Psyllid ID: psy1653


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MGANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAALAAAAVDH
ccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHccccccccccccccccccccccccccccccc
mganglrrrgrqtyTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAALAAAAVDH
mganglrrrgrqtytryqtlelekefhtnhyltrrRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAALAAAAVDH
MGANglrrrgrqtytryqtlELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNeqekqaqaqkaaaaalaaaaVDH
****************YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLK*********************************
*************YTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRR*************************************
*********GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELN***********************
***********QTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE*******************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVDH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q8T940253 Homeotic protein ultrabit N/A N/A 0.968 0.367 0.978 1e-46
P83950389 Homeotic protein ultrabit N/A N/A 0.760 0.187 0.972 2e-37
P83949389 Homeotic protein ultrabit no N/A 0.760 0.187 0.972 2e-37
P20822385 Homeotic protein ultrabit yes N/A 0.760 0.189 0.972 1e-35
P29552 239 Homeobox protein abdomina N/A N/A 0.770 0.309 0.866 1e-32
Q05007139 Homeobox protein abdomina N/A N/A 0.760 0.525 0.878 2e-32
B0W1V2216 Homeobox protein abdomina N/A N/A 0.760 0.337 0.864 6e-32
P29555 590 Homeobox protein abdomina no N/A 0.906 0.147 0.75 6e-32
P29556157 Homeobox protein abdomina N/A N/A 0.760 0.464 0.864 2e-31
Q2643097 Homeobox protein abdomina N/A N/A 0.760 0.752 0.864 4e-31
>sp|Q8T940|UBX_JUNCO Homeotic protein ultrabithorax OS=Junonia coenia GN=Ubx PE=2 SV=1 Back     alignment and function desciption
 Score =  184 bits (468), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/93 (97%), Positives = 91/93 (97%)

Query: 2   GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 61
           GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK
Sbjct: 154 GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 213

Query: 62  LKKEIQAIKELNEQEKQAQAQKAAAAALAAAAV 94
           LKKEIQAIKELNEQEKQAQAQKAAAAA AAAA 
Sbjct: 214 LKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAA 246




Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds the consensus region 5'-TTAAT[GT][GA]-3'. This homeotic protein controls development of the cells in the posterior thoracic and first abdominal segments.
Junonia coenia (taxid: 39708)
>sp|P83950|UBX_DROSI Homeotic protein ultrabithorax OS=Drosophila simulans GN=Ubx PE=3 SV=1 Back     alignment and function description
>sp|P83949|UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster GN=Ubx PE=1 SV=1 Back     alignment and function description
>sp|P20822|UBX_DROPS Homeotic protein ultrabithorax OS=Drosophila pseudoobscura pseudoobscura GN=Ubx PE=2 SV=3 Back     alignment and function description
>sp|P29552|ABDA_AEDAE Homeobox protein abdominal-A homolog OS=Aedes aegypti GN=abd-A PE=3 SV=2 Back     alignment and function description
>sp|Q05007|ABDA_ARTSF Homeobox protein abdominal-A homolog (Fragment) OS=Artemia franciscana GN=ABDA PE=3 SV=1 Back     alignment and function description
>sp|B0W1V2|ABDA_CULQU Homeobox protein abdominal-A homolog OS=Culex quinquefasciatus GN=abd-A PE=3 SV=1 Back     alignment and function description
>sp|P29555|ABDA_DROME Homeobox protein abdominal-A OS=Drosophila melanogaster GN=abd-A PE=2 SV=2 Back     alignment and function description
>sp|P29556|ABDA_SCHGR Homeobox protein abdominal-A homolog (Fragment) OS=Schistocerca gregaria GN=ABD-A PE=3 SV=1 Back     alignment and function description
>sp|Q26430|ABDA_MANSE Homeobox protein abdominal-A homolog (Fragment) OS=Manduca sexta GN=ABD-A PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
164682494 254 homeobox protein [Bombyx mori] 0.968 0.366 0.989 1e-45
166429526 254 ultrabithorax [Bombyx mori] gi|164682496 0.968 0.366 0.978 4e-45
426432569 254 ultrabithorax [Biston betularia] 0.968 0.366 0.978 4e-45
47115878 253 RecName: Full=Homeotic protein ultrabith 0.968 0.367 0.978 5e-45
195349282 201 GM15411 [Drosophila sechellia] gi|194122 0.947 0.452 0.989 2e-44
392301341105 ultrabithorax, partial [Notonecta undula 0.937 0.857 1.0 2e-43
45553381 355 ultrabithorax, isoform F [Drosophila mel 0.947 0.256 0.989 2e-43
390178469 360 Ubx, isoform B [Drosophila pseudoobscura 0.947 0.252 0.989 3e-43
87042406 267 ultrabithorax [Strigamia maritima] 0.885 0.318 0.964 5e-42
391339782178 PREDICTED: homeotic protein ultrabithora 0.968 0.522 0.881 2e-41
>gi|164682494|gb|ABY66344.1| homeobox protein [Bombyx mori] Back     alignment and taxonomy information
 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/93 (98%), Positives = 92/93 (98%)

Query: 2   GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 61
           GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK
Sbjct: 155 GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 214

Query: 62  LKKEIQAIKELNEQEKQAQAQKAAAAALAAAAV 94
           LKKEIQAIKELNEQEKQAQAQKAAAAA AAAAV
Sbjct: 215 LKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAV 247




Source: Bombyx mori

Species: Bombyx mori

Genus: Bombyx

Family: Bombycidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|166429526|ref|NP_001107632.1| ultrabithorax [Bombyx mori] gi|164682496|gb|ABY66345.1| homeobox protein [Bombyx mori] gi|284924982|dbj|BAI67747.1| Ultrabithorax [Bombyx mori] Back     alignment and taxonomy information
>gi|426432569|gb|ADO33070.2| ultrabithorax [Biston betularia] Back     alignment and taxonomy information
>gi|47115878|sp|Q8T940.1|UBX_JUNCO RecName: Full=Homeotic protein ultrabithorax; AltName: Full=JcUbx gi|18535620|gb|AAL71873.1| ultrabithorax [Junonia coenia] Back     alignment and taxonomy information
>gi|195349282|ref|XP_002041174.1| GM15411 [Drosophila sechellia] gi|194122779|gb|EDW44822.1| GM15411 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|392301341|gb|AFM55056.1| ultrabithorax, partial [Notonecta undulata] Back     alignment and taxonomy information
>gi|45553381|ref|NP_996219.1| ultrabithorax, isoform F [Drosophila melanogaster] gi|45446510|gb|AAS65158.1| ultrabithorax, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|390178469|ref|XP_003736653.1| Ubx, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859455|gb|EIM52726.1| Ubx, isoform B [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|87042406|gb|ABD16212.1| ultrabithorax [Strigamia maritima] Back     alignment and taxonomy information
>gi|391339782|ref|XP_003744226.1| PREDICTED: homeotic protein ultrabithorax-like [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
UNIPROTKB|Q8T940253 Ubx "Homeotic protein ultrabit 0.75 0.284 0.777 1.6e-24
FB|FBgn0003944389 Ubx "Ultrabithorax" [Drosophil 0.760 0.187 0.753 2.6e-24
UNIPROTKB|P20822385 Ubx "Homeotic protein ultrabit 0.760 0.189 0.753 2.6e-24
UNIPROTKB|P83950389 Ubx "Homeotic protein ultrabit 0.760 0.187 0.753 2.6e-24
UNIPROTKB|Q6VPU7387 Ubx "Ultrabithorax" [Drosophil 0.760 0.188 0.753 2.6e-24
UNIPROTKB|B0W1V2216 abd-A "Homeobox protein abdomi 0.552 0.245 0.886 4.3e-22
UNIPROTKB|O76762308 abd-A "Homeobox protein abdomi 0.552 0.172 0.886 4.3e-22
UNIPROTKB|P29552 239 abd-A "Homeobox protein abdomi 0.552 0.221 0.886 4.3e-22
FB|FBgn0000014 590 abd-A "abdominal A" [Drosophil 0.552 0.089 0.886 3.1e-21
ZFIN|ZDB-GENE-000823-7224 hoxb6b "homeo box B6b" [Danio 0.510 0.218 0.836 7.5e-18
UNIPROTKB|Q8T940 Ubx "Homeotic protein ultrabithorax" [Junonia coenia (taxid:39708)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
 Identities = 56/72 (77%), Positives = 56/72 (77%)

Query:     2 GANXXXXXXXXXXXXXXXXELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 61
             GAN                ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK
Sbjct:   154 GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMK 213

Query:    62 LKKEIQAIKELN 73
             LKKEIQAIKELN
Sbjct:   214 LKKEIQAIKELN 225




GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
FB|FBgn0003944 Ubx "Ultrabithorax" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P20822 Ubx "Homeotic protein ultrabithorax" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|P83950 Ubx "Homeotic protein ultrabithorax" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VPU7 Ubx "Ultrabithorax" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B0W1V2 abd-A "Homeobox protein abdominal-A homolog" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|O76762 abd-A "Homeobox protein abdominal-A homolog" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|P29552 abd-A "Homeobox protein abdominal-A homolog" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
FB|FBgn0000014 abd-A "abdominal A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000823-7 hoxb6b "homeo box B6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P20822UBX_DROPSNo assigned EC number0.97260.76040.1896yesN/A
P15856ABDA_APIMENo assigned EC number0.86300.750.9729noN/A
P14839HXB6_CHICKNo assigned EC number0.71250.81250.9285noN/A
Q24645ANTP_DROSUNo assigned EC number0.91520.61450.1497N/AN/A
A2T7F3HXA7_PANTRNo assigned EC number0.91520.61450.2565noN/A
P02830HXA7_MOUSENo assigned EC number0.67810.85410.3580yesN/A
P02833ANTP_DROMENo assigned EC number0.91520.61450.1560noN/A
P83950UBX_DROSINo assigned EC number0.97260.76040.1876N/AN/A
Q8T940UBX_JUNCONo assigned EC number0.97840.96870.3675N/AN/A
P21523HLOX2_HIRMENo assigned EC number0.84500.73950.6016N/AN/A
P09634HXA7_RATNo assigned EC number0.61290.89580.8190noN/A
P24061HXA7_COTJANo assigned EC number0.91520.61450.2438N/AN/A
A1YFA5HXB7_GORGONo assigned EC number0.91520.61450.2718N/AN/A
Q26430ABDA_MANSENo assigned EC number0.86480.76040.7525N/AN/A
Q9TT89HXB7_BOVINNo assigned EC number0.91520.61450.2718yesN/A
Q9YGT4HXB6B_DANRENo assigned EC number0.69510.81250.3482yesN/A
Q90VZ9HXA7_CHICKNo assigned EC number0.91520.61450.2694noN/A
P31268HXA7_HUMANNo assigned EC number0.91520.61450.2565noN/A
P17509HXB6_HUMANNo assigned EC number0.86150.65620.2812yesN/A
P83949UBX_DROMENo assigned EC number0.97260.76040.1876noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-22
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-18
smart0038957 smart00389, HOX, Homeodomain 4e-18
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 6e-09
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 80.6 bits (200), Expect = 5e-22
 Identities = 32/57 (56%), Positives = 38/57 (66%)

Query: 8  RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 64
          RR R T+T  Q  ELEKEF  N Y +   R E+A  L LTERQ+K+WFQNRR K K+
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG0489|consensus261 99.78
KOG0488|consensus309 99.77
KOG0850|consensus245 99.76
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.75
KOG0843|consensus197 99.75
KOG0484|consensus125 99.74
KOG0487|consensus308 99.73
KOG2251|consensus 228 99.73
KOG0485|consensus268 99.71
KOG0842|consensus307 99.7
KOG3802|consensus398 99.7
KOG0492|consensus246 99.68
KOG0848|consensus317 99.65
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.64
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.63
KOG0494|consensus 332 99.63
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.62
COG5576156 Homeodomain-containing transcription factor [Trans 99.62
KOG0493|consensus342 99.58
KOG0491|consensus194 99.57
KOG4577|consensus 383 99.53
KOG0483|consensus198 99.49
KOG0844|consensus 408 99.48
KOG0847|consensus288 99.44
KOG0486|consensus 351 99.43
KOG1168|consensus385 99.3
KOG0490|consensus235 99.26
KOG0849|consensus354 99.12
KOG0775|consensus304 99.07
KOG0774|consensus334 98.89
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.68
KOG2252|consensus558 98.53
KOG0490|consensus235 98.26
KOG1146|consensus 1406 97.55
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.46
KOG0773|consensus342 96.51
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 96.32
KOG3623|consensus 1007 96.01
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 88.2
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 87.9
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 87.49
PF0960758 BrkDBD: Brinker DNA-binding domain; InterPro: IPR0 87.37
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 84.19
PF1066860 Phage_terminase: Phage terminase small subunit; In 83.75
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 82.15
>KOG0489|consensus Back     alignment and domain information
Probab=99.78  E-value=1.7e-19  Score=125.36  Aligned_cols=68  Identities=71%  Similarity=1.022  Sum_probs=62.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCcchhhhhhchhhhhhHHHHHHHH
Q psy1653           3 ANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIK   70 (96)
Q Consensus         3 ~~~~~rr~r~~~s~~q~~~L~~~F~~~~~p~~~~~~~la~~l~l~~~~V~~WFqnrR~k~kr~~~~~~   70 (96)
                      ..+..||.|+.||..|+..||..|..|.|.+...|.+||..|.|+++||+|||||||+||||+.+...
T Consensus       155 ~~~~~kR~RtayT~~QllELEkEFhfN~YLtR~RRiEiA~~L~LtErQIKIWFQNRRMK~Kk~~k~~~  222 (261)
T KOG0489|consen  155 TGGKSKRRRTAFTRYQLLELEKEFHFNKYLTRSRRIEIAHALNLTERQIKIWFQNRRMKWKKENKAKS  222 (261)
T ss_pred             ccCCCCCCCcccchhhhhhhhhhhccccccchHHHHHHHhhcchhHHHHHHHHHHHHHHHHHhhcccc
Confidence            34567999999999999999999999999999999999999999999999999999999999765443



>KOG0488|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF09607 BrkDBD: Brinker DNA-binding domain; InterPro: IPR018586 This DNA-binding domain is the first approx Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 3e-21
1hom_A68 Determination Of The Three-Dimensional Structure Of 2e-17
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 8e-17
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 1e-16
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 1e-16
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 2e-16
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 6e-15
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 5e-12
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 7e-12
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-11
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 3e-11
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 3e-09
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-08
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-08
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 2e-08
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 2e-08
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-08
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-08
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 5e-08
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 5e-08
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 6e-08
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 7e-08
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 8e-08
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 2e-07
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 2e-07
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 2e-07
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-07
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 4e-07
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 8e-07
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 9e-07
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 2e-06
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 4e-06
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 5e-06
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-05
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-05
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-05
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 4e-05
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 1e-04
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 2e-04
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-04
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 3e-04
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 5e-04
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 6e-04
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 7e-04
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure

Iteration: 1

Score = 96.7 bits (239), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 47/48 (97%), Positives = 47/48 (97%) Query: 21 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQA 68 ELEKEFHTNHYLTRRRRIEMAHAL LTERQIKIWFQNRRMKLKKEIQA Sbjct: 34 ELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEIQA 81
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-37
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-36
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-36
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 2e-34
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 9e-33
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-32
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 9e-32
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 9e-32
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 5e-31
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-30
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-30
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-30
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-30
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-28
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-25
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-23
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-23
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-23
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-23
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-22
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-22
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-21
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 3e-21
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-20
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 9e-20
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-16
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-16
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 6e-16
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-15
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 7e-14
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 6e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-12
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-12
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-11
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-11
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-11
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-11
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-11
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 4e-11
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-11
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 5e-11
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-10
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 8e-10
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-09
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 5e-08
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-06
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 2e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 2e-05
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-05
1lfb_A99 Liver transcription factor (LFB1); transcription r 8e-04
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
 Score =  120 bits (303), Expect = 1e-37
 Identities = 65/68 (95%), Positives = 65/68 (95%)

Query: 1  MGANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRM 60
           G NGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHAL LTERQIKIWFQNRRM
Sbjct: 14 AGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRM 73

Query: 61 KLKKEIQA 68
          KLKKEIQA
Sbjct: 74 KLKKEIQA 81


>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.86
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.85
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.85
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.85
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.85
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.85
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.85
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.85
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.85
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.84
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.84
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.84
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.84
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.84
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.84
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.84
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.84
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.84
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.84
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.83
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.83
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.83
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.83
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.83
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.83
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.82
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.82
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.82
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.82
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.82
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.82
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.82
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.81
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.81
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.81
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.81
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.8
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.8
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.8
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.8
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.8
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.8
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.8
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.79
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.79
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.79
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.79
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.79
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.79
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.79
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.78
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.78
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.78
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.77
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.77
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.76
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.76
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.75
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.75
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.75
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.75
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.75
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.74
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.73
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.73
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.73
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.72
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.72
2e19_A64 Transcription factor 8; homeobox domain, structura 99.71
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.7
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.65
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.57
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.54
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.51
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.5
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.39
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.72
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 97.24
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 90.46
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 88.15
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 87.85
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 83.8
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 81.54
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 80.96
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.86  E-value=1.3e-21  Score=113.44  Aligned_cols=67  Identities=34%  Similarity=0.556  Sum_probs=62.1

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCcchhhhhhchhhhhhHHHHHH
Q psy1653           2 GANGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQA   68 (96)
Q Consensus         2 ~~~~~~rr~r~~~s~~q~~~L~~~F~~~~~p~~~~~~~la~~l~l~~~~V~~WFqnrR~k~kr~~~~   68 (96)
                      ++++..++.|+.|+..|+..|+..|..++||+..++..||..|||++.+|++||+|||+++|+....
T Consensus         2 s~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~   68 (80)
T 2cue_A            2 SSGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKL   68 (80)
T ss_dssp             CSCCSSCCCCCCSCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCccCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhh
Confidence            4566788899999999999999999999999999999999999999999999999999999996543



>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-20
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-19
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-18
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-18
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 8e-18
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-17
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-16
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-16
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 9e-16
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-15
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-15
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 4e-15
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-14
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 7e-14
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 7e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 8e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-12
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 4e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-11
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-11
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 4e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-09
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 4e-07
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
 Score = 74.4 bits (183), Expect = 3e-20
 Identities = 50/55 (90%), Positives = 51/55 (92%)

Query: 11 RQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 65
          RQTYTRYQTLELEKEFH N YLTRRRRIE+AHAL LTERQIKIWFQNRRMK KKE
Sbjct: 1  RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKE 55


>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.88
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.88
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.87
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.87
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.87
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.87
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.87
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.87
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.86
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.86
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.85
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.85
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.84
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.84
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.84
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.83
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.83
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.83
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.83
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.81
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.81
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.81
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.78
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.77
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.75
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.74
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.71
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.71
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.68
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.67
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.65
d1hlva166 DNA-binding domain of centromere binding protein B 94.64
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 89.8
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 83.31
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 81.07
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 80.54
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=2.3e-23  Score=112.91  Aligned_cols=57  Identities=47%  Similarity=0.797  Sum_probs=54.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCcchhhhhhchhhhhhHH
Q psy1653           8 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK   64 (96)
Q Consensus         8 rr~r~~~s~~q~~~L~~~F~~~~~p~~~~~~~la~~l~l~~~~V~~WFqnrR~k~kr   64 (96)
                      ++.|+.||..|+.+|+..|..++||+..++..||..|||++.+|++||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            567899999999999999999999999999999999999999999999999999875



>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure