  Identities=37%  Similarity=0.617  Sum_probs=181.6

Q ss_pred             CCCEEEcCcCceEEEEEeeee-cCCcceEEecCCcccCCCCCCCCCCCCCCCCCCccccccccccCCCCCccccc-----
Q psy15632        104 FVPEVNIDKLGKVRGRVTMSH-WTKRLIYSFQGIPYAIPPVGKMRFQGVGISLPTWQGVGREFLTFAHLPTRLID-----  177 (339)
Q Consensus       104 ~~~~v~~~~~G~~~G~~~~~~-~~~~~~~~f~gIPyA~pP~g~~Rf~~~p~~~~~w~~~~~a~~~~~~c~q~~~~-----  177 (339)
                      +.|+|+|+ +|+|+|. +... ..++.|++|+|||||+||+|++||++ |+|+++|+++++|+++++.|+|....     
T Consensus         2 ~~pvv~t~-~G~v~G~-~~~~~~~~~~v~~f~gIpYA~pP~g~~Rf~~-p~~~~~~~~~~~at~~~~~C~Q~~~~~~~~~   78 (532)
T d2h7ca1           2 SPPVVDTV-HGKVLGK-FVSLEGFAQPVAIFLGIPFAKPPLGPLRFTP-PQPAEPWSFVKNATSYPPMCTQDPKAGQLLS   78 (532)
T ss_dssp             CCCEEEET-TEEEECE-EECCTTCSSCEEEEEEEECSCCCCGGGTTSC-CCCCCCCSSEEECBSCCCEESCCHHHHHHHH
T ss_pred             CCCEEEEC-ceEEEeE-EEeeCCCCcceEEEeccccCCCCCCCCCCCC-CCCCCCCCCceeCccCCCCCCCCCccccccc
Confidence            56999999 9999999 3332 23567999999999999999999999 99999999999999999999996422     


Q ss_pred             --------CCCCCCCCcceEEEEEecccccCCCccccccCCcCEEEEEecCccccCCCCCCch-hHHhcCCeEEEEECCc
Q psy15632        178 --------YISTEALEDCLYLNVYTPMISTNVNQTEASQKLFPVIFYIHGGSFRVGSSHSMTP-HYLLEKDVVLVTIQYR  248 (339)
Q Consensus       178 --------~~~~~~sedcL~l~Iy~P~~~~~~~~~~~~~~~~PViv~iHGGg~~~g~~~~~~~-~~~~~~g~ivV~~nYR  248 (339)
                              .....++||||+||||+|+    ...   .++++|||||||||+|..|+...+.+ .+++++++|||++|||
T Consensus        79 ~~~~~~~~~~~~~~sEDCL~LnI~~P~----~~~---~~~~lPV~v~ihGG~~~~gs~~~~~~~~~~~~~~vIvVt~nYR  151 (532)
T d2h7ca1          79 ELFTNRKENIPLKLSEDCLYLNIYTPA----DLT---KKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYR  151 (532)
T ss_dssp             HHHCCSSSCCCCCEESCCCEEEEEECS----CTT---SCCCEEEEEEECCSTTTSCCSTTSCCHHHHHHHTCEEEEECCC
T ss_pred             ccccccccCCCCCCCCcCCEEEEEECC----CCC---CCCCcEEEEEEeCCcccccccccCCchhhhhcCceEEEEEeec
Confidence                    1234679999999999996    221   22479999999999999999888554 4557789999999999


Q ss_pred             CCccCCCCCCCCCCCCCchHHHHHHHHHHHHHhhhhcCCCCCcEEEEeecchHHHHHHHHhCcCcCCCcccccchh
Q psy15632        249 LGILGFLSLETNEIPGNMGFLDMLLALEWVNDHIRSFNGDKNCVTLMGQSAGGAAVTFFLTSPLVRDGEFFEIGFI  324 (339)
Q Consensus       249 lg~~Gf~~~~~~~~~~n~gl~D~~~Al~wv~~~i~~fggDp~~I~l~G~SaGg~~a~~l~~~~~~~~~~~~~~~~~  324 (339)
                      ||+|||++.++.+.++|.||.||++||+||++||+.|||||+||||+||||||.++.+|++++.+++  +|..+++
T Consensus       152 Lg~~GFl~~~~~~~~gN~Gl~Dq~~AL~WV~~nI~~FGGDp~~VTl~G~SAGa~sv~~~l~sp~~~~--LF~raI~  225 (532)
T d2h7ca1         152 LGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKN--LFHRAIS  225 (532)
T ss_dssp             CHHHHHCCCSSTTCCCCHHHHHHHHHHHHHHHHGGGGTEEEEEEEEEEETHHHHHHHHHHHCGGGTT--SCSEEEE
T ss_pred             cCCCccccccccccccccccHHHHHHHHHHHHHHHHhcCCcceeeeeccccccchHHHHHhhhhccC--cchhhhh
Confidence            9999999999888999999999999999999999999999999999999999999999999999886  4444443



>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure