Psyllid ID: psy16044


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MINLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRKQINIAVDEY
ccccccccccccccccccccccccccEEccccccccccccEEEEEEcccccccccEEEEEEEEcccEEEEcccccccccccccccccEEEEEcEEccccccccEEEEcccEEEEccccccccccEEEEEEccccccccccccEEcccccccccccccccEEEEEccccccccccccccEEEEEEcccHHHHccccccccccccccEEccccccccccccccccccccEEEccccEEEEEEEEEcccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccEEcccccccccccccccEEEEEccccccccccccccEEEEEEcccHHHHccccccccccccccEEccccccccccccccccccccEEEccccEEEEEEEEEcccccccccccEEEcccccHHHHHHHHccccccc
cEEEEccccccHHccccccccccccHcEccEEccccccccEEEEEEEccccccccEEEEEEEEEccEEEEcHHHHcccccccccccEEEEEEEccccccccccEEEEEEEEEEEccccccccccEEEEEEccccEEccccEccEEcccccccccccccEEEEEEccccccccccHHHHEEEEEEEEcHHHHHHHccccccccccEEEEEccccccEccccccccEEEEEcccccEEEEEEEEEccccccccccccEEEHHHHHHHHHEEEcccccccccccccEEEEEEccccEEcccEEEcEEcccccccccccccEEEEEEccccccccccHHHHEEEEEEEEcHHHHHHHccccccccccEEEEEccccccEccccccccEEEEEcccccEEEEEEEEEccccccccccEEEEEcHHHHHHHHHHHccccccc
minlcdtvtfardcgvgiryshrqprlingkesirgawpwqVSLQVlhprlglmphwcgavlihpswvVTAAhcihndifslpipelwtavlgdwdrteeeksevripverIRVHEEFHNYHHDIALlklsrptsardkgvravcltdadkrpvnpkqqcvatgwgrvkpkgdlvSKLRqirvplhnisvcrdkygdsvelhgghlcggqldgfsgacigdsggplqcslkdgrwylagitsfgsgycgvgiryshrqprlingkesirgawpwqNLITSFLSAALLKlsrptsardkgvravcltdadkrpvnpkqqcvatgwgrvkpkgdlvSKLRqirvplhnisvcrdkygdsvelhgghlcggqldgfsgacigdsggplqcslkdgrwYLAGITsfgsgcaksgypdvytklsfylPWIRKQINIAVDEY
minlcdtvtfardcgvgiryshrqprlingkesirgawPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDwdrteeeksevripverIRVHEEFHNYHHDiallklsrptsardKGVRAVcltdadkrpvnpkqqcvatgwgrvkpkgdlvsklrqirvplhnisvCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSrptsardkgVRAVCltdadkrpvnpkqqcvatgwgrvkpkgdlvsklrqirvplhnisvCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSfylpwirkqiniavdey
MINLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRKQINIAVDEY
**NLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPT*ARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRKQINIAV***
MINLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDR***********VERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRK**N******
MINLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWD********VRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRKQINIAVDEY
MINLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRKQIN******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINLCDTVTFARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVGIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGCAKSGYPDVYTKLSFYLPWIRKQINIAVDEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query436 2.2.26 [Sep-21-2011]
Q9DBI0811 Transmembrane protease se yes N/A 0.479 0.257 0.390 3e-31
Q5QSK2417 Transmembrane protease se yes N/A 0.488 0.510 0.389 4e-31
Q8BZ10417 Transmembrane protease se no N/A 0.488 0.510 0.394 7e-31
P56677855 Suppressor of tumorigenic no N/A 0.532 0.271 0.356 7e-31
Q7M3E1268 Chymotrypsin-C OS=Bos tau no N/A 0.516 0.839 0.352 1e-30
Q8IU80811 Transmembrane protease se yes N/A 0.479 0.257 0.390 1e-29
Q9JIQ8490 Transmembrane protease se no N/A 0.511 0.455 0.380 2e-29
Q9CR35263 Chymotrypsinogen B OS=Mus no N/A 0.463 0.768 0.378 2e-29
Q3V0Q7336 Transmembrane protease se no N/A 0.529 0.687 0.337 2e-29
Q7RTY8843 Transmembrane protease se no N/A 0.511 0.264 0.374 3e-29
>sp|Q9DBI0|TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus GN=Tmprss6 PE=1 SV=4 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 115/228 (50%), Gaps = 19/228 (8%)

Query: 26  RLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIP 85
           R++ G  S  G WPWQ SLQ+         H CG  LI   WV+TAAHC   D  S+  P
Sbjct: 576 RIVGGTVSSEGEWPWQASLQIRGR------HICGGALIADRWVITAAHCFQED--SMASP 627

Query: 86  ELWTAVLGDWDRTEEEKSEVRIPVERIRVH----EEFHNYHHDIALLKLSRPTSARDKGV 141
           +LWT  LG   +      EV   V R+ +H    E+ H+Y  D+ALL+L  P       V
Sbjct: 628 KLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDY--DVALLQLDHPV-VYSATV 684

Query: 142 RAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVEL 201
           R VCL  A      P Q C  TGWG  +  G + + L+++ V L    +C + Y    ++
Sbjct: 685 RPVCLP-ARSHFFEPGQHCWITGWGAQREGGPVSNTLQKVDVQLVPQDLCSEAY--RYQV 741

Query: 202 HGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCG 249
               LC G   G   AC GDSGGPL C    GRW+LAG+ S+G G CG
Sbjct: 742 SPRMLCAGYRKGKKDACQGDSGGPLVCREPSGRWFLAGLVSWGLG-CG 788




Serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. Can also activate urokinase-type plasminogen activator with low efficiency (By similarity). May play a specialized role in matrix remodeling processes in liver. Required to sense iron deficiency. Overexpression suppresses activation of the HAMP promoter.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q5QSK2|TM11G_RAT Transmembrane protease serine 11G OS=Rattus norvegicus GN=Tmprss11g PE=2 SV=1 Back     alignment and function description
>sp|Q8BZ10|TM11G_MOUSE Transmembrane protease serine 11G OS=Mus musculus GN=Tmprss11g PE=2 SV=2 Back     alignment and function description
>sp|P56677|ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus GN=St14 PE=1 SV=2 Back     alignment and function description
>sp|Q7M3E1|CTRC_BOVIN Chymotrypsin-C OS=Bos taurus GN=CTRC PE=1 SV=2 Back     alignment and function description
>sp|Q8IU80|TMPS6_HUMAN Transmembrane protease serine 6 OS=Homo sapiens GN=TMPRSS6 PE=1 SV=3 Back     alignment and function description
>sp|Q9JIQ8|TMPS2_MOUSE Transmembrane protease serine 2 OS=Mus musculus GN=Tmprss2 PE=2 SV=3 Back     alignment and function description
>sp|Q9CR35|CTRB1_MOUSE Chymotrypsinogen B OS=Mus musculus GN=Ctrb1 PE=2 SV=1 Back     alignment and function description
>sp|Q3V0Q7|TMPSC_MOUSE Transmembrane protease serine 12 OS=Mus musculus GN=Tmprss12 PE=2 SV=1 Back     alignment and function description
>sp|Q7RTY8|TMPS7_HUMAN Transmembrane protease serine 7 OS=Homo sapiens GN=TMPRSS7 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
270002775287 serine protease P16 [Tribolium castaneum 0.552 0.839 0.604 3e-82
328712500308 PREDICTED: ovochymase-1-like [Acyrthosip 0.538 0.762 0.582 1e-77
195112336417 GI22360 [Drosophila mojavensis] gi|19391 0.857 0.896 0.379 1e-71
383856150314 PREDICTED: transmembrane protease serine 0.5 0.694 0.570 4e-69
328777878309 PREDICTED: serine protease 15 [Apis mell 0.5 0.705 0.561 5e-69
380023164293 PREDICTED: chymotrypsin-like elastase fa 0.5 0.744 0.561 1e-68
340717332318 PREDICTED: chymotrypsin-like elastase fa 0.5 0.685 0.565 2e-68
350407648318 PREDICTED: chymotrypsin-like elastase fa 0.5 0.685 0.565 2e-68
307183199328 Acrosin [Camponotus floridanus] 0.5 0.664 0.547 3e-65
307212507320 Ovochymase-2 [Harpegnathos saltator] 0.541 0.737 0.514 2e-64
>gi|270002775|gb|EEZ99222.1| serine protease P16 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  311 bits (798), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 187/250 (74%), Gaps = 9/250 (3%)

Query: 4   LCDTVTFARDCGVGIRYSHRQPR------LINGKESIRGAWPWQVSLQVLHPRLGLMPHW 57
           +C +++  +DCG  +R S RQPR      +I+GK+S+RGAWPWQVSLQ+LHP+ G + HW
Sbjct: 11  MCGSMSAFQDCGRSVRRS-RQPRVGALGRIIHGKQSVRGAWPWQVSLQLLHPQFGFLGHW 69

Query: 58  CGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEE 117
           CG VLI P W++TAAHC++ND+F+LP+  LWTAVLGDWDR  EEKSE RIPVE I +HE 
Sbjct: 70  CGGVLISPEWLLTAAHCVNNDLFNLPLAALWTAVLGDWDRDVEEKSEQRIPVEEIILHER 129

Query: 118 FHNYHHDIALLKLSRPTS-ARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVS 176
           FHN+ HDIAL+KLSRP   ARD  VRAVCL  + +   N    C+ATGWGR    G L  
Sbjct: 130 FHNFQHDIALMKLSRPVKLARDSRVRAVCLPPS-RLAYNQTDLCIATGWGRDAEDGMLAG 188

Query: 177 KLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWY 236
           KL + RVPLH+ +VCR KYG +V +  GH+C G LDG SG C+GDSGGPLQC+++DGRW 
Sbjct: 189 KLLEARVPLHDNAVCRKKYGHAVSIRSGHMCAGHLDGSSGTCVGDSGGPLQCAMRDGRWM 248

Query: 237 LAGITSFGSG 246
           LAGITSFGSG
Sbjct: 249 LAGITSFGSG 258




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328712500|ref|XP_003244825.1| PREDICTED: ovochymase-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195112336|ref|XP_002000730.1| GI22360 [Drosophila mojavensis] gi|193917324|gb|EDW16191.1| GI22360 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|383856150|ref|XP_003703573.1| PREDICTED: transmembrane protease serine 7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328777878|ref|XP_395901.2| PREDICTED: serine protease 15 [Apis mellifera] Back     alignment and taxonomy information
>gi|380023164|ref|XP_003695397.1| PREDICTED: chymotrypsin-like elastase family member 2A-like [Apis florea] Back     alignment and taxonomy information
>gi|340717332|ref|XP_003397138.1| PREDICTED: chymotrypsin-like elastase family member 2A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350407648|ref|XP_003488148.1| PREDICTED: chymotrypsin-like elastase family member 2A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307183199|gb|EFN70108.1| Acrosin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307212507|gb|EFN88238.1| Ovochymase-2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
FB|FBgn0038447442 CG14892 [Drosophila melanogast 0.309 0.305 0.528 2.8e-78
UNIPROTKB|E1B9Z91095 TMPRSS9 "Uncharacterized prote 0.552 0.220 0.359 3.3e-31
RGD|13095811061 Tmprss9 "transmembrane proteas 0.513 0.211 0.356 4.2e-29
UNIPROTKB|F1NP62 983 F1NP62 "Uncharacterized protei 0.516 0.228 0.337 2.9e-54
UNIPROTKB|F1RIS0 855 F1RIS0 "Uncharacterized protei 0.486 0.247 0.378 5.5e-52
UNIPROTKB|Q7Z4101059 TMPRSS9 "Transmembrane proteas 0.513 0.211 0.379 2.4e-31
UNIPROTKB|I3LDL11047 TMPRSS9 "Uncharacterized prote 0.548 0.228 0.356 3.6e-33
UNIPROTKB|F1N633 935 F1N633 "Uncharacterized protei 0.525 0.244 0.352 5.9e-49
UNIPROTKB|F1NZZ9805 OVCH2 "Uncharacterized protein 0.481 0.260 0.354 8.5e-29
ZFIN|ZDB-GENE-040426-834 556 zgc:55888 "zgc:55888" [Danio r 0.472 0.370 0.367 9.3e-47
FB|FBgn0038447 CG14892 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 421 (153.3 bits), Expect = 2.8e-78, Sum P(2) = 2.8e-78
 Identities = 73/138 (52%), Positives = 97/138 (70%)

Query:    10 FARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVV 69
             F  DCG   R + R PR+I G  +  G +PWQ SL++LHP LG + HWCGAVLIH  W++
Sbjct:    66 FETDCGC--RPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWIL 123

Query:    70 TAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLK 129
             +AAHC+HND+F+LPIP LWT VLG+ DR  E  +E RIPVE+I +H  +HN+ HD+ L+K
Sbjct:   124 SAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRYHNFKHDVVLMK 183

Query:   130 LSRPTS-ARDKGVRAVCL 146
             LS+P    R   +R +CL
Sbjct:   184 LSKPADLTRASNIRRICL 201


GO:0006508 "proteolysis" evidence=IEA;NAS
GO:0004252 "serine-type endopeptidase activity" evidence=IEA;NAS
UNIPROTKB|E1B9Z9 TMPRSS9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1309581 Tmprss9 "transmembrane protease, serine 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP62 F1NP62 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIS0 F1RIS0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z410 TMPRSS9 "Transmembrane protease serine 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDL1 TMPRSS9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N633 F1N633 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZZ9 OVCH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-834 zgc:55888 "zgc:55888" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 9e-66
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 2e-62
pfam00089218 pfam00089, Trypsin, Trypsin 6e-45
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 8e-42
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 3e-39
pfam00089218 pfam00089, Trypsin, Trypsin 3e-26
COG5640413 COG5640, COG5640, Secreted trypsin-like serine pro 3e-17
COG5640 413 COG5640, COG5640, Secreted trypsin-like serine pro 5e-09
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
 Score =  209 bits (535), Expect = 9e-66
 Identities = 86/225 (38%), Positives = 120/225 (53%), Gaps = 16/225 (7%)

Query: 28  INGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPEL 87
           + G E+  G++PWQVSLQ    R     H+CG  LI P WV+TAAHC+++       P  
Sbjct: 2   VGGSEAKIGSFPWQVSLQYTGGR-----HFCGGSLISPRWVLTAAHCVYS-----SAPSN 51

Query: 88  WTAVLGDWDRTEEEKSEVRIPVERIRVHEEFH--NYHHDIALLKLSRPTSARDKGVRAVC 145
           +T  LG  D +  E     I V+++ VH  ++   Y +DIALLKL RP +  D  VR +C
Sbjct: 52  YTVRLGSHDLSSNEGGGQVIKVKKVIVHPNYNPSTYDNDIALLKLKRPVTLSDN-VRPIC 110

Query: 146 LTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGH 205
           L  +    +     C  +GWGR    G L   L+++ VP+ + + C+  Y     +    
Sbjct: 111 LPSSG-YNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVPIVSNAECKRAYSYGGTITDNM 169

Query: 206 LCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGV 250
           LC G L+G   AC GDSGGPL C+  +GR  L GI S+GSG C  
Sbjct: 170 LCAGGLEGGKDACQGDSGGPLVCN-DNGRGVLVGIVSWGSG-CAR 212


Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232

>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 436
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 100.0
KOG3627|consensus256 100.0
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 100.0
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 100.0
COG5640413 Secreted trypsin-like serine protease [Posttransla 99.96
KOG3627|consensus256 99.94
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.92
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.87
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.83
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 99.74
COG5640 413 Secreted trypsin-like serine protease [Posttransla 99.61
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 99.48
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 98.67
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 98.27
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.19
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.06
PRK10898353 serine endoprotease; Provisional 97.94
PRK10139455 serine endoprotease; Provisional 97.9
PRK10942473 serine endoprotease; Provisional 97.81
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 97.29
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 96.15
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 93.68
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 90.18
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 85.09
COG0265347 DegQ Trypsin-like serine proteases, typically peri 82.07
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 81.2
PRK10898353 serine endoprotease; Provisional 80.99
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
Probab=100.00  E-value=5.6e-40  Score=297.75  Aligned_cols=226  Identities=38%  Similarity=0.723  Sum_probs=192.5

Q ss_pred             EeCCcccCCCCCcceEEEeeeccCCCCCCeeeEEEEecCCEEEecCCCcCCCCCCCCCCcceEEEeccccCCccCCceEE
Q psy16044         27 LINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTAVLGDWDRTEEEKSEVR  106 (436)
Q Consensus        27 i~~G~~a~~~~~Pw~v~i~~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~~~~~~~~~~~v~~g~~~~~~~~~~~~~  106 (436)
                      |+||+++..++|||+|+|+...     ..++|+||||+++||||||||+....     ...+.|++|...........+.
T Consensus         1 i~~G~~~~~~~~Pw~v~i~~~~-----~~~~C~GtlIs~~~VLTaAhC~~~~~-----~~~~~v~~g~~~~~~~~~~~~~   70 (232)
T cd00190           1 IVGGSEAKIGSFPWQVSLQYTG-----GRHFCGGSLISPRWVLTAAHCVYSSA-----PSNYTVRLGSHDLSSNEGGGQV   70 (232)
T ss_pred             CcCCeECCCCCCCCEEEEEccC-----CcEEEEEEEeeCCEEEECHHhcCCCC-----CccEEEEeCcccccCCCCceEE
Confidence            6899999999999999998763     16899999999999999999997631     4678899998776654445677


Q ss_pred             EeeeEEEeCCCCCC--CCCceeEEEeCCCCCCCCCceeeeeecCCCCCCCCCCCcEEEEecCccCCCCCccccceeeeee
Q psy16044        107 IPVERIRVHEEFHN--YHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVP  184 (436)
Q Consensus       107 ~~v~~i~~hp~y~~--~~~DiAll~L~~~~~~~~~~v~pi~l~~~~~~~~~~~~~~~~~GwG~~~~~~~~~~~l~~~~~~  184 (436)
                      +.|.++++||+|+.  ..+|||||||++|+. ++.+++|+|||... .....+..+.++|||...........++...+.
T Consensus        71 ~~v~~~~~hp~y~~~~~~~DiAll~L~~~~~-~~~~v~picl~~~~-~~~~~~~~~~~~G~g~~~~~~~~~~~~~~~~~~  148 (232)
T cd00190          71 IKVKKVIVHPNYNPSTYDNDIALLKLKRPVT-LSDNVRPICLPSSG-YNLPAGTTCTVSGWGRTSEGGPLPDVLQEVNVP  148 (232)
T ss_pred             EEEEEEEECCCCCCCCCcCCEEEEEECCccc-CCCcccceECCCcc-ccCCCCCEEEEEeCCcCCCCCCCCceeeEEEee
Confidence            89999999999984  689999999999999 67789999999863 345577899999999987655566789999999


Q ss_pred             ccchhhhhhhcCCCcCCcCCeEEeccCCCCCCCccCCCCCeeeeEecCCcEEEEEEEeEcCCCCC---CCccccccccee
Q psy16044        185 LHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCG---VGIRYSHRQPRL  261 (436)
Q Consensus       185 ~~~~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gDsGgPl~~~~~~~~~~l~GI~S~g~~~C~---~~~~y~~v~~~~  261 (436)
                      +++...|...+.......+.++|+.......+.|.|||||||++.. +++|+|+||+|+|.. |+   .+.+|+++..+.
T Consensus       149 ~~~~~~C~~~~~~~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~-~~~~~lvGI~s~g~~-c~~~~~~~~~t~v~~~~  226 (232)
T cd00190         149 IVSNAECKRAYSYGGTITDNMLCAGGLEGGKDACQGDSGGPLVCND-NGRGVLVGIVSWGSG-CARPNYPGVYTRVSSYL  226 (232)
T ss_pred             eECHHHhhhhccCcccCCCceEeeCCCCCCCccccCCCCCcEEEEe-CCEEEEEEEEehhhc-cCCCCCCCEEEEcHHhh
Confidence            9999999988865345667999998876568899999999999985 589999999999987 77   457899999999


Q ss_pred             cCCcc
Q psy16044        262 INGKE  266 (436)
Q Consensus       262 ~~~~~  266 (436)
                      .||.+
T Consensus       227 ~WI~~  231 (232)
T cd00190         227 DWIQK  231 (232)
T ss_pred             HHhhc
Confidence            99975



Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.

>KOG3627|consensus Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 1e-29
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 2e-16
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 3e-28
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 3e-14
2any_A241 Expression, Crystallization And The Three-Dimension 3e-28
2any_A241 Expression, Crystallization And The Three-Dimension 6e-19
2anw_A241 Expression, Crystallization And Three-Dimensional S 8e-28
2anw_A241 Expression, Crystallization And Three-Dimensional S 8e-19
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 1e-27
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 3e-14
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 1e-27
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 3e-16
1pyt_C253 Ternary Complex Of Procarboxypeptidase A, Proprotei 2e-27
1pyt_C253 Ternary Complex Of Procarboxypeptidase A, Proprotei 3e-14
1bru_P241 Structure Of Porcine Pancreatic Elastase Complexed 3e-27
1bru_P241 Structure Of Porcine Pancreatic Elastase Complexed 3e-16
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 1e-26
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 1e-17
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 4e-26
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 8e-17
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 5e-26
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 8e-17
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 5e-26
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 1e-16
1fon_A240 Crystal Structure Of Bovine Procarboxypeptidase A-S 5e-26
1fon_A240 Crystal Structure Of Bovine Procarboxypeptidase A-S 5e-14
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 6e-26
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 8e-17
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 7e-26
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 4e-16
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 7e-26
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 1e-16
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 9e-26
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 1e-16
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 1e-25
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 8e-17
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 1e-25
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 8e-16
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 1e-25
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 1e-16
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 1e-25
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 1e-16
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 1e-25
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 8e-16
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 1e-25
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 8e-16
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 2e-25
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 5e-18
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 2e-25
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 1e-16
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 2e-25
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 1e-16
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 3e-25
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 3e-16
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 4e-25
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 2e-15
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 8e-25
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 4e-16
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 9e-25
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 4e-16
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 9e-25
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 5e-15
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 1e-24
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 1e-17
1lto_A245 Human Alpha1-Tryptase Length = 245 1e-24
1lto_A245 Human Alpha1-Tryptase Length = 245 7e-16
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 1e-24
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 1e-15
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 2e-24
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 7e-16
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 2e-24
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 8e-16
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 2e-24
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 8e-16
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 2e-24
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 8e-16
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 2e-24
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 3e-16
1aut_C250 Human Activated Protein C Length = 250 4e-24
1aut_C250 Human Activated Protein C Length = 250 4e-13
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 4e-24
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 4e-13
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 4e-24
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 9e-16
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 9e-23
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 4e-15
1eai_A240 Complex Of Ascaris Chymotrpsin/elastase Inhibitor W 6e-22
1eai_A240 Complex Of Ascaris Chymotrpsin/elastase Inhibitor W 2e-13
2est_E240 Crystallographic Study Of The Binding Of A Trifluor 8e-22
2est_E240 Crystallographic Study Of The Binding Of A Trifluor 2e-13
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 1e-21
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 7e-19
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 1e-21
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 7e-19
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 1e-21
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 7e-19
1pfx_C235 Porcine Factor Ixa Length = 235 1e-21
1pfx_C235 Porcine Factor Ixa Length = 235 2e-13
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 2e-21
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 5e-14
1hax_B240 Snapshots Of Serine Protease Catalysis: (A) Acyl-En 2e-21
1hax_B240 Snapshots Of Serine Protease Catalysis: (A) Acyl-En 2e-13
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 2e-21
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 4e-15
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 2e-21
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 4e-14
1kig_H241 Bovine Factor Xa Length = 241 3e-21
1kig_H241 Bovine Factor Xa Length = 241 9e-16
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 5e-21
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 2e-13
1elt_A236 Structure Of Native Pancreatic Elastase From North 6e-21
1elt_A236 Structure Of Native Pancreatic Elastase From North 9e-13
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 6e-21
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 3e-13
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 6e-21
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 1e-13
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 1e-20
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 8e-17
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 1e-20
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 8e-17
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 1e-20
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 3e-13
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 2e-20
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 3e-13
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 2e-20
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 3e-13
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 3e-20
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 3e-15
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 5e-20
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 4e-14
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 7e-20
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 1e-13
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 8e-20
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 2e-15
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 1e-19
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 5e-17
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 1e-19
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 2e-09
2xrc_A565 Human Complement Factor I Length = 565 1e-19
2xrc_A565 Human Complement Factor I Length = 565 3e-13
2xxl_A408 Crystal Structure Of Drosophila Grass Clip Serine P 3e-19
2xxl_A408 Crystal Structure Of Drosophila Grass Clip Serine P 3e-09
2bvr_H252 Human Thrombin Complexed With Fragment-based Small 4e-19
2bvr_H252 Human Thrombin Complexed With Fragment-based Small 7e-12
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 7e-19
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 2e-09
1ton_A235 Rat Submaxillary Gland Serine Protease, Tonin. Stru 8e-19
1ton_A235 Rat Submaxillary Gland Serine Protease, Tonin. Stru 1e-12
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 1e-18
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 6e-14
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 1e-18
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 4e-14
1h8i_H253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 1e-18
1h8i_H253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 2e-11
1h8d_H260 X-Ray Structure Of The Human Alpha-Thrombin Complex 2e-18
1h8d_H260 X-Ray Structure Of The Human Alpha-Thrombin Complex 3e-11
1vzq_H250 Complex Of Thrombin With Designed Inhibitor 7165 Le 2e-18
1vzq_H250 Complex Of Thrombin With Designed Inhibitor 7165 Le 3e-11
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 2e-18
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 4e-17
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 2e-18
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 2e-14
2bok_A241 Factor Xa- Cation Length = 241 2e-18
2bok_A241 Factor Xa- Cation Length = 241 2e-14
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 5e-18
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 8e-16
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 5e-18
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 6e-12
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 6e-18
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 5e-14
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 6e-18
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 5e-14
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 6e-18
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 5e-14
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 6e-18
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 5e-14
1azz_A226 Fiddler Crab Collagenase Complexed To Ecotin Length 7e-18
1azz_A226 Fiddler Crab Collagenase Complexed To Ecotin Length 3e-11
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 7e-18
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 5e-14
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 7e-18
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 6e-13
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 7e-18
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 5e-14
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 8e-18
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 5e-14
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 9e-18
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 3e-13
3gic_B250 Structure Of Thrombin Mutant Delta(146-149e) In The 1e-17
3gic_B250 Structure Of Thrombin Mutant Delta(146-149e) In The 2e-10
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 1e-17
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 7e-13
1eoj_A289 Design Of P1' And P3' Residues Of Trivalent Thrombi 1e-17
1eoj_A289 Design Of P1' And P3' Residues Of Trivalent Thrombi 1e-09
1d9i_A288 Structure Of Thrombin Complexed With Selective Non- 1e-17
1d9i_A288 Structure Of Thrombin Complexed With Selective Non- 1e-09
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 1e-17
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 4e-13
1nu9_A291 Staphylocoagulase-prethrombin-2 Complex Length = 29 1e-17
1nu9_A291 Staphylocoagulase-prethrombin-2 Complex Length = 29 9e-10
1d6w_A287 Structure Of Thrombin Complexed With Selective Non- 1e-17
1d6w_A287 Structure Of Thrombin Complexed With Selective Non- 1e-09
1hag_E295 The Isomorphous Structures Of Prethrombin2, Hirugen 1e-17
1hag_E295 The Isomorphous Structures Of Prethrombin2, Hirugen 1e-09
1nm6_A287 Thrombin In Complex With Selective Macrocyclic Inhi 1e-17
1nm6_A287 Thrombin In Complex With Selective Macrocyclic Inhi 1e-09
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 1e-17
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 6e-14
2bdy_A289 Thrombin In Complex With Inhibitor Length = 289 1e-17
2bdy_A289 Thrombin In Complex With Inhibitor Length = 289 1e-09
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 1e-17
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 1e-13
1jwt_A305 Crystal Structure Of Thrombin In Complex With A Nov 1e-17
1jwt_A305 Crystal Structure Of Thrombin In Complex With A Nov 9e-10
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 1e-17
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 6e-13
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 1e-17
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 2e-14
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 2e-17
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 6e-13
3nxp_A424 Crystal Structure Of Human Prethrombin-1 Length = 4 2e-17
3nxp_A424 Crystal Structure Of Human Prethrombin-1 Length = 4 1e-09
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 2e-17
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 7e-13
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 2e-17
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 5e-16
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 2e-17
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 7e-13
3k65_B308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 2e-17
3k65_B308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 2e-09
1mh0_A287 Crystal Structure Of The Anticoagulant Slow Form Of 2e-17
1mh0_A287 Crystal Structure Of The Anticoagulant Slow Form Of 1e-09
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 2e-17
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 2e-14
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 3e-17
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 6e-14
1dm4_B260 Ser195ala Mutant Of Human Thrombin Complexed With F 3e-17
1dm4_B260 Ser195ala Mutant Of Human Thrombin Complexed With F 2e-09
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 3e-17
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 2e-14
3sqe_E290 Crystal Structure Of Prethrombin-2 Mutant S195a In 3e-17
3sqe_E290 Crystal Structure Of Prethrombin-2 Mutant S195a In 2e-09
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 3e-17
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 9e-16
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 3e-17
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 6e-12
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 4e-17
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 2e-14
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 4e-17
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 2e-12
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 4e-17
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 6e-16
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 4e-17
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 8e-16
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 4e-17
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 3e-14
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 4e-17
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 9e-16
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 4e-17
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 6e-14
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 4e-17
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 6e-14
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 4e-17
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 2e-09
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 4e-17
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 1e-15
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 4e-17
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 8e-16
2a31_A223 Trypsin In Complex With Borate Length = 223 5e-17
2a31_A223 Trypsin In Complex With Borate Length = 223 2e-14
3g01_A227 Structure Of Grc Mutant E192rE193G Length = 227 5e-17
3g01_A227 Structure Of Grc Mutant E192rE193G Length = 227 2e-11
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 5e-17
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 1e-15
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 5e-17
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 2e-10
1bth_H259 Structure Of Thrombin Complexed With Bovine Pancrea 5e-17
1bth_H259 Structure Of Thrombin Complexed With Bovine Pancrea 8e-10
1gj5_H258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 5e-17
1gj5_H258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 9e-10
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 5e-17
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 5e-16
1qur_H257 Human Alpha-Thrombin In Complex With Bivalent, Benz 5e-17
1qur_H257 Human Alpha-Thrombin In Complex With Bivalent, Benz 9e-10
1abi_H259 Structure Of The Hirulog 3-Thrombin Complex And Nat 5e-17
1abi_H259 Structure Of The Hirulog 3-Thrombin Complex And Nat 9e-10
1wbg_B259 Active Site Thrombin Inhibitors Length = 259 5e-17
1wbg_B259 Active Site Thrombin Inhibitors Length = 259 2e-09
1vr1_H261 Specifity For Plasminogen Activator Inhibitor-1 Len 6e-17
1vr1_H261 Specifity For Plasminogen Activator Inhibitor-1 Len 6e-09
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 6e-17
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 1e-09
2thf_B259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 6e-17
2thf_B259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 1e-09
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 6e-17
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 2e-12
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 6e-17
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 1e-15
1b7x_B259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 6e-17
1b7x_B259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 9e-10
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 6e-17
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 2e-12
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 7e-17
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 8e-11
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 7e-17
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 2e-15
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 7e-17
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 2e-12
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 8e-17
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 4e-15
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 8e-17
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 2e-15
3ee0_B259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 8e-17
3ee0_B259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 2e-09
1tq0_B257 Crystal Structure Of The Potent Anticoagulant Throm 8e-17
1tq0_B257 Crystal Structure Of The Potent Anticoagulant Throm 2e-09
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 8e-17
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 3e-12
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 8e-17
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 7e-11
1dx5_M259 Crystal Structure Of The Thrombin-Thrombomodulin Co 8e-17
1dx5_M259 Crystal Structure Of The Thrombin-Thrombomodulin Co 9e-10
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 8e-17
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 3e-12
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 8e-17
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 6e-12
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 8e-17
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 6e-12
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 9e-17
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 6e-12
3jz1_B259 Crystal Structure Of Human Thrombin Mutant N143p In 9e-17
3jz1_B259 Crystal Structure Of Human Thrombin Mutant N143p In 2e-09
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 1e-16
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 5e-12
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 1e-16
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 8e-12
1mkw_K308 The Co-Crystal Structure Of Unliganded Bovine Alpha 1e-16
1mkw_K308 The Co-Crystal Structure Of Unliganded Bovine Alpha 3e-09
1jou_B259 Crystal Structure Of Native S195a Thrombin With An 1e-16
1jou_B259 Crystal Structure Of Native S195a Thrombin With An 2e-09
1sfq_B259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 1e-16
1sfq_B259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 1e-09
2a0q_B257 Structure Of Thrombin In 400 Mm Potassium Chloride 1e-16
2a0q_B257 Structure Of Thrombin In 400 Mm Potassium Chloride 9e-10
2od3_B259 Human Thrombin Chimera With Human Residues 184a, 18 1e-16
2od3_B259 Human Thrombin Chimera With Human Residues 184a, 18 2e-09
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 1e-16
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 3e-12
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 1e-16
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 1e-11
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 1e-16
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 3e-15
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 1e-16
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 3e-12
3r3g_B259 Structure Of Human Thrombin With Residues 145-150 O 1e-16
3r3g_B259 Structure Of Human Thrombin With Residues 145-150 O 2e-09
2gp9_B259 Crystal Structure Of The Slow Form Of Thrombin In A 2e-16
2gp9_B259 Crystal Structure Of The Slow Form Of Thrombin In A 8e-10
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 2e-16
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 2e-12
1z8i_B259 Crystal Structure Of The Thrombin Mutant G193a Boun 2e-16
1z8i_B259 Crystal Structure Of The Thrombin Mutant G193a Boun 3e-09
1fuj_A221 Pr3 (Myeloblastin) Length = 221 3e-16
1fuj_A221 Pr3 (Myeloblastin) Length = 221 4e-10
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 3e-16
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 1e-11
3fzz_A227 Structure Of Grc Length = 227 3e-16
3fzz_A227 Structure Of Grc Length = 227 1e-10
1z8j_B259 Crystal Structure Of The Thrombin Mutant G193p Boun 4e-16
1z8j_B259 Crystal Structure Of The Thrombin Mutant G193p Boun 6e-09
2pgb_B259 Inhibitor-Free Human Thrombin Mutant C191a-C220a Le 4e-16
2pgb_B259 Inhibitor-Free Human Thrombin Mutant C191a-C220a Le 6e-08
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 5e-16
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 6e-12
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 5e-16
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 9e-11
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 5e-16
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 3e-11
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 6e-16
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 8e-14
1bbr_K259 The Structure Of Residues 7-16 Of The A Alpha Chain 7e-16
1bbr_K259 The Structure Of Residues 7-16 Of The A Alpha Chain 3e-09
1id5_H256 Crystal Structure Of Bovine Thrombin Complex With P 8e-16
1id5_H256 Crystal Structure Of Bovine Thrombin Complex With P 3e-09
2ocv_B259 Structural Basis Of Na+ Activation Mimicry In Murin 9e-16
2ocv_B259 Structural Basis Of Na+ Activation Mimicry In Murin 5e-08
3edx_B258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 1e-15
3edx_B258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 1e-07
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 1e-15
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 3e-13
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 2e-15
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 7e-13
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 2e-15
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 3e-13
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 2e-15
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 2e-13
2pux_B258 Crystal Structure Of Murine Thrombin In Complex Wit 2e-15
2pux_B258 Crystal Structure Of Murine Thrombin In Complex Wit 1e-07
1kdq_A131 Crystal Structure Analysis Of The Mutant S189d Rat 2e-15
1sgf_A240 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 2e-15
1sgf_A240 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 1e-10
1fi8_A228 Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie 3e-15
1fi8_A228 Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie 1e-08
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 3e-15
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 2e-12
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 3e-15
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 3e-13
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 4e-15
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 5e-13
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 4e-15
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-12
2jet_B128 Crystal Structure Of A Trypsin-Like Mutant (S189d, 4e-15
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 4e-15
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 2e-08
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 5e-15
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 2e-08
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 5e-15
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 6e-13
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 5e-15
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 8e-13
1mtn_B131 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 7e-15
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 7e-15
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 9e-13
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-14
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 4e-12
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-14
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-12
1fq3_A227 Crystal Structure Of Human Granzyme B Length = 227 1e-14
1fq3_A227 Crystal Structure Of Human Granzyme B Length = 227 1e-07
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 1e-14
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 5e-12
1iau_A227 Human Granzyme B In Complex With Ac-Iepd-Cho Length 1e-14
1iau_A227 Human Granzyme B In Complex With Ac-Iepd-Cho Length 1e-07
3rp2_A224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 2e-14
3rp2_A224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 1e-08
2zgc_A240 Crystal Structure Of Active Human Granzyme M Length 2e-14
2zgc_A240 Crystal Structure Of Active Human Granzyme M Length 6e-07
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 2e-14
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 5e-12
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 2e-14
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 8e-12
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 3e-14
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 9e-10
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 3e-14
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 6e-13
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 4e-14
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 7e-13
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 6e-14
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 5e-10
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 6e-14
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 4e-10
2zgj_A240 Crystal Structure Of D86n-gzmm Complexed With Its O 6e-14
2zgj_A240 Crystal Structure Of D86n-gzmm Complexed With Its O 4e-07
2kai_B152 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 6e-14
1euf_A227 Bovine Duodenase(New Serine Protease), Crystal Stru 7e-14
1euf_A227 Bovine Duodenase(New Serine Protease), Crystal Stru 8e-09
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 7e-14
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 1e-12
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 9e-14
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 1e-12
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 1e-13
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 2e-12
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 1e-13
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 1e-11
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 1e-13
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 3e-08
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 2e-13
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 8e-11
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 3e-13
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 5e-10
1gdu_A224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 3e-13
1gdu_A224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 1e-07
4gaw_A226 Crystal Structure Of Active Human Granzyme H Length 3e-13
4gaw_A226 Crystal Structure Of Active Human Granzyme H Length 1e-06
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 4e-13
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 5e-10
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 5e-13
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 9e-12
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 6e-13
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 6e-10
1hne_E218 Structure Of Human Neutrophil Elastase In Complex W 6e-13
1hne_E218 Structure Of Human Neutrophil Elastase In Complex W 3e-06
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 6e-13
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 9e-10
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 6e-13
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 5e-10
1gvz_A237 Prostate Specific Antigen (Psa) From Stallion Semin 6e-13
1gvz_A237 Prostate Specific Antigen (Psa) From Stallion Semin 1e-05
1ppg_E218 The Refined 2.3 Angstroms Crystal Structure Of Huma 7e-13
1ppg_E218 The Refined 2.3 Angstroms Crystal Structure Of Huma 3e-06
1xvm_A224 Trypsin From Fusarium Oxysporum- Room Temperature T 7e-13
1xvm_A224 Trypsin From Fusarium Oxysporum- Room Temperature T 1e-07
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 7e-13
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 6e-10
1m9u_A241 Crystal Structure Of Earthworm Fibrinolytic Enzyme 7e-13
1m9u_A241 Crystal Structure Of Earthworm Fibrinolytic Enzyme 1e-10
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 7e-13
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 3e-10
1ppf_E218 X-Ray Crystal Structure Of The Complex Of Human Leu 7e-13
1ppf_E218 X-Ray Crystal Structure Of The Complex Of Human Leu 3e-06
1b0f_A218 Crystal Structure Of Human Neutrophil Elastase With 7e-13
1b0f_A218 Crystal Structure Of Human Neutrophil Elastase With 3e-06
1hyl_A230 The 1.8 A Structure Of Collagenase From Hypoderma L 9e-13
1hyl_A230 The 1.8 A Structure Of Collagenase From Hypoderma L 2e-04
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 9e-13
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 8e-11
3tju_A226 Crystal Structure Of Human Granzyme H With An Inhib 1e-12
3tju_A226 Crystal Structure Of Human Granzyme H With An Inhib 8e-07
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 1e-12
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 1e-11
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 1e-12
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 8e-10
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 1e-12
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 8e-10
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 1e-12
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 1e-09
1ppz_A224 Trypsin Complexes At Atomic And Ultra-High Resoluti 1e-12
1ppz_A224 Trypsin Complexes At Atomic And Ultra-High Resoluti 4e-07
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 1e-12
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 5e-10
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 1e-12
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 4e-11
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 1e-12
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 6e-10
2b9l_A394 Crystal Structure Of Prophenoloxidase Activating Fa 1e-12
2b9l_A394 Crystal Structure Of Prophenoloxidase Activating Fa 1e-07
4gso_A232 Structure Of Jararacussin-I Length = 232 1e-12
4gso_A232 Structure Of Jararacussin-I Length = 232 3e-07
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 2e-12
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 7e-11
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 2e-12
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 5e-10
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 2e-12
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 2e-09
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 2e-12
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 2e-09
1dpo_A223 Structure Of Rat Trypsin Length = 223 2e-12
1dpo_A223 Structure Of Rat Trypsin Length = 223 2e-09
1pjp_A226 The 2.2 A Crystal Structure Of Human Chymase In Com 2e-12
1pjp_A226 The 2.2 A Crystal Structure Of Human Chymase In Com 5e-07
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 2e-12
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 5e-10
2rg3_A218 Covalent Complex Structure Of Elastase Length = 218 2e-12
2rg3_A218 Covalent Complex Structure Of Elastase Length = 218 1e-05
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 4e-12
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 4e-05
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 4e-12
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 2e-09
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 6e-12
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 5e-06
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 7e-12
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 5e-11
1klt_A226 Crystal Structure Of Pmsf-Treated Human Chymase At 8e-12
1klt_A226 Crystal Structure Of Pmsf-Treated Human Chymase At 6e-07
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 8e-12
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 7e-09
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 9e-12
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 8e-07
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 9e-12
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 4e-06
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 9e-12
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 7e-09
1md8_A329 Monomeric Structure Of The Active Catalytic Domain 1e-11
1md8_A329 Monomeric Structure Of The Active Catalytic Domain 4e-06
3n7o_A226 X-Ray Structure Of Human Chymase In Complex With Sm 1e-11
3n7o_A226 X-Ray Structure Of Human Chymase In Complex With Sm 8e-07
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 2e-11
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 3e-06
2fmj_A222 220-Loop Mutant Of Streptomyces Griseus Trypsin Len 2e-11
2fmj_A222 220-Loop Mutant Of Streptomyces Griseus Trypsin Len 4e-10
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 2e-11
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 5e-06
1md7_A328 Monomeric Structure Of The Zymogen Of Complement Pr 2e-11
1md7_A328 Monomeric Structure Of The Zymogen Of Complement Pr 8e-06
1os8_A223 Recombinant Streptomyces Griseus Trypsin Length = 2 2e-11
1sgt_A223 Refined Crystal Structure Of Streptomyces Griseus T 2e-11
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 2e-11
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 4e-06
1oss_A223 T190p Streptomyces Griseus Trypsin In Complex With 3e-11
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 3e-11
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 4e-06
1nn6_A228 Human Pro-Chymase Length = 228 4e-11
1nn6_A228 Human Pro-Chymase Length = 228 7e-07
4afq_A226 Human Chymase - Fynomer Complex Length = 226 4e-11
4afq_A226 Human Chymase - Fynomer Complex Length = 226 7e-07
1orf_A234 The Oligomeric Structure Of Human Granzyme A Reveal 4e-11
1orf_A234 The Oligomeric Structure Of Human Granzyme A Reveal 1e-08
1op8_A234 Crystal Structure Of Human Granzyme A Length = 234 4e-11
1op8_A234 Crystal Structure Of Human Granzyme A Length = 234 2e-08
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 5e-11
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 2e-06
2jet_C99 Crystal Structure Of A Trypsin-Like Mutant (S189d, 5e-11
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 5e-11
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 1e-06
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 6e-11
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 5e-09
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 9e-11
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 3e-06
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 1e-10
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 1e-08
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 1e-10
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 4e-05
1kdq_B99 Crystal Structure Analysis Of The Mutant S189d Rat 2e-10
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 2e-10
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 7e-06
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 2e-10
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 2e-05
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 3e-10
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 4e-05
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 3e-10
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 5e-08
1fy3_A225 [g175q]hbp, A Mutant Of Human Heparin Binding Prote 3e-10
1fy3_A225 [g175q]hbp, A Mutant Of Human Heparin Binding Prote 6e-05
2qy0_B242 Active Dimeric Structure Of The Catalytic Domain Of 4e-10
2qy0_B242 Active Dimeric Structure Of The Catalytic Domain Of 3e-06
1a7s_A225 Atomic Resolution Structure Of Hbp Length = 225 4e-10
1a7s_A225 Atomic Resolution Structure Of Hbp Length = 225 8e-05
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 5e-10
1fy1_A225 [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P 8e-10
1fy1_A225 [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P 1e-04
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 8e-10
3s69_A234 Crystal Structure Of Saxthrombin Length = 234 9e-10
3s69_A234 Crystal Structure Of Saxthrombin Length = 234 7e-06
2asu_B234 Crystal Structure Of The Beta-Chain Of HgflMSP Leng 9e-10
2rdl_A226 Hamster Chymase 2 Length = 226 1e-09
2rdl_A226 Hamster Chymase 2 Length = 226 3e-06
1afq_C96 Crystal Structure Of Bovine Gamma-Chymotrypsin Comp 2e-09
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 2e-09
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 4e-07
3i77_A230 3599170-Loops Of Fxa In Sgt Length = 230 2e-09
1bhx_B147 X-Ray Structure Of The Complex Of Human Alpha Throm 5e-09
1mtn_C97 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 1e-08
3i78_A229 3599170186220-Loops Of Fxa In Sgt Length = 229 1e-08
3i78_A229 3599170186220-Loops Of Fxa In Sgt Length = 229 2e-07
1au8_A224 Human Cathepsin G Length = 224 1e-08
1au8_A224 Human Cathepsin G Length = 224 2e-06
3beu_A224 Na+-Dependent Allostery Mediates Coagulation Factor 2e-08
3beu_A224 Na+-Dependent Allostery Mediates Coagulation Factor 2e-07
1kyn_B235 Cathepsin-G Length = 235 2e-08
1kyn_B235 Cathepsin-G Length = 235 2e-06
1si5_H240 Protease-Like Domain From 2-Chain Hepatocyte Growth 2e-08
1shy_A234 The Crystal Structure Of Hgf Beta-Chain In Complex 2e-08
4f4o_C347 Structure Of The Haptoglobin-Haemoglobin Complex Le 2e-08
4f4o_C347 Structure Of The Haptoglobin-Haemoglobin Complex Le 2e-05
1bbr_H150 The Structure Of Residues 7-16 Of The A Alpha Chain 4e-08
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 9e-08
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 2e-07
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 5e-07
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 4e-04
1aks_A125 Crystal Structure Of The First Active Autolysate Fo 1e-06
2pks_C102 Thrombin In Complex With Inhibitor Length = 102 3e-06
2hnt_F105 Crystallographic Structure Of Human Gamma-Thrombin 3e-06
1bbr_E109 The Structure Of Residues 7-16 Of The A Alpha Chain 3e-06
3h7o_A228 Crystal Structure Of Scabies Mite Inactivated Prote 2e-04
2kai_A80 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 4e-04
3h7t_A235 Crystal Structure Of Scabies Mite Inactivated Prote 7e-04
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure

Iteration: 1

Score = 127 bits (319), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 86/238 (36%), Positives = 130/238 (54%), Gaps = 20/238 (8%) Query: 14 CGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAH 73 CG I + R++ G+++I +WPWQ+SLQ L R H CG LI P+ V+TAAH Sbjct: 1 CGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYL--RDNTWRHTCGGTLITPNHVLTAAH 58 Query: 74 CIHNDIFSLPIPELWTAVLGDWD-RTEEEKSEVRIPVERIRVHEEFHNY--HHDIALLKL 130 CI N + + LG + E+E + + V+ I VHE+++++ +DIAL+KL Sbjct: 59 CISNTL-------TYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKL 111 Query: 131 SRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISV 190 + D ++ CL ++ + C TGWGR+ G + ++L+Q P+ + + Sbjct: 112 AETVELGDT-IQVACLP-SEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYAT 169 Query: 191 C--RDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSG 246 C RD +G +V+ +C G DG AC GDSGGPL C DG+W + GI SFGSG Sbjct: 170 CSQRDWWGTTVK--ETMVCAGG-DGVISACNGDSGGPLNCQ-ADGQWDVRGIVSFGSG 223
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 Back     alignment and structure
>pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 Back     alignment and structure
>pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 Back     alignment and structure
>pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 Back     alignment and structure
>pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 Back     alignment and structure
>pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 Back     alignment and structure
>pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 Back     alignment and structure
>pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 Back     alignment and structure
>pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 Back     alignment and structure
>pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 Back     alignment and structure
>pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|1KDQ|A Chain A, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 131 Back     alignment and structure
>pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 Back     alignment and structure
>pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 Back     alignment and structure
>pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 Back     alignment and structure
>pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 Back     alignment and structure
>pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 Back     alignment and structure
>pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 Back     alignment and structure
>pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 Back     alignment and structure
>pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 Back     alignment and structure
>pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 Back     alignment and structure
>pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 Back     alignment and structure
>pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 Back     alignment and structure
>pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 Back     alignment and structure
>pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 Back     alignment and structure
>pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 Back     alignment and structure
>pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 Back     alignment and structure
>pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 Back     alignment and structure
>pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 Back     alignment and structure
>pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 Back     alignment and structure
>pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 Back     alignment and structure
>pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 Back     alignment and structure
>pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 Back     alignment and structure
>pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 Back     alignment and structure
>pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|2FMJ|A Chain A, 220-Loop Mutant Of Streptomyces Griseus Trypsin Length = 222 Back     alignment and structure
>pdb|2FMJ|A Chain A, 220-Loop Mutant Of Streptomyces Griseus Trypsin Length = 222 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 Back     alignment and structure
>pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 Back     alignment and structure
>pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 Back     alignment and structure
>pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|1OSS|A Chain A, T190p Streptomyces Griseus Trypsin In Complex With Benzamidine Length = 223 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 Back     alignment and structure
>pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 Back     alignment and structure
>pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 Back     alignment and structure
>pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 Back     alignment and structure
>pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 Back     alignment and structure
>pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 Back     alignment and structure
>pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 Back     alignment and structure
>pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 Back     alignment and structure
>pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 Back     alignment and structure
>pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 Back     alignment and structure
>pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 Back     alignment and structure
>pdb|2ASU|B Chain B, Crystal Structure Of The Beta-Chain Of HgflMSP Length = 234 Back     alignment and structure
>pdb|2RDL|A Chain A, Hamster Chymase 2 Length = 226 Back     alignment and structure
>pdb|2RDL|A Chain A, Hamster Chymase 2 Length = 226 Back     alignment and structure
>pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 Back     alignment and structure
>pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 Back     alignment and structure
>pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 Back     alignment and structure
>pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 Back     alignment and structure
>pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|3BEU|A Chain A, Na+-Dependent Allostery Mediates Coagulation Factor Protease Active Site Selectivity Length = 224 Back     alignment and structure
>pdb|3BEU|A Chain A, Na+-Dependent Allostery Mediates Coagulation Factor Protease Active Site Selectivity Length = 224 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 Back     alignment and structure
>pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 Back     alignment and structure
>pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 Back     alignment and structure
>pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 Back     alignment and structure
>pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 Back     alignment and structure
>pdb|2PKS|C Chain C, Thrombin In Complex With Inhibitor Length = 102 Back     alignment and structure
>pdb|2HNT|F Chain F, Crystallographic Structure Of Human Gamma-Thrombin Length = 105 Back     alignment and structure
>pdb|1BBR|E Chain E, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 109 Back     alignment and structure
>pdb|3H7O|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-I1 (Smipp-S-I1) Length = 228 Back     alignment and structure
>pdb|2KAI|A Chain A, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 80 Back     alignment and structure
>pdb|3H7T|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-D1 (Smipp-S-D1) Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 5e-73
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 5e-40
2jde_A276 Urokinase-type plasminogen activator; plasminogen 9e-71
2jde_A276 Urokinase-type plasminogen activator; plasminogen 4e-38
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 4e-70
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 3e-40
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 2e-69
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 8e-39
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 5e-69
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 1e-40
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 8e-69
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 4e-42
3bg8_A238 Coagulation factor XIA light chain; protease inhib 8e-69
3bg8_A238 Coagulation factor XIA light chain; protease inhib 5e-42
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 1e-68
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 1e-41
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 3e-68
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 3e-43
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 4e-68
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 4e-39
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 1e-67
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 2e-37
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 1e-67
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 3e-38
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 1e-67
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 1e-41
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 2e-67
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 3e-39
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 7e-67
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 9e-41
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 8e-67
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 1e-42
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 9e-67
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 7e-40
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 1e-66
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 4e-40
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 1e-66
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 6e-40
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 2e-66
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 2e-37
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 2e-66
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 5e-40
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 3e-66
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 9e-38
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 3e-66
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 3e-45
2r0l_A248 Hepatocyte growth factor activator; serine proteas 1e-65
2r0l_A248 Hepatocyte growth factor activator; serine proteas 1e-37
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 2e-65
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 9e-40
1aut_C250 Activated protein C; serine proteinase, plasma cal 2e-65
1aut_C250 Activated protein C; serine proteinase, plasma cal 2e-38
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 1e-64
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 2e-36
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 1e-64
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 9e-39
1md8_A329 C1R complement serine protease; innate immunity, a 3e-64
1md8_A329 C1R complement serine protease; innate immunity, a 3e-33
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 3e-64
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 6e-38
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 3e-64
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 9e-39
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 4e-64
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 1e-39
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 8e-64
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 5e-39
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 2e-63
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 2e-38
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 3e-63
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 2e-37
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 3e-63
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 3e-40
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 4e-63
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 7e-37
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 9e-63
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 2e-34
1gpz_A399 Complement C1R component; hydrolase, activation, i 9e-63
1gpz_A399 Complement C1R component; hydrolase, activation, i 1e-32
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 3e-62
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 2e-37
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 3e-62
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 6e-37
1euf_A227 Duodenase; serine protease, dual specificity, hydr 3e-62
1euf_A227 Duodenase; serine protease, dual specificity, hydr 4e-37
2qy0_B242 Complement C1R subcomponent; serine protease, beta 4e-62
2qy0_B242 Complement C1R subcomponent; serine protease, beta 8e-35
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 6e-62
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 7e-36
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 1e-61
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 7e-37
1a7s_A225 Heparin binding protein; serine protease homolog, 1e-61
1a7s_A225 Heparin binding protein; serine protease homolog, 9e-36
2xw9_A228 Complement factor D; immune system, hydrolase, ser 2e-61
2xw9_A228 Complement factor D; immune system, hydrolase, ser 2e-35
2xxl_A408 GRAM-positive specific serine protease, isoform B; 2e-61
2xxl_A408 GRAM-positive specific serine protease, isoform B; 6e-35
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 3e-61
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 6e-35
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 5e-61
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 1e-34
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 5e-61
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 6e-35
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 1e-60
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 2e-35
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 2e-60
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 9e-35
2z7f_E218 Leukocyte elastase; serine protease, serine protea 3e-60
2z7f_E218 Leukocyte elastase; serine protease, serine protea 1e-35
2xrc_A565 Human complement factor I; immune system, hydrolas 5e-60
2xrc_A565 Human complement factor I; immune system, hydrolas 3e-37
2asu_B234 Hepatocyte growth factor-like protein; serine prot 9e-60
2asu_B234 Hepatocyte growth factor-like protein; serine prot 3e-39
1azz_A226 Collagenase; complex (serine protease/inhibitor), 1e-59
1azz_A226 Collagenase; complex (serine protease/inhibitor), 2e-33
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 2e-59
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 2e-39
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 2e-59
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 1e-39
1elv_A333 Complement C1S component; trypsin-like serin prote 8e-59
1elv_A333 Complement C1S component; trypsin-like serin prote 1e-33
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 8e-59
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 3e-35
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 9e-59
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 2e-35
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 2e-58
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 7e-34
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 6e-58
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 7e-38
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 1e-57
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 7e-34
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 2e-57
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 3e-35
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 3e-57
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 2e-34
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 7e-57
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 2e-34
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 7e-57
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 1e-34
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 1e-56
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 5e-36
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 2e-56
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 8e-35
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 4e-56
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 8e-33
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 4e-56
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 2e-35
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 8e-56
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 1e-33
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 1e-55
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 3e-33
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 1e-55
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 8e-35
1ao5_A237 Glandular kallikrein-13; serine protease, protein 1e-55
1ao5_A237 Glandular kallikrein-13; serine protease, protein 3e-34
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 3e-55
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 6e-34
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 3e-55
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 4e-34
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 5e-55
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 2e-37
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 2e-54
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 2e-33
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 4e-54
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 1e-31
2aiq_A231 Protein C activator; snake venom serine proteinase 6e-54
2aiq_A231 Protein C activator; snake venom serine proteinase 3e-32
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-52
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 4e-33
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 9e-52
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 3e-33
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 9e-52
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 1e-32
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 4e-51
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 4e-28
2odp_A509 Complement C2; C3/C5 convertase, complement serin 1e-50
2odp_A509 Complement C2; C3/C5 convertase, complement serin 2e-26
3hrz_D741 Complement factor B; serine protease, glycosilated 5e-46
3hrz_D741 Complement factor B; serine protease, glycosilated 2e-26
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 2e-40
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 4e-04
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 7e-34
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 2e-27
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 5e-28
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 1e-15
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 6e-24
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 1e-16
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 3e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
 Score =  228 bits (584), Expect = 5e-73
 Identities = 82/240 (34%), Positives = 120/240 (50%), Gaps = 17/240 (7%)

Query: 14  CGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAH 73
           CG  I   +   R++ G+++I  +WPWQ+SLQ L        H CG  LI P+ V+TAAH
Sbjct: 1   CGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWR--HTCGGTLITPNHVLTAAH 58

Query: 74  CIHNDIFSLPIPELWTAVLGDWDR-TEEEKSEVRIPVERIRVHEEFH--NYHHDIALLKL 130
           CI N          +   LG  +   E+E   + + V+ I VHE+++     +DIAL+KL
Sbjct: 59  CISN-------TLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKL 111

Query: 131 SRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISV 190
           +      D  ++  CL       +     C  TGWGR+   G + ++L+Q   P+ + + 
Sbjct: 112 AETVELGDT-IQVACLPSEGS-LLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYAT 169

Query: 191 CRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGY-CG 249
           C  +      +    +C G  DG   AC GDSGGPL C   DG+W + GI SFGSG  C 
Sbjct: 170 CSQRDWWGTTVKETMVCAG-GDGVISACNGDSGGPLNC-QADGQWDVRGIVSFGSGLSCN 227


>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 100.0
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 100.0
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 100.0
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 100.0
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 100.0
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 100.0
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 100.0
2jde_A276 Urokinase-type plasminogen activator; plasminogen 100.0
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 100.0
1aut_C250 Activated protein C; serine proteinase, plasma cal 100.0
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 100.0
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 100.0
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 100.0
3bg8_A238 Coagulation factor XIA light chain; protease inhib 100.0
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 100.0
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 100.0
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 100.0
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 100.0
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 100.0
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 100.0
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 100.0
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 100.0
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 100.0
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 100.0
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 100.0
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 100.0
1md8_A329 C1R complement serine protease; innate immunity, a 100.0
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 100.0
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 100.0
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 100.0
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 100.0
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 100.0
1ao5_A237 Glandular kallikrein-13; serine protease, protein 100.0
2asu_B234 Hepatocyte growth factor-like protein; serine prot 100.0
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 100.0
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 100.0
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 100.0
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 100.0
2r0l_A248 Hepatocyte growth factor activator; serine proteas 100.0
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 100.0
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 100.0
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 100.0
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 100.0
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 100.0
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 100.0
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 100.0
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 100.0
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 100.0
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 100.0
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 100.0
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 100.0
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 100.0
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 100.0
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 100.0
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 100.0
2qy0_B242 Complement C1R subcomponent; serine protease, beta 100.0
1elv_A333 Complement C1S component; trypsin-like serin prote 100.0
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 100.0
2xxl_A408 GRAM-positive specific serine protease, isoform B; 100.0
2xw9_A228 Complement factor D; immune system, hydrolase, ser 100.0
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 100.0
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 100.0
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 100.0
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 100.0
1gpz_A399 Complement C1R component; hydrolase, activation, i 100.0
1euf_A227 Duodenase; serine protease, dual specificity, hydr 100.0
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 100.0
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 100.0
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 100.0
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 100.0
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 100.0
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 100.0
1azz_A226 Collagenase; complex (serine protease/inhibitor), 100.0
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 100.0
2xrc_A565 Human complement factor I; immune system, hydrolas 100.0
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 100.0
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 100.0
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 100.0
1a7s_A225 Heparin binding protein; serine protease homolog, 100.0
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 100.0
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 100.0
2z7f_E218 Leukocyte elastase; serine protease, serine protea 100.0
2aiq_A231 Protein C activator; snake venom serine proteinase 100.0
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 100.0
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 100.0
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 100.0
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 100.0
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 100.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 100.0
2odp_A509 Complement C2; C3/C5 convertase, complement serin 100.0
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 100.0
3hrz_D741 Complement factor B; serine protease, glycosilated 100.0
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 100.0
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.98
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.98
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 99.98
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.98
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.98
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.97
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.97
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.97
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.97
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.97
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.97
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.97
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.97
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.97
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.97
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.97
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.97
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.97
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.97
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.97
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.97
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.97
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.97
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.97
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.97
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.97
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.97
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.97
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.97
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.97
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.97
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.96
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.96
1md8_A329 C1R complement serine protease; innate immunity, a 99.96
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.96
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.96
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.96
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.96
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.96
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.96
1elv_A333 Complement C1S component; trypsin-like serin prote 99.96
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.96
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.96
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.96
2aiq_A231 Protein C activator; snake venom serine proteinase 99.96
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.96
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.96
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.96
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.96
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.96
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.96
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.96
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.96
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.96
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.96
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.95
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.95
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.95
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.95
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.95
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.95
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.95
1a7s_A225 Heparin binding protein; serine protease homolog, 99.94
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.94
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.94
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.94
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.93
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.93
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.93
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.91
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.91
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.91
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.9
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.9
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.89
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.89
3hrz_D741 Complement factor B; serine protease, glycosilated 99.88
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.86
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.85
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.82
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.74
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.72
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.72
3k6y_A237 Serine protease, possible membrane-associated seri 99.71
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.71
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.7
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.67
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.67
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.66
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.65
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.65
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.64
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.64
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.64
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.64
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.63
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.63
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.63
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.62
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.62
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.62
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.62
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.62
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.61
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.59
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.59
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.59
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.56
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.55
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.53
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.52
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.52
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.52
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.51
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.51
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.5
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.49
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.48
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.46
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.45
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.45
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.44
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.44
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.43
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.39
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.36
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.31
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.26
2xrc_A565 Human complement factor I; immune system, hydrolas 99.25
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 99.22
1hpg_A187 Glutamic acid specific protease; serine protease, 99.22
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.1
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.09
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.0
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 98.97
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.86
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.85
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 98.78
2oua_A188 Serine protease, protein NAPA; kinetic stability, 98.74
1hpg_A187 Glutamic acid specific protease; serine protease, 98.7
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 98.68
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.64
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.56
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 98.53
3k6y_A237 Serine protease, possible membrane-associated seri 98.49
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 98.46
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 98.45
2w5e_A163 Putative serine protease; coiled coil, transmembra 98.29
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.26
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.24
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 98.22
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.17
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.08
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.08
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 97.98
2oua_A188 Serine protease, protein NAPA; kinetic stability, 97.94
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 97.8
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 97.79
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 97.78
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 97.21
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 96.14
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 96.13
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 96.02
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 96.01
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 95.35
3syj_A 1011 Adhesion and penetration protein autotransporter; 94.74
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 92.81
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 91.8
3syj_A 1011 Adhesion and penetration protein autotransporter; 87.85
2fyq_A194 Chymotrypsin-like cysteine proteinase; protease, n 87.71
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 86.21
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 85.61
4ash_A185 NS6 protease; hydrolase, trypsin-like, calicivirus 84.24
3h09_A 989 IGA1 protease, immunoglobulin A1 protease; serine 83.74
3sze_A 968 Serine protease ESPP; parallel beta-helix, hydrola 80.29
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
Probab=100.00  E-value=3.6e-51  Score=388.84  Aligned_cols=260  Identities=24%  Similarity=0.405  Sum_probs=197.8

Q ss_pred             cCCCCCCccCCCCCCeEeCCcccCCCCCcceEEEeeeccCCCCCCeeeEEEEecCCEEEecCCCcCCCCCCCCCCcceEE
Q psy16044         11 ARDCGVGIRYSHRQPRLINGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPELWTA   90 (436)
Q Consensus        11 ~~~CG~~~~~~~~~~~i~~G~~a~~~~~Pw~v~i~~~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~~~~~~~~~~~v   90 (436)
                      .+.||++..+....+||+||++|.+++|||+|+|+...      .++|+||||+++||||||||+.....     ....+
T Consensus        87 ~p~CG~p~~~~~~~~RIvGG~~a~~g~~Pw~v~l~~~~------~~~CGGsLIs~~~VLTAAHCv~~~~~-----~~~~~  155 (347)
T 4f4o_C           87 EAVCGKPKNPVDQVQRIMGGSLDAKGSFPWQAKMISHH------NLTSGATLINEQWLLTTAKNLRLGHK-----NDTKA  155 (347)
T ss_dssp             EECCSCCSSCC-----CCSCCBCCSCCCTTCEEEECTT------CCEEECCBCSSSEEEECHHHHTTTSC-----TTCCH
T ss_pred             cCCCCCCCCCCCCCCeEECCEECCCCCCCcEEEEEeCC------CEEEEEEEEcCCEEEeCcccccCCCC-----CcceE
Confidence            45799877766778899999999999999999998643      68999999999999999999965321     11222


Q ss_pred             EeccccCCccCCceEEEeeeEEEeCCCCCCCCCceeEEEeCCCCCCCCCceeeeeecCCCCCCCCCCCcEEEEecCccCC
Q psy16044         91 VLGDWDRTEEEKSEVRIPVERIRVHEEFHNYHHDIALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKP  170 (436)
Q Consensus        91 ~~g~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~DiAll~L~~~~~~~~~~v~pi~l~~~~~~~~~~~~~~~~~GwG~~~~  170 (436)
                      ..+...........+.+.|+++++||+|+  .||||||||++|+. ++.+++|||||..+  ....+..++++|||.+..
T Consensus       156 ~~~~~~~~~~~~~~~~~~V~~i~~HP~y~--~nDIALlkL~~~v~-~~~~v~PicLp~~~--~~~~g~~~~v~GWG~~~~  230 (347)
T 4f4o_C          156 KDIAPTLRLYVGKKQEVEIEKVIFHPDNS--TVDIGLIKLKQKVP-VNERVMPICLPSKD--YVNVGLVGYVSGWGRNAN  230 (347)
T ss_dssp             HHHGGGCEEEETTTEEECEEEEEECSCTT--TCCCEEEEESSCCC-CSSSCCCCBCCSSC--CCCTTCEEEEEECSBCTT
T ss_pred             EeeeeeeeecCCCeEEEEEEEEEECcCCC--CCCEEEEEECCCcc-CCCceeeeecCccc--cCCCCcEEEEeccccCCC
Confidence            22322222223345788999999999986  58999999999999 78899999999853  345788999999998763


Q ss_pred             CCCccccceeeeeeccchhhhhhhcCCCcCCcCCeEEeccCCCCCCCccCCCCCeeeeEecCCcEEEEEEEeEcCCCCCC
Q psy16044        171 KGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGV  250 (436)
Q Consensus       171 ~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~Ca~~~~~~~~~C~gDsGgPl~~~~~~~~~~l~GI~S~g~~~C~~  250 (436)
                       +..+..|+++.+++++.+.|...|.......                            .                   
T Consensus       231 -~~~s~~L~~~~v~iv~~~~C~~~~~~~~~~~----------------------------~-------------------  262 (347)
T 4f4o_C          231 -LNFTEHLKYVMLPVADQEKCVQYYEGSTVPE----------------------------K-------------------  262 (347)
T ss_dssp             -SSBCSSCEEEEEEEECHHHHHHHHSSCSSGG----------------------------G-------------------
T ss_pred             -CCCCccceEEEEEEeCHHHHHHHhccccccc----------------------------c-------------------
Confidence             4567789999999999999998875321100                            0                   


Q ss_pred             CcccccccceecCCccccCCCCCcccccccccccceeecccccccCCCCeeeeccCCCCCCCCCCCCeEEEEecCCCCCC
Q psy16044        251 GIRYSHRQPRLINGKESIRGAWPWQNLITSFLSAALLKLSRPTSARDKGVRAVCLTDADKRPVNPKQQCVATGWGRVKPK  330 (436)
Q Consensus       251 ~~~y~~v~~~~~~~~~~~~~~~p~~~~~~~~~diali~l~~~~~~~~~~v~picl~~~~~~~~~~~~~~~~~Gwg~~~~~  330 (436)
                                                                                                      
T Consensus       263 --------------------------------------------------------------------------------  262 (347)
T 4f4o_C          263 --------------------------------------------------------------------------------  262 (347)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCccccceEEEEEeeCccccccccCCCccCCCCceecccCCCCCCCccCCCCceeeeEe-cCCcEEEEEEEEecCCCCCC
Q psy16044        331 GDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGHLCGGQLDGFSGACIGDSGGPLQCSL-KDGRWYLAGITSFGSGCAKS  409 (436)
Q Consensus       331 ~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~-~~~~~~l~Gi~S~~~~c~~~  409 (436)
                                       ..+.........++++||||+...+++++|+|||||||++.. .+++|+|+||+|||.+|+. 
T Consensus       263 -----------------~~~~~~~~~~~~~~~~~iCAG~~~~~~d~C~GDSGGPLv~~~~~~~~~~lvGIvS~G~~C~~-  324 (347)
T 4f4o_C          263 -----------------KTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRT-  324 (347)
T ss_dssp             -----------------CCCCCSSSSCCCCSTTEEEECCCTTCCCCCTTCTTCEEEEEETTTTEEEEEEEEEECCCTTT-
T ss_pred             -----------------ccccccccccccccCCeEEecCCCCCCCCCCCCCCcceEEEeCCCCEEEEEEEEEeCCCCCC-
Confidence                             000000000114688999998877778999999999999976 4789999999999999976 


Q ss_pred             CCCeEEEeCcccHHHHHHHHhhh
Q psy16044        410 GYPDVYTKLSFYLPWIRKQINIA  432 (436)
Q Consensus       410 ~~p~v~t~V~~~~~WI~~~i~~~  432 (436)
                      ..|+|||||++|++||+++|+++
T Consensus       325 ~~pgVYTrVs~y~~WI~~~i~~N  347 (347)
T 4f4o_C          325 AEYGVYVRVTSILDWIQTTIADN  347 (347)
T ss_dssp             SSCEEEEEHHHHHHHHHHHHTC-
T ss_pred             CCCeEEEEHHHHHHHHHHHHHcC
Confidence            46999999999999999999764



>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} Back     alignment and structure
>3h09_A IGA1 protease, immunoglobulin A1 protease; serine protease, beta helix, hydrolase, M protease, secreted, transmembrane, virulence; 1.75A {Haemophilus influenzae} Back     alignment and structure
>3sze_A Serine protease ESPP; parallel beta-helix, hydrolase; 2.50A {Escherichia coli O157} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 436
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 5e-36
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 8e-25
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 1e-35
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 4e-24
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 3e-35
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 2e-24
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 7e-35
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 3e-23
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 5e-34
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 3e-24
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 1e-33
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 4e-22
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 3e-33
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 1e-23
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 5e-33
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 7e-24
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 2e-32
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 2e-24
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 2e-31
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 2e-21
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 6e-31
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 4e-20
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 1e-30
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 3e-21
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 2e-30
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 6e-23
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 3e-30
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 1e-21
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 4e-30
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 1e-20
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 7e-30
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 7e-22
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 7e-30
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 4e-16
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 7e-30
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 3e-20
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 2e-29
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 4e-18
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 2e-29
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 1e-21
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 6e-29
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 3e-20
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 4e-28
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 2e-16
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 8e-28
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 3e-18
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 1e-27
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 4e-18
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 4e-27
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 3e-19
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 5e-27
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 1e-17
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 8e-27
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 1e-20
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 9e-27
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 5e-18
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 1e-26
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 3e-17
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 1e-26
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 8e-18
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-26
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 8e-18
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 2e-26
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 2e-19
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 3e-26
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 2e-17
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 3e-26
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 7e-17
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 6e-26
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 7e-19
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 8e-26
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 4e-15
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 3e-25
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 3e-16
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 9e-25
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 7e-16
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 1e-24
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 8e-17
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 2e-24
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 1e-13
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 4e-24
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 3e-14
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 2e-23
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 2e-16
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 3e-23
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 2e-19
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 4e-23
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 5e-13
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 1e-22
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 7e-17
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 1e-22
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 1e-15
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 1e-22
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 6e-15
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 2e-22
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 4e-14
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 4e-22
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 2e-14
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 6e-22
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 5e-12
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 6e-22
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 2e-13
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 8e-22
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 8e-14
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 1e-21
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 9e-12
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 1e-21
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 1e-13
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 8e-19
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 4e-13
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 2e-18
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 5e-12
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-17
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 5e-09
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 2e-16
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 2e-12
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 1e-08
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 2e-05
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 1e-07
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 2e-06
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 4e-04
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Trypsin(ogen)
species: Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]
 Score =  130 bits (328), Expect = 5e-36
 Identities = 75/226 (33%), Positives = 112/226 (49%), Gaps = 12/226 (5%)

Query: 28  INGKESIRGAWPWQVSLQVLHPRLGLMPHWCGAVLIHPSWVVTAAHCIHNDIFSLPIPEL 87
           + G ++  G +P+Q+S Q     +G   H+CGA + + ++ +TA HC++ D      P  
Sbjct: 2   VGGTDATLGEFPYQLSFQ--ETFIGFSFHFCGASIYNENYAITAGHCVYGD--DYENPSG 57

Query: 88  WTAVLGDWDRTEEEKSEVRIPVERIRVHEEF--HNYHHDIALLKLSRPTSARDKGVRAVC 145
              V G+ D +  E SE  I V +I +HE F  +   +DI+LLKLS   +  D  V  + 
Sbjct: 58  LQIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDN-VAPIA 116

Query: 146 LTDADKRPVNPKQQCVATGWGRVKPKGDLVSKLRQIRVPLHNISVCRDKYGDSVELHGGH 205
           L +            + TGWG     G+    L+++ VPL +   CR  YG + E+    
Sbjct: 117 LPEQGHTATG---DVIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYG-ADEILDSM 172

Query: 206 LCGGQLDGFSGACIGDSGGPLQCSLKDGRWYLAGITSFGSGYCGVG 251
           +C G  +G   +C GDSGGPL  S   G  YLAGI S+G G    G
Sbjct: 173 ICAGVPEGGKDSCQGDSGGPLAAS-DTGSTYLAGIVSWGYGCARPG 217


>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 100.0
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 100.0
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 100.0
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 100.0
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 100.0
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 100.0
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 100.0
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 100.0
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 100.0
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 100.0
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 100.0
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 100.0
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 100.0
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 100.0
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 100.0
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 100.0
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 100.0
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 100.0
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 100.0
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 100.0
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 100.0
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 100.0
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 100.0
d1elva1259 Complement C1S protease, catalytic domain {Human ( 100.0
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 100.0
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 100.0
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 100.0
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 100.0
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 100.0
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 100.0
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 100.0
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 100.0
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 100.0
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 100.0
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 100.0
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 100.0
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 100.0
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 100.0
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.94
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.94
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.94
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.92
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.91
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.91
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.9
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.9
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.9
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.89
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.89
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.89
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.88
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.88
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.88
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.87
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.86
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.62
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.6
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.47
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.47
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.47
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.46
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.46
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.41
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.39
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.38
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.37
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.36
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.31
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.26
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.26
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.2
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.19
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.18
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.16
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.15
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.15
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.14
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.13
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.1
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.1
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.08
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.07
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.06
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.02
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.0
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 98.86
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 98.78
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.78
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 98.67
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.66
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 98.66
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 98.6
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 98.59
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.53
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 98.53
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 98.36
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 98.25
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 97.8
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 97.78
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 97.73
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 97.72
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 97.37
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 96.34
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 94.86
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 94.27
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 94.08
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 93.56
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 93.18
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 92.44
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 91.96
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 91.18
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 90.33
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 89.76
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure