Psyllid ID: psy16161


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
IISKKEQEEEEEEEKKKKKKKKKKKKKFLQLDTNRILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSKHSTTSVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWNAVSPP
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHccccEEEEEEEHHHHHHHccccccHHHHHHHHHHcccccccEEcccccHHHHHccccEEEEEccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccccHHHcccEEEEEEEEHHcccccccccccccEEEEEccccccccccccccccccHHcHHHHHHHHHcccccccccccEEEcccccEEcccccccc
cccHHHHHHHHHHHccccccccccccHEEEEHHHEEcccHHHHHHHHHHHHHccccEEEEEEEccccccccEHHHHHHHccccEEEEEEEEHHHHHHccccccHHHHHHHHccccccccEEEEEcccHHHHHccccEEEEEcccEEEcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHEEEEEEEEEEcccHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHccEEEEEEcccEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHccEEEEEEcccEccccccccccEcHHHHcHHHHHHHccccccccccccEEEEccEEEcccccccc
IISKKEQEEEEEEEKKKKKKKKKKKKKFLQLDTNRILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAplmhrlqngeHFRVVVVFELERLvhnmpggngadarqqekgegkhcpciplttggsedskhstTSVILvgehkktsvkgnapfgqqaETTLATNFFALVTVCHMLFPLLRPHARVVNVASQygmlykvpsqeLKQTLLNDSLTEDQLVGMMHDYVKLAKegkdqeagwpddpytvskVGVIKLSFIQHatlskdqtrpdiivnavhpgyvntdltghkgILTMTIHTLKVGVIKLSFIQHatlskdqtrpdiivnavhpgyvntdltghkgiltteqgsvssvkgalippdakeprgqfiwydgsivdwnavspp
iiskkeqeeeeeEEKKkkkkkkkkkkkflqldtnriltrsmnARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPlttggsedskhSTTSVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKegkdqeagwpdDPYTVSKVGVIKLSFIQHAtlskdqtrpDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATlskdqtrpdIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWNAVSPP
IISkkeqeeeeeeekkkkkkkkkkkkkFLQLDTNRILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEhfrvvvvfelerlvhNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSKHSTTSVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWNAVSPP
**********************************RILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHN****************************************ILV***************QQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEG***EAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTE**********L********RGQFIWYDGSIVDWNA****
************************************LTRSMNARFLRKFYQ*ERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSKHSTTSVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWN*****
***************************FLQLDTNRILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHNMPGGNGA**********KHCPCIPLTT***********SVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWNAVSPP
*****E****************KKKKKFLQLDTNRILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSKHSTTSVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWNA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxFLQLDTNRILTRSMNARFLRKFYQQERISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRVVVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSKHSTTSVILVGEHKKTSVKGNAPFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWNAVSPP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query387 2.2.26 [Sep-21-2011]
P16152277 Carbonyl reductase [NADPH yes N/A 0.431 0.602 0.340 2e-25
Q5RCU5277 Carbonyl reductase [NADPH yes N/A 0.431 0.602 0.340 3e-25
P48758277 Carbonyl reductase [NADPH yes N/A 0.465 0.649 0.324 5e-25
O75828277 Carbonyl reductase [NADPH no N/A 0.452 0.631 0.318 5e-25
P47844277 Carbonyl reductase [NADPH no N/A 0.452 0.631 0.344 6e-25
Q8MI29277 Carbonyl reductase [NADPH N/A N/A 0.348 0.487 0.419 1e-24
Q8K354277 Carbonyl reductase [NADPH no N/A 0.431 0.602 0.327 4e-24
Q28960289 Carbonyl reductase [NADPH no N/A 0.462 0.619 0.323 2e-22
Q3SZD7277 Carbonyl reductase [NADPH no N/A 0.354 0.494 0.434 7e-22
P47727277 Carbonyl reductase [NADPH no N/A 0.356 0.498 0.410 1e-21
>sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 Back     alignment and function desciption
 Score =  116 bits (291), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 108/220 (49%), Gaps = 53/220 (24%)

Query: 154 PFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGM-LYKVPSQELKQTLLND 212
           PF  QAE T+ TNFF    VC  L PL++P  RVVNV+S   +   K  S EL+Q   ++
Sbjct: 102 PFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSE 161

Query: 213 SLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDI 272
           ++TE++LVG+M+ +V+  K+G  Q+ GWP   Y V+K+GV  LS I    LS+ +    I
Sbjct: 162 TITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKI 221

Query: 273 IVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPG 332
           ++NA  PG+V TD+ G K                      AT S +              
Sbjct: 222 LLNACCPGWVRTDMAGPK----------------------ATKSPE-------------- 245

Query: 333 YVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFI 372
                           +G+ + V  AL+PPDA+ P GQF+
Sbjct: 246 ----------------EGAETPVYLALLPPDAEGPHGQFV 269




NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 8EC: 9
>sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 Back     alignment and function description
>sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 Back     alignment and function description
>sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 Back     alignment and function description
>sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 Back     alignment and function description
>sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=2 SV=1 Back     alignment and function description
>sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 Back     alignment and function description
>sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 Back     alignment and function description
>sp|P47727|CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
346471833277 hypothetical protein [Amblyomma maculatu 0.457 0.638 0.413 2e-43
427787661277 Putative 20-hydroxysteroid dehydrogenase 0.457 0.638 0.404 3e-42
346467597262 hypothetical protein [Amblyomma maculatu 0.434 0.641 0.425 1e-41
427785103276 Putative 20-hydroxysteroid dehydrogenase 0.467 0.655 0.393 1e-41
442755155277 Putative 20-hydroxysteroid dehydrogenase 0.459 0.642 0.411 1e-41
241858242252 20-hydroxysteroid dehydrogenase, putativ 0.364 0.559 0.549 2e-37
442749421277 Putative 20-hydroxysteroid dehydrogenase 0.454 0.635 0.375 2e-37
321468273290 hypothetical protein DAPPUDRAFT_231053 [ 0.452 0.603 0.369 5e-37
322800101267 hypothetical protein SINV_12418 [Solenop 0.447 0.647 0.383 3e-35
193704482281 PREDICTED: carbonyl reductase [NADPH] 3- 0.454 0.626 0.390 1e-34
>gi|346471833|gb|AEO35761.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 131/230 (56%), Gaps = 53/230 (23%)

Query: 153 APFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGMLYKVPSQELKQTLLND 212
           APFG+QAE T+ TNFF+ + VC  LFPLLRPHARVVNV+S  GML ++P +ELK+ L N 
Sbjct: 100 APFGEQAEVTVKTNFFSTLNVCKELFPLLRPHARVVNVSSMCGMLQRIPGEELKKKLSNP 159

Query: 213 SLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDI 272
           ++T ++L  +M ++V+ AKEGK++E GW    Y VSKVGV  LSFIQ    ++D  R D+
Sbjct: 160 NITLEELCSLMEEFVQAAKEGKNKEKGWGQSAYNVSKVGVTVLSFIQQREFNED-PREDL 218

Query: 273 IVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPG 332
           +VNAVHPGYV+TD++ HKG LT                           PD         
Sbjct: 219 VVNAVHPGYVDTDMSSHKGPLT---------------------------PD--------- 242

Query: 333 YVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDWN 382
                           QG+ +    A++PP+   P+G+F+W D +I  W+
Sbjct: 243 ----------------QGADAPTYLAMLPPNINSPKGEFVWNDRTITPWD 276




Source: Amblyomma maculatum

Species: Amblyomma maculatum

Genus: Amblyomma

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427787661|gb|JAA59282.1| Putative 20-hydroxysteroid dehydrogenase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|346467597|gb|AEO33643.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|427785103|gb|JAA58003.1| Putative 20-hydroxysteroid dehydrogenase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|442755155|gb|JAA69737.1| Putative 20-hydroxysteroid dehydrogenase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|241858242|ref|XP_002416147.1| 20-hydroxysteroid dehydrogenase, putative [Ixodes scapularis] gi|215510361|gb|EEC19814.1| 20-hydroxysteroid dehydrogenase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|442749421|gb|JAA66870.1| Putative 20-hydroxysteroid dehydrogenase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|321468273|gb|EFX79259.1| hypothetical protein DAPPUDRAFT_231053 [Daphnia pulex] Back     alignment and taxonomy information
>gi|322800101|gb|EFZ21207.1| hypothetical protein SINV_12418 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|193704482|ref|XP_001942666.1| PREDICTED: carbonyl reductase [NADPH] 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query387
UNIPROTKB|J9P7P2277 CBR1 "Uncharacterized protein" 0.346 0.483 0.452 4.6e-25
RGD|2286277 Cbr1 "carbonyl reductase 1" [R 0.354 0.494 0.413 7.6e-25
UNIPROTKB|P16152277 CBR1 "Carbonyl reductase [NADP 0.354 0.494 0.434 1.2e-24
UNIPROTKB|Q5RCU5277 CBR1 "Carbonyl reductase [NADP 0.351 0.490 0.446 1.2e-24
UNIPROTKB|F1N8Y3276 CBR1 "Uncharacterized protein" 0.366 0.514 0.419 1.6e-24
UNIPROTKB|F1P2X1277 CBR1 "Uncharacterized protein" 0.366 0.512 0.419 1.6e-24
UNIPROTKB|Q3SZD7277 CBR1 "Carbonyl reductase [NADP 0.354 0.494 0.434 2e-24
ZFIN|ZDB-GENE-030902-2276 cbr1 "carbonyl reductase 1" [D 0.348 0.489 0.419 2e-24
MGI|MGI:88284277 Cbr1 "carbonyl reductase 1" [M 0.366 0.512 0.412 3.3e-24
UNIPROTKB|Q8MI29277 CBR1 "Carbonyl reductase [NADP 0.348 0.487 0.419 3.3e-24
UNIPROTKB|J9P7P2 CBR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 4.6e-25, P = 4.6e-25
 Identities = 62/137 (45%), Positives = 88/137 (64%)

Query:   154 PFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGM-LYKVPSQELKQTLLND 212
             PF  QAE T+ TNFF    VC  L PL++P  RVVNV+S   +   K  S EL+Q   ++
Sbjct:   102 PFHIQAEVTMKTNFFGTRDVCTELLPLMKPQGRVVNVSSVVSVRALKSCSPELQQKFRSE 161

Query:   213 SLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPD- 271
             ++TE++LVG+M+ +V+  K+G  +  GWPD+ Y V+K+GV  LS I HA    +Q R D 
Sbjct:   162 AITEEELVGLMNKFVEDTKKGVHRNEGWPDNAYGVTKIGVTVLSRI-HARKLSEQRRDDK 220

Query:   272 IIVNAVHPGYVNTDLTG 288
             I++NA  PG+V TD+ G
Sbjct:   221 ILLNACCPGWVRTDMAG 237


GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
RGD|2286 Cbr1 "carbonyl reductase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P16152 CBR1 "Carbonyl reductase [NADPH] 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCU5 CBR1 "Carbonyl reductase [NADPH] 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8Y3 CBR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2X1 CBR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZD7 CBR1 "Carbonyl reductase [NADPH] 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030902-2 cbr1 "carbonyl reductase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:88284 Cbr1 "carbonyl reductase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MI29 CBR1 "Carbonyl reductase [NADPH] 1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 3e-20
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 5e-06
COG1028251 COG1028, FabG, Dehydrogenases with different speci 6e-06
cd05233234 cd05233, SDR_c, classical (c) SDRs 9e-06
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 4e-05
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 5e-05
PRK12428241 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydro 8e-05
PRK06953222 PRK06953, PRK06953, short chain dehydrogenase; Pro 2e-04
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
 Score = 88.1 bits (219), Expect = 3e-20
 Identities = 58/231 (25%), Positives = 77/231 (33%), Gaps = 104/231 (45%)

Query: 153 APFGQQAETTLATNFFALVTVCHMLFPLLRP--HARVVNVASQYGMLYKVPSQELKQTLL 210
            P  +QA  T+ TNFF  V V   L PLL+     R+VNV+S  G               
Sbjct: 97  TPTREQARETMKTNFFGTVDVTQALLPLLKKSPAGRIVNVSSGLG--------------- 141

Query: 211 NDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRP 270
             SLT                             Y VSK  +  L+ I    L+K+    
Sbjct: 142 --SLTS---------------------------AYGVSKAALNALTRI----LAKELKET 168

Query: 271 DIIVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVH 330
            I VNA  PG+V TD+ G K   T                           P+       
Sbjct: 169 GIKVNACCPGWVKTDMGGGKAPKT---------------------------PE------- 194

Query: 331 PGYVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDW 381
                             +G+ + V  AL+PPD  EP G+F + D  +V W
Sbjct: 195 ------------------EGAETPVYLALLPPDG-EPTGKF-FSDKKVVPW 225


PTCR is a classical SDR which catalyzes the NADPH-dependent reduction of ketones on steroids and prostaglandins. Unlike most SDRs, PTCR functions as a monomer. This subgroup also includes human carbonyl reductase 1 (CBR1) and CBR3. CBR1 is an NADPH-dependent SDR with broad substrate specificity and may be responsible for the in vivo reduction of quinones, prostaglandins, and other carbonyl-containing compounds. In addition it includes poppy NADPH-dependent salutaridine reductase which catalyzes the stereospecific reduction of salutaridine to 7(S)-salutaridinol in the biosynthesis of morphine, and Arabidopsis SDR1,a menthone reductase, which catalyzes the reduction of menthone to neomenthol, a compound with antimicrobial activity; SDR1 can also carry out neomenthol oxidation. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 225

>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237099 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180774 PRK06953, PRK06953, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 387
KOG1200|consensus256 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
KOG0725|consensus270 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06484520 short chain dehydrogenase; Validated 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
KOG1205|consensus282 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
KOG1207|consensus245 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK09242257 tropinone reductase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
KOG1201|consensus300 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.98
PRK12744257 short chain dehydrogenase; Provisional 99.98
PRK06500249 short chain dehydrogenase; Provisional 99.98
KOG1611|consensus249 99.98
PRK06483236 dihydromonapterin reductase; Provisional 99.98
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
PRK06701290 short chain dehydrogenase; Provisional 99.98
PRK08628258 short chain dehydrogenase; Provisional 99.98
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.98
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.98
PRK07890258 short chain dehydrogenase; Provisional 99.97
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK07814263 short chain dehydrogenase; Provisional 99.97
PRK08278273 short chain dehydrogenase; Provisional 99.97
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.97
PRK12939250 short chain dehydrogenase; Provisional 99.97
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.97
PRK07576264 short chain dehydrogenase; Provisional 99.97
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.97
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.97
PRK06947248 glucose-1-dehydrogenase; Provisional 99.97
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.97
PRK06484 520 short chain dehydrogenase; Validated 99.97
PRK08862227 short chain dehydrogenase; Provisional 99.97
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.97
KOG1208|consensus314 99.97
PRK05872296 short chain dehydrogenase; Provisional 99.97
PRK09186256 flagellin modification protein A; Provisional 99.97
PRK06138252 short chain dehydrogenase; Provisional 99.97
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.97
PRK06139330 short chain dehydrogenase; Provisional 99.97
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK05599246 hypothetical protein; Provisional 99.97
PRK06057255 short chain dehydrogenase; Provisional 99.97
PRK08703239 short chain dehydrogenase; Provisional 99.97
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.97
PLN00015308 protochlorophyllide reductase 99.97
PRK06198260 short chain dehydrogenase; Provisional 99.97
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.97
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.97
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.97
PRK06123248 short chain dehydrogenase; Provisional 99.97
PRK07109334 short chain dehydrogenase; Provisional 99.97
PRK12746254 short chain dehydrogenase; Provisional 99.97
PRK07069251 short chain dehydrogenase; Validated 99.97
PRK05876275 short chain dehydrogenase; Provisional 99.97
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK07774250 short chain dehydrogenase; Provisional 99.97
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.97
PRK05854313 short chain dehydrogenase; Provisional 99.97
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK05875276 short chain dehydrogenase; Provisional 99.96
PRK09009235 C factor cell-cell signaling protein; Provisional 99.96
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.96
PRK06196315 oxidoreductase; Provisional 99.96
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.96
KOG1610|consensus322 99.96
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.96
PRK07074257 short chain dehydrogenase; Provisional 99.96
PRK09134258 short chain dehydrogenase; Provisional 99.96
PRK07806248 short chain dehydrogenase; Provisional 99.96
KOG4169|consensus261 99.96
PRK07577234 short chain dehydrogenase; Provisional 99.96
KOG1199|consensus260 99.96
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.96
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.96
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK06197306 short chain dehydrogenase; Provisional 99.96
PRK12827249 short chain dehydrogenase; Provisional 99.96
PRK05866293 short chain dehydrogenase; Provisional 99.96
PRK05855582 short chain dehydrogenase; Validated 99.96
PRK06182273 short chain dehydrogenase; Validated 99.96
PRK07454241 short chain dehydrogenase; Provisional 99.96
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.96
PRK07825273 short chain dehydrogenase; Provisional 99.96
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK07060245 short chain dehydrogenase; Provisional 99.96
PRK07832272 short chain dehydrogenase; Provisional 99.96
PLN02780320 ketoreductase/ oxidoreductase 99.96
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK06924251 short chain dehydrogenase; Provisional 99.96
PRK07041230 short chain dehydrogenase; Provisional 99.95
PRK07024257 short chain dehydrogenase; Provisional 99.95
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.95
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.95
PRK07904253 short chain dehydrogenase; Provisional 99.95
PRK12828239 short chain dehydrogenase; Provisional 99.95
PRK06180277 short chain dehydrogenase; Provisional 99.95
COG1028251 FabG Dehydrogenases with different specificities ( 99.95
PRK05650270 short chain dehydrogenase; Provisional 99.95
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK08263275 short chain dehydrogenase; Provisional 99.95
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.95
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK05993277 short chain dehydrogenase; Provisional 99.95
PRK08324681 short chain dehydrogenase; Validated 99.95
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK06194287 hypothetical protein; Provisional 99.95
PRK06101240 short chain dehydrogenase; Provisional 99.95
PRK09072263 short chain dehydrogenase; Provisional 99.95
PRK07102243 short chain dehydrogenase; Provisional 99.95
PRK07775274 short chain dehydrogenase; Provisional 99.94
PRK10538248 malonic semialdehyde reductase; Provisional 99.94
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.94
PRK08251248 short chain dehydrogenase; Provisional 99.94
PRK06179270 short chain dehydrogenase; Provisional 99.94
PRK12829264 short chain dehydrogenase; Provisional 99.94
PRK08177225 short chain dehydrogenase; Provisional 99.94
PRK08267260 short chain dehydrogenase; Provisional 99.94
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.94
PRK06914280 short chain dehydrogenase; Provisional 99.94
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.94
PRK09135249 pteridine reductase; Provisional 99.94
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.94
PRK07201657 short chain dehydrogenase; Provisional 99.94
PRK07578199 short chain dehydrogenase; Provisional 99.94
PRK05693274 short chain dehydrogenase; Provisional 99.94
PRK06181263 short chain dehydrogenase; Provisional 99.93
KOG1014|consensus312 99.93
PRK06482276 short chain dehydrogenase; Provisional 99.93
PRK07326237 short chain dehydrogenase; Provisional 99.93
PRK06953222 short chain dehydrogenase; Provisional 99.93
PRK07023243 short chain dehydrogenase; Provisional 99.92
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.92
KOG1209|consensus289 99.91
PRK12367245 short chain dehydrogenase; Provisional 99.91
PRK09291257 short chain dehydrogenase; Provisional 99.9
PRK08264238 short chain dehydrogenase; Validated 99.9
KOG1210|consensus331 99.9
PRK08017256 oxidoreductase; Provisional 99.9
KOG1204|consensus253 99.88
PRK08219227 short chain dehydrogenase; Provisional 99.87
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.84
KOG1478|consensus341 99.83
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.8
PLN03209 576 translocon at the inner envelope of chloroplast su 99.8
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.78
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.76
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.74
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.72
PLN02583297 cinnamoyl-CoA reductase 99.71
PLN02653340 GDP-mannose 4,6-dehydratase 99.7
KOG1502|consensus327 99.7
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.69
PLN02650351 dihydroflavonol-4-reductase 99.65
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.62
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.62
PLN02214342 cinnamoyl-CoA reductase 99.61
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.59
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.58
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.57
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.56
PLN00198338 anthocyanidin reductase; Provisional 99.56
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.53
PLN02686367 cinnamoyl-CoA reductase 99.52
PRK06720169 hypothetical protein; Provisional 99.52
PLN02240352 UDP-glucose 4-epimerase 99.51
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.51
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.5
PLN02896353 cinnamyl-alcohol dehydrogenase 99.49
PLN02572442 UDP-sulfoquinovose synthase 99.49
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.48
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.48
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.47
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.47
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.44
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.44
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.4
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.38
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.37
PLN02427386 UDP-apiose/xylose synthase 99.32
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.3
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.29
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.26
PLN02260 668 probable rhamnose biosynthetic enzyme 99.25
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.23
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.22
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.21
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.19
KOG1371|consensus343 99.15
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.12
PLN02206442 UDP-glucuronate decarboxylase 99.09
CHL00194317 ycf39 Ycf39; Provisional 99.09
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.08
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.06
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.04
PLN02166436 dTDP-glucose 4,6-dehydratase 99.04
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.99
KOG4022|consensus236 98.98
PRK07201 657 short chain dehydrogenase; Provisional 98.98
COG3320382 Putative dehydrogenase domain of multifunctional n 98.97
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.97
KOG1430|consensus361 98.96
PLN02996 491 fatty acyl-CoA reductase 98.93
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.92
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.88
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.88
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.78
PLN02503 605 fatty acyl-CoA reductase 2 98.77
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.75
PLN02778298 3,5-epimerase/4-reductase 98.6
KOG0747|consensus331 98.59
PRK05865 854 hypothetical protein; Provisional 98.59
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.5
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.46
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.45
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.37
KOG1221|consensus 467 98.36
PLN00016378 RNA-binding protein; Provisional 98.33
PLN02260668 probable rhamnose biosynthetic enzyme 98.3
PRK08309177 short chain dehydrogenase; Provisional 98.19
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.14
KOG1429|consensus350 98.08
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.02
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 97.9
PRK12320 699 hypothetical protein; Provisional 97.88
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.88
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.73
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.72
KOG1203|consensus411 97.52
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.47
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.45
KOG2865|consensus391 97.42
KOG1202|consensus 2376 97.15
PLN00106323 malate dehydrogenase 97.04
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.7
PTZ00325321 malate dehydrogenase; Provisional 96.7
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.61
KOG1372|consensus376 96.48
KOG2774|consensus366 96.47
KOG2733|consensus423 96.42
PRK06732229 phosphopantothenate--cysteine ligase; Validated 96.36
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.29
PRK14982340 acyl-ACP reductase; Provisional 96.09
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.01
KOG4039|consensus238 95.97
COG2910211 Putative NADH-flavin reductase [General function p 95.68
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 95.55
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 95.51
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 95.51
KOG1431|consensus315 95.42
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 95.39
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.35
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.14
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.12
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.83
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 94.4
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.39
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.26
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 94.01
PRK14968188 putative methyltransferase; Provisional 93.72
PRK09620229 hypothetical protein; Provisional 93.72
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 93.66
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 93.49
PRK05086312 malate dehydrogenase; Provisional 93.4
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 93.31
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 93.22
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 93.09
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.08
PRK12549284 shikimate 5-dehydrogenase; Reviewed 92.65
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 92.65
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 92.52
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 92.4
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 92.38
PRK06849389 hypothetical protein; Provisional 92.37
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 92.07
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 91.9
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 91.88
KOG1197|consensus336 91.86
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 91.72
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 91.45
PRK14027283 quinate/shikimate dehydrogenase; Provisional 90.94
KOG0023|consensus360 90.92
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 90.88
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.66
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 90.45
PRK13940414 glutamyl-tRNA reductase; Provisional 90.36
PRK04148134 hypothetical protein; Provisional 89.95
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 89.91
PLN00112444 malate dehydrogenase (NADP); Provisional 89.87
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.28
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 88.93
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 88.83
COG2130340 Putative NADP-dependent oxidoreductases [General f 88.8
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 88.74
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 88.5
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 88.27
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 88.2
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 88.12
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 87.97
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 87.74
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 87.69
PRK09496 453 trkA potassium transporter peripheral membrane com 87.62
PRK09496453 trkA potassium transporter peripheral membrane com 87.53
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 87.36
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 87.19
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 87.13
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.11
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 87.09
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 87.07
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 87.05
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 87.04
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 87.01
PRK12550272 shikimate 5-dehydrogenase; Reviewed 86.96
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 86.82
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 86.81
KOG4288|consensus283 86.59
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 86.36
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 86.33
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 86.3
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 86.19
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 86.18
KOG1198|consensus347 86.08
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 86.0
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 85.91
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.71
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 85.68
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 85.67
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 85.55
PRK14901434 16S rRNA methyltransferase B; Provisional 85.33
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 85.3
PLN00203519 glutamyl-tRNA reductase 85.21
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 84.83
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 84.83
PRK05442326 malate dehydrogenase; Provisional 84.66
COG3268382 Uncharacterized conserved protein [Function unknow 84.53
PRK06719157 precorrin-2 dehydrogenase; Validated 84.4
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 83.99
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 83.88
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 83.72
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.7
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.57
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 83.56
PRK08655 437 prephenate dehydrogenase; Provisional 83.37
TIGR00438188 rrmJ cell division protein FtsJ. 83.28
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 83.27
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 83.21
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 83.17
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 83.06
COG2263198 Predicted RNA methylase [Translation, ribosomal st 82.88
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 82.86
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 82.83
PRK14903431 16S rRNA methyltransferase B; Provisional 82.78
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.74
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 82.71
PTZ00117319 malate dehydrogenase; Provisional 82.7
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 82.59
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.36
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 82.03
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 81.95
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.88
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 81.85
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.75
PRK14902444 16S rRNA methyltransferase B; Provisional 81.56
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 81.39
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 81.29
PRK11207197 tellurite resistance protein TehB; Provisional 81.27
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 81.19
COG0569225 TrkA K+ transport systems, NAD-binding component [ 81.19
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.88
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.55
PRK15116268 sulfur acceptor protein CsdL; Provisional 80.47
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.38
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.33
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 80.22
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.05
>KOG1200|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-40  Score=293.07  Aligned_cols=229  Identities=17%  Similarity=0.184  Sum_probs=200.1

Q ss_pred             ccCCcEEEEecCCCcccHHHHHHHhhccCCCCc-eEEEEecccCCCCCcccHHHHHHHHhcCCCcccEEeccCCCChhhH
Q psy16161         54 RISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRV-VVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSK  132 (387)
Q Consensus        54 ~l~gk~vlVTGassGIG~aia~~~L~~a~~~~G-~Vil~~~R~~~~~~~~~~~~~~~~l~~~~~~v~~~~~Dlt~~~~sv  132 (387)
                      ++..|.++||||++|||++++.. |  ++  .| +|+++ ++     +....++.+..|...+ ....+.||++ +.+++
T Consensus        11 r~~sk~~~vtGg~sGIGrAia~~-l--a~--~Garv~v~-dl-----~~~~A~ata~~L~g~~-~h~aF~~DVS-~a~~v   77 (256)
T KOG1200|consen   11 RLMSKVAAVTGGSSGIGRAIAQL-L--AK--KGARVAVA-DL-----DSAAAEATAGDLGGYG-DHSAFSCDVS-KAHDV   77 (256)
T ss_pred             HHhcceeEEecCCchHHHHHHHH-H--Hh--cCcEEEEe-ec-----chhhHHHHHhhcCCCC-ccceeeeccC-cHHHH
Confidence            45578999999999999999999 9  99  99 99999 88     8788888888886653 5778999999 99999


Q ss_pred             HHHHHHHHHhhcCC----eeeCCCCCCh-------hHHHHHHHhhchHHHHHHHHHhhcc--cC--CCEEEEEcCCcccc
Q psy16161        133 HSTTSVILVGEHKK----TSVKGNAPFG-------QQAETTLATNFFALVTVCHMLFPLL--RP--HARVVNVASQYGML  197 (387)
Q Consensus       133 ~~~~~~~~~~~~~~----VnnAg~~~~~-------~~~~~~~~vN~~g~~~l~~~~lp~l--~~--~grIv~vSS~~~~~  197 (387)
                      +..++ +..+.++.    |||||+....       ++|+..+.+|+.|.|++++++...|  +.  +++||||||+.|..
T Consensus        78 ~~~l~-e~~k~~g~psvlVncAGItrD~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGki  156 (256)
T KOG1200|consen   78 QNTLE-EMEKSLGTPSVLVNCAGITRDGLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKI  156 (256)
T ss_pred             HHHHH-HHHHhcCCCcEEEEcCccccccceeeccHHHHHHHHHhhchhhHHHHHHHHHHHHHhcCCCceEEeehhhhccc
Confidence            99999 99999988    8999987665       9999999999999999999999874  33  25999999999988


Q ss_pred             ccCCchhHHhhhccCCcchHHHhhhHHHHHHHhhhcCCCCCCCCCCCchhhHHHHHHHHHHHHHHhCCCCCCCCcEEEEE
Q psy16161        198 YKVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAV  277 (387)
Q Consensus       198 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~Y~aSK~al~~l~~~la~el~~~~~~~gI~Vn~v  277 (387)
                      +                                        ...+..|++||.++.+|+++.|+|++    .+|||||+|
T Consensus       157 G----------------------------------------N~GQtnYAAsK~GvIgftktaArEla----~knIrvN~V  192 (256)
T KOG1200|consen  157 G----------------------------------------NFGQTNYAASKGGVIGFTKTAARELA----RKNIRVNVV  192 (256)
T ss_pred             c----------------------------------------cccchhhhhhcCceeeeeHHHHHHHh----hcCceEeEe
Confidence            3                                        23348999999999999999999999    899999999


Q ss_pred             eCCceecCCCCCcccchhhhhccccchhhhhhhhhcccccCCCCchhhhhhccCCccccccCCCCCCCChHHHHHHhhhh
Q psy16161        278 HPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKG  357 (387)
Q Consensus       278 ~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~peevA~~~~~l  357 (387)
                      +||++.|||+....                               ......+..   .+|+   +|++.+||+|..++||
T Consensus       193 lPGFI~tpMT~~mp-------------------------------~~v~~ki~~---~iPm---gr~G~~EevA~~V~fL  235 (256)
T KOG1200|consen  193 LPGFIATPMTEAMP-------------------------------PKVLDKILG---MIPM---GRLGEAEEVANLVLFL  235 (256)
T ss_pred             ccccccChhhhhcC-------------------------------HHHHHHHHc---cCCc---cccCCHHHHHHHHHHH
Confidence            99999999998852                               222222222   5788   8999999999999999


Q ss_pred             hccCCCCCCCCceEEeecCeee
Q psy16161        358 ALIPPDAKEPRGQFIWYDGSIV  379 (387)
Q Consensus       358 a~~~~~~~~~tG~~i~~dgg~~  379 (387)
                      ++  +.++|+||+.+.++||..
T Consensus       236 AS--~~ssYiTG~t~evtGGl~  255 (256)
T KOG1200|consen  236 AS--DASSYITGTTLEVTGGLA  255 (256)
T ss_pred             hc--cccccccceeEEEecccc
Confidence            99  999999999999999974



>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>KOG4288|consensus Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1wma_A276 Crystal Structure Of Human Cbr1 In Complex With Hyd 1e-26
2hrb_A274 Crystal Structure Of Human Carbonyl Reductase 3, Co 2e-26
2pfg_A276 Crystal Structure Of Human Cbr1 In Complex With Big 4e-25
1n5d_A288 Crystal Structure Of Porcine Testicular Carbonyl Re 6e-24
3o26_A311 The Structure Of Salutaridine Reductase From Papave 4e-06
>pdb|1WMA|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Hydroxy-pp Length = 276 Back     alignment and structure

Iteration: 1

Score = 117 bits (293), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 75/220 (34%), Positives = 108/220 (49%), Gaps = 53/220 (24%) Query: 154 PFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGM-LYKVPSQELKQTLLND 212 PF QAE T+ TNFF VC L PL++P RVVNV+S + K S EL+Q ++ Sbjct: 101 PFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSE 160 Query: 213 SLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDI 272 ++TE++LVG+M+ +V+ K+G Q+ GWP Y V+K+GV LS I LS+ + I Sbjct: 161 TITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKI 220 Query: 273 IVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPG 332 ++NA PG+V TD+ G K AT S + Sbjct: 221 LLNACCPGWVRTDMAGPK----------------------ATKSPE-------------- 244 Query: 333 YVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFI 372 +G+ + V AL+PPDA+ P GQF+ Sbjct: 245 ----------------EGAETPVYLALLPPDAEGPHGQFV 268
>pdb|2HRB|A Chain A, Crystal Structure Of Human Carbonyl Reductase 3, Complexed With Nadp+ Length = 274 Back     alignment and structure
>pdb|2PFG|A Chain A, Crystal Structure Of Human Cbr1 In Complex With Bigf2 Length = 276 Back     alignment and structure
>pdb|1N5D|A Chain A, Crystal Structure Of Porcine Testicular Carbonyl Reductase 20beta-Hydroxysteroid Dehydrogenase Length = 288 Back     alignment and structure
>pdb|3O26|A Chain A, The Structure Of Salutaridine Reductase From Papaver Somniferum Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query387
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 3e-46
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 7e-34
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 3e-14
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 7e-12
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 4e-13
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 4e-09
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 9e-09
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-06
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 1e-05
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 1e-05
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 2e-05
1ooe_A236 Dihydropteridine reductase; structural genomics, P 3e-05
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 4e-05
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 5e-05
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-05
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 6e-05
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 6e-05
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 7e-05
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 7e-05
3tjr_A301 Short chain dehydrogenase; structural genomics, se 9e-05
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 1e-04
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 2e-04
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 3e-04
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 3e-04
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 3e-04
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-04
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 3e-04
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 3e-04
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 4e-04
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 5e-04
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 6e-04
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 7e-04
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 7e-04
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 8e-04
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 8e-04
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 8e-04
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
 Score =  159 bits (403), Expect = 3e-46
 Identities = 74/229 (32%), Positives = 108/229 (47%), Gaps = 54/229 (23%)

Query: 154 PFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGML-YKVPSQELKQTLLND 212
           PF  QAE T+ TNFF    VC  L PL++P  RVVNV+S   +   K  S EL+Q   ++
Sbjct: 101 PFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSE 160

Query: 213 SLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDI 272
           ++TE++LVG+M+ +V+  K+G  Q+ GWP   Y V+K+GV                    
Sbjct: 161 TITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGV-------------------- 200

Query: 273 IVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPG 332
                                             LS I    LS+ +    I++NA  PG
Sbjct: 201 --------------------------------TVLSRIHARKLSEQRKGDKILLNACCPG 228

Query: 333 YVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDW 381
           +V TD+ G K   + E+G+ + V  AL+PPDA+ P GQF   +  +  W
Sbjct: 229 WVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF-VSEKRVEQW 276


>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.98
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.98
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.98
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.98
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.97
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.97
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.97
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.97
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.97
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.97
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.97
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.97
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.97
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.96
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.96
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.96
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.95
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.95
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.95
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.94
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.94
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.92
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.91
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.88
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.88
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.86
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.85
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.85
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.85
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.84
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.83
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.83
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.82
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.82
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.82
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.81
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.8
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.8
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.8
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.79
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.79
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.79
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.77
1xq6_A253 Unknown protein; structural genomics, protein stru 99.77
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.77
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.77
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.76
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.75
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.74
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.74
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.74
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.74
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.74
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.74
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.73
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.73
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.73
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.73
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.73
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.72
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.72
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.72
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.72
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.72
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.72
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.72
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.71
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.71
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.71
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.7
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.7
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.7
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.69
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.69
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.69
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.69
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.68
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.67
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.67
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.66
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.66
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.65
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.65
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.65
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.65
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.65
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.64
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.64
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.64
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.62
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.61
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.61
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.59
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.59
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.59
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.58
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.58
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.57
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.53
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.52
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.52
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.52
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.51
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.5
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.44
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.41
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.38
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.32
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.32
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.3
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.29
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.28
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.24
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.19
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.12
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.12
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.08
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 98.84
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.68
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.57
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.08
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.01
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.01
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.93
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.87
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.76
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.74
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.6
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.59
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.56
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.54
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 97.48
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.48
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.48
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.47
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.39
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.27
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.22
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.22
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.19
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 97.1
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.06
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.02
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.02
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.98
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 96.97
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.94
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 96.89
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.86
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.84
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.77
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 96.74
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.64
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.63
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.62
3krt_A456 Crotonyl COA reductase; structural genomics, prote 96.58
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.55
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.5
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.39
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.31
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.2
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.1
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 96.08
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.0
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.99
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.99
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.96
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.9
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.88
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 95.83
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.8
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.73
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 95.68
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 95.58
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 95.46
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.39
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 95.24
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 94.86
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.67
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 94.47
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.39
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.36
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 94.35
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 94.31
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.1
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.07
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.06
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.01
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.97
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 93.97
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 93.96
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 93.93
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 93.85
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.81
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 93.7
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.64
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.57
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 93.43
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 93.3
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.27
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.24
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.14
3fbg_A346 Putative arginate lyase; structural genomics, unkn 93.11
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 92.82
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 92.81
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 92.74
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 92.56
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 92.27
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 92.23
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 92.17
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 91.66
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 91.6
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 91.59
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 91.55
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 91.46
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 91.43
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 91.34
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 91.22
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.05
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 91.04
3p2o_A285 Bifunctional protein fold; structural genomics, ce 91.02
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.86
4g65_A 461 TRK system potassium uptake protein TRKA; structur 90.78
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 90.75
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 90.67
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 90.28
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 90.27
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 90.24
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.9
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 89.7
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 89.68
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 89.63
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 89.21
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 89.18
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 89.15
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 88.97
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 88.85
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 88.75
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 88.69
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 88.62
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 88.59
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 88.29
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 88.14
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 88.13
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 88.02
3l07_A285 Bifunctional protein fold; structural genomics, ID 87.93
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 87.69
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 87.42
2rir_A300 Dipicolinate synthase, A chain; structural genomic 87.37
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 87.3
3tl2_A315 Malate dehydrogenase; center for structural genomi 87.12
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 86.79
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 86.72
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 86.68
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 86.49
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 86.4
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 86.37
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 86.22
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 86.15
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 86.15
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 86.07
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 85.88
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 85.77
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 85.68
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 85.59
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 85.52
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 85.07
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 84.74
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 84.68
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 84.37
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 84.31
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 84.31
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 84.12
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 84.03
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 83.54
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 83.39
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 83.37
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 83.32
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 83.0
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 82.67
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 82.59
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 82.24
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 81.91
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 81.87
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 81.78
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 81.75
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 81.19
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 80.98
3qha_A296 Putative oxidoreductase; seattle structural genomi 80.89
3m70_A286 Tellurite resistance protein TEHB homolog; structu 80.63
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 80.36
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=1.2e-48  Score=368.35  Aligned_cols=233  Identities=19%  Similarity=0.181  Sum_probs=203.9

Q ss_pred             ccCCcEEEEecCCCcccHHHHHHHhhccCCCCc-eEEEEecccCCCCCcccHHHHHHHHhcCCCcccEEeccCCCChhhH
Q psy16161         54 RISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRV-VVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSK  132 (387)
Q Consensus        54 ~l~gk~vlVTGassGIG~aia~~~L~~a~~~~G-~Vil~~~R~~~~~~~~~~~~~~~~l~~~~~~v~~~~~Dlt~~~~sv  132 (387)
                      +|+||++|||||++|||+++|+. |  ++  .| +|+++ +|     +++.++++.+++++.+.++.++++|++ +++++
T Consensus         4 sL~gKvalVTGas~GIG~aiA~~-l--a~--~Ga~Vv~~-~~-----~~~~~~~~~~~i~~~g~~~~~~~~Dvt-~~~~v   71 (254)
T 4fn4_A            4 SLKNKVVIVTGAGSGIGRAIAKK-F--AL--NDSIVVAV-EL-----LEDRLNQIVQELRGMGKEVLGVKADVS-KKKDV   71 (254)
T ss_dssp             GGTTCEEEEETTTSHHHHHHHHH-H--HH--TTCEEEEE-ES-----CHHHHHHHHHHHHHTTCCEEEEECCTT-SHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHH-H--HH--cCCEEEEE-EC-----CHHHHHHHHHHHHhcCCcEEEEEccCC-CHHHH
Confidence            78999999999999999999999 9  99  99 99999 99     999999999999998889999999999 99999


Q ss_pred             HHHHHHHHHhhcCC----eeeCCCCCC----h----hHHHHHHHhhchHHHHHHHHHhhcccC--CCEEEEEcCCccccc
Q psy16161        133 HSTTSVILVGEHKK----TSVKGNAPF----G----QQAETTLATNFFALVTVCHMLFPLLRP--HARVVNVASQYGMLY  198 (387)
Q Consensus       133 ~~~~~~~~~~~~~~----VnnAg~~~~----~----~~~~~~~~vN~~g~~~l~~~~lp~l~~--~grIv~vSS~~~~~~  198 (387)
                      +++++ ++.+++++    |||||+...    .    ++|+++|++|+.|+|+++|+++|+|++  +|+|||+||.++.. 
T Consensus        72 ~~~~~-~~~~~~G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~-  149 (254)
T 4fn4_A           72 EEFVR-RTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIR-  149 (254)
T ss_dssp             HHHHH-HHHHHHSCCCEEEECCCCCCTTCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTC-
T ss_pred             HHHHH-HHHHHcCCCCEEEECCcccCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCcEEEEEechhhcC-
Confidence            99999 99999988    899996432    2    899999999999999999999999976  59999999999987 


Q ss_pred             cCCchhHHhhhccCCcchHHHhhhHHHHHHHhhhcCCCCCCCCC-CCchhhHHHHHHHHHHHHHHhCCCCCCCCcEEEEE
Q psy16161        199 KVPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPD-DPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAV  277 (387)
Q Consensus       199 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~p~-~~Y~aSK~al~~l~~~la~el~~~~~~~gI~Vn~v  277 (387)
                                                              +.|. .+|++||+|+.+|+|+||.||+    ++|||||+|
T Consensus       150 ----------------------------------------~~~~~~~Y~asKaal~~ltr~lA~ela----~~gIrVN~V  185 (254)
T 4fn4_A          150 ----------------------------------------GGFAGAPYTVAKHGLIGLTRSIAAHYG----DQGIRAVAV  185 (254)
T ss_dssp             ----------------------------------------SSSSCHHHHHHHHHHHHHHHHHHHHHG----GGTEEEEEE
T ss_pred             ----------------------------------------CCCCChHHHHHHHHHHHHHHHHHHHhh----hhCeEEEEE
Confidence                                                    3444 7899999999999999999999    899999999


Q ss_pred             eCCceecCCCCCcccchhhhhccccchhhhhhhhhcccccCCCCchhhhhhccCCccccccCCCCCCCChHHHHHHhhhh
Q psy16161        278 HPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKG  357 (387)
Q Consensus       278 ~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~peevA~~~~~l  357 (387)
                      +||+|+|||.....                            ...+........  ...|+   +|+++|||+|++++||
T Consensus       186 ~PG~i~T~~~~~~~----------------------------~~~~~~~~~~~~--~~~~~---~R~g~pediA~~v~fL  232 (254)
T 4fn4_A          186 LPGTVKTNIGLGSS----------------------------KPSELGMRTLTK--LMSLS---SRLAEPEDIANVIVFL  232 (254)
T ss_dssp             EECSBCSSCTTSCS----------------------------SCCHHHHHHHHH--HHTTC---CCCBCHHHHHHHHHHH
T ss_pred             EeCCCCCccccccc----------------------------CCcHHHHHHHHh--cCCCC---CCCcCHHHHHHHHHHH
Confidence            99999999976631                            011111110000  12355   7999999999999999


Q ss_pred             hccCCCCCCCCceEEeecCeee
Q psy16161        358 ALIPPDAKEPRGQFIWYDGSIV  379 (387)
Q Consensus       358 a~~~~~~~~~tG~~i~~dgg~~  379 (387)
                      +|  +.++|+||+.|.||||++
T Consensus       233 aS--d~a~~iTG~~i~VDGG~t  252 (254)
T 4fn4_A          233 AS--DEASFVNGDAVVVDGGLT  252 (254)
T ss_dssp             HS--GGGTTCCSCEEEESTTGG
T ss_pred             hC--chhcCCcCCEEEeCCCcc
Confidence            99  899999999999999975



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 387
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 1e-22
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-11
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 5e-07
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 7e-08
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 0.001
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 9e-05
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 0.001
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 0.001
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 0.001
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 0.001
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 0.001
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 0.002
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 0.002
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 0.002
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 0.004
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Carbonyl reductase/20beta-hydroxysteroid dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 94.5 bits (234), Expect = 1e-22
 Identities = 74/229 (32%), Positives = 108/229 (47%), Gaps = 54/229 (23%)

Query: 154 PFGQQAETTLATNFFALVTVCHMLFPLLRPHARVVNVASQYGML-YKVPSQELKQTLLND 212
           PF  QAE T+ TNFF    VC  L PL++P  RVVNV+S   +   K  S EL+Q   ++
Sbjct: 100 PFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSE 159

Query: 213 SLTEDQLVGMMHDYVKLAKEGKDQEAGWPDDPYTVSKVGVIKLSFIQHATLSKDQTRPDI 272
           ++TE++LVG+M+ +V+  K+G  Q+ GWP   Y V+K+GV                    
Sbjct: 160 TITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGV-------------------- 199

Query: 273 IVNAVHPGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPG 332
                                             LS I    LS+ +    I++NA  PG
Sbjct: 200 --------------------------------TVLSRIHARKLSEQRKGDKILLNACCPG 227

Query: 333 YVNTDLTGHKGILTTEQGSVSSVKGALIPPDAKEPRGQFIWYDGSIVDW 381
           +V TD+ G K   + E+G+ + V  AL+PPDA+ P GQF   +  +  W
Sbjct: 228 WVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQF-VSEKRVEQW 275


>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query387
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.98
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.93
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.69
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.59
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.55
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.52
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.51
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.48
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.48
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.47
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.47
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.43
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.39
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.37
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.36
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.36
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.35
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.33
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.32
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.31
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.31
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.28
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.26
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.26
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.22
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.15
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.84
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.83
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.82
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.76
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.65
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.59
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.46
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.15
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 96.69
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.54
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.48
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.46
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.38
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.28
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.21
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.03
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.0
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.95
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.53
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.39
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.33
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.98
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.85
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.73
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.63
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.56
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.53
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.49
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 94.48
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.46
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 94.33
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.13
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 94.04
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.01
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.65
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 93.63
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.54
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.53
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.45
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.27
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.19
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.68
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.18
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.73
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 91.67
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.63
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.58
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 91.4
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.15
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.0
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.87
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 90.71
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 90.48
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.32
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.19
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 89.99
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.59
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 89.55
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.22
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.17
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 88.99
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 88.8
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.47
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 88.46
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.03
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.54
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 87.03
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 86.9
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 86.51
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.47
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 86.23
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 85.99
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 85.65
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.4
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 85.38
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 85.34
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 85.08
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 84.48
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 83.91
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 83.88
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 83.64
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 83.47
d1kl7a_511 Threonine synthase {Baker's yeast (Saccharomyces c 83.31
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 82.15
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 82.1
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 82.05
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.92
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 81.22
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 80.83
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 80.62
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: beta-keto acyl carrier protein reductase
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]
Probab=100.00  E-value=1.3e-47  Score=359.04  Aligned_cols=230  Identities=20%  Similarity=0.214  Sum_probs=202.2

Q ss_pred             ccCCcEEEEecCCCcccHHHHHHHhhccCCCCc-eEEEEecccCCCCCcccHHHHHHHHhcCCCcccEEeccCCCChhhH
Q psy16161         54 RISQHRFLIEGVNAGYVWAPLMHRLQNGEHFRV-VVVFELERLVHNMPGGNGADARQQEKGEGKHCPCIPLTTGGSEDSK  132 (387)
Q Consensus        54 ~l~gk~vlVTGassGIG~aia~~~L~~a~~~~G-~Vil~~~R~~~~~~~~~~~~~~~~l~~~~~~v~~~~~Dlt~~~~sv  132 (387)
                      ++++|+||||||++|||+++|+. |  ++  .| +|+++ +|     +.+.++++.+++++.+.++.++++|++ +++++
T Consensus         7 ~lenKvalITGas~GIG~a~a~~-l--a~--~Ga~V~~~-~r-----~~~~l~~~~~~l~~~g~~~~~~~~Dvt-~~~~v   74 (251)
T d2c07a1           7 CGENKVALVTGAGRGIGREIAKM-L--AK--SVSHVICI-SR-----TQKSCDSVVDEIKSFGYESSGYAGDVS-KKEEI   74 (251)
T ss_dssp             CCSSCEEEEESTTSHHHHHHHHH-H--TT--TSSEEEEE-ES-----SHHHHHHHHHHHHTTTCCEEEEECCTT-CHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHH-H--HH--cCCEEEEE-EC-----CHHHHHHHHHHHHhcCCcEEEEEccCC-CHHHH
Confidence            68899999999999999999999 9  99  99 99999 99     999999999999988889999999999 99999


Q ss_pred             HHHHHHHHHhhcCC----eeeCCCCCCh-------hHHHHHHHhhchHHHHHHHHHhhcccC--CCEEEEEcCCcccccc
Q psy16161        133 HSTTSVILVGEHKK----TSVKGNAPFG-------QQAETTLATNFFALVTVCHMLFPLLRP--HARVVNVASQYGMLYK  199 (387)
Q Consensus       133 ~~~~~~~~~~~~~~----VnnAg~~~~~-------~~~~~~~~vN~~g~~~l~~~~lp~l~~--~grIv~vSS~~~~~~~  199 (387)
                      +++++ ++.+++++    |||||.....       ++|++++++|+.|+++++++++|.|++  +|+||++||.++..  
T Consensus        75 ~~~~~-~~~~~~g~iDilvnnag~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~--  151 (251)
T d2c07a1          75 SEVIN-KILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLT--  151 (251)
T ss_dssp             HHHHH-HHHHHCSCCCEEEECCCCCCCCCTTTCCHHHHHHHHHHHTTHHHHHHHHHHHHHHHHTCEEEEEECCTHHHH--
T ss_pred             HHHHH-HHHHhcCCceeeeeccccccccccccccHHHHhhhheeeehhhhhhhhhcCcccccCCCeEEEEECCHHhcC--
Confidence            99999 99999988    8999965443       899999999999999999999999976  59999999999987  


Q ss_pred             CCchhHHhhhccCCcchHHHhhhHHHHHHHhhhcCCCCCCCCC-CCchhhHHHHHHHHHHHHHHhCCCCCCCCcEEEEEe
Q psy16161        200 VPSQELKQTLLNDSLTEDQLVGMMHDYVKLAKEGKDQEAGWPD-DPYTVSKVGVIKLSFIQHATLSKDQTRPDIIVNAVH  278 (387)
Q Consensus       200 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~p~-~~Y~aSK~al~~l~~~la~el~~~~~~~gI~Vn~v~  278 (387)
                                                             +.|. .+|++||+|+++|+|+||.|++    +.|||||+|+
T Consensus       152 ---------------------------------------~~~~~~~Y~asKaal~~ltr~lA~el~----~~gIrVN~V~  188 (251)
T d2c07a1         152 ---------------------------------------GNVGQANYSSSKAGVIGFTKSLAKELA----SRNITVNAIA  188 (251)
T ss_dssp             ---------------------------------------CCTTCHHHHHHHHHHHHHHHHHHHHHG----GGTEEEEEEE
T ss_pred             ---------------------------------------CCCCCHHHHHHHHHHHHHHHHHHHHhh----hhCeEEEEEc
Confidence                                                   3444 8999999999999999999999    8999999999


Q ss_pred             CCceecCCCCCcccchhhhhccccchhhhhhhhhcccccCCCCchhhhhhccCCccccccCCCCCCCChHHHHHHhhhhh
Q psy16161        279 PGYVNTDLTGHKGILTMTIHTLKVGVIKLSFIQHATLSKDQTRPDIIVNAVHPGYVNTDLTGHKGILTTEQGSVSSVKGA  358 (387)
Q Consensus       279 PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~peevA~~~~~la  358 (387)
                      ||+|+|+|.....                               +...+.+..   .+|+   +|+.+|||+|++++||+
T Consensus       189 PG~v~T~~~~~~~-------------------------------~~~~~~~~~---~~pl---~R~~~pedvA~~v~fL~  231 (251)
T d2c07a1         189 PGFISSDMTDKIS-------------------------------EQIKKNIIS---NIPA---GRMGTPEEVANLACFLS  231 (251)
T ss_dssp             ECSBCC-----CC-------------------------------HHHHHHHHT---TCTT---SSCBCHHHHHHHHHHHH
T ss_pred             cCCEecccccccC-------------------------------HHHHHHHHh---cCCC---CCCcCHHHHHHHHHHHh
Confidence            9999999987631                               112222212   5788   89999999999999999


Q ss_pred             ccCCCCCCCCceEEeecCeeec
Q psy16161        359 LIPPDAKEPRGQFIWYDGSIVD  380 (387)
Q Consensus       359 ~~~~~~~~~tG~~i~~dgg~~~  380 (387)
                      +  +.++|+||+.|.+|||++|
T Consensus       232 S--~~s~~itG~~i~vDGG~sp  251 (251)
T d2c07a1         232 S--DKSGYINGRVFVIDGGLSP  251 (251)
T ss_dssp             S--GGGTTCCSCEEEESTTSCC
T ss_pred             C--chhCCCcCcEEEECCCcCc
Confidence            9  8999999999999999875



>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure