Psyllid ID: psy16588


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL
ccccHHHHHHHcccccccccHHHHccHHHHHHcccccccccccccccccccccccccccccHHHHHcHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc
ccccEEEEEEEcccccHccHHHHHHcHccEcccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccc
mrsltsqlsvddleaeeegiadsvldtntiataarpgtslktaavtapaltsrprtesgrpvsgvvrpgtlasrggtleqslktprtaksarpltSQAARTIRLGTasmlsqpdgpfiqVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGvnhfyndqPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSidsshglsqnNLAVLEAREGHIERASTYLQAAaasspylyetHYNQAVISNLAGDLQESYNIVKKsldlhpghsysWDILRKLEQYFSYL
mrsltsqlsvddlEAEEEgiadsvldtntiataarpgtslktaavtapaltsrprtesgrpvsgvvrpgtlasrggtleqslktprtaksarpltsqAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLdlhpghsyswdILRKLEQYFSYL
MRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL
******************************************************************************************************************GPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFS**
*RSLTSQLSVDDLEAEEEGIADSVLDTNTIA*************************ESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL
************LEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAP**************SGVVRPGTLASR*********************SQAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL
*RSLTSQLSVDDLEAEEEGIADSVLDTNTIATA*************************GRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFS*L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
Q8TAM2541 Tetratricopeptide repeat yes N/A 0.636 0.401 0.577 5e-71
Q8VD72515 Tetratricopeptide repeat yes N/A 0.636 0.421 0.568 1e-69
Q8RVB2 931 Probable UDP-N-acetylgluc N/A N/A 0.428 0.156 0.236 2e-06
P56558 1036 UDP-N-acetylglucosamine-- no N/A 0.598 0.196 0.240 3e-06
Q8CGY8 1046 UDP-N-acetylglucosamine-- no N/A 0.598 0.195 0.240 3e-06
P81436 1046 UDP-N-acetylglucosamine-- no N/A 0.598 0.195 0.240 3e-06
Q27HV0 1046 UDP-N-acetylglucosamine-- no N/A 0.598 0.195 0.240 3e-06
O15294 1046 UDP-N-acetylglucosamine-- no N/A 0.598 0.195 0.240 3e-06
Q96301 914 Probable UDP-N-acetylgluc yes N/A 0.428 0.159 0.229 3e-06
O82039 932 Probable UDP-N-acetylgluc N/A N/A 0.428 0.156 0.222 3e-06
>sp|Q8TAM2|TTC8_HUMAN Tetratricopeptide repeat protein 8 OS=Homo sapiens GN=TTC8 PE=1 SV=2 Back     alignment and function desciption
 Score =  268 bits (684), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 126/218 (57%), Positives = 165/218 (75%), Gaps = 1/218 (0%)

Query: 125 LAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGL 184
           +A+I+E +NNM  + +YYK +LK+D T +EAIACIG NHFY+DQPE+AL FYRRLLQMG+
Sbjct: 324 IARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGI 383

Query: 185 YNAELFNNLALCCFYSQQYDMVVTCFERALSLALN-ENAADVWYNISHVAIGISDTRLAI 243
           YN +LFNNL LCCFY+QQYDM +T FERALSLA N E AADVWYN+ HVA+GI DT LA 
Sbjct: 384 YNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAH 443

Query: 244 QCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNL 303
           QC  LAL  +++H  + NNLAVLE R+GH+E+A   LQ A++ +P++YE H+N A IS+ 
Sbjct: 444 QCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDK 503

Query: 304 AGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL 341
            GDLQ SY   +KS    P H  +  ++++L Q+F+ L
Sbjct: 504 IGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML 541




The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.
Homo sapiens (taxid: 9606)
>sp|Q8VD72|TTC8_MOUSE Tetratricopeptide repeat protein 8 OS=Mus musculus GN=Ttc8 PE=2 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 Back     alignment and function description
>sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 Back     alignment and function description
>sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
432937169 475 PREDICTED: tetratricopeptide repeat prot 0.985 0.707 0.400 3e-75
328699792 503 PREDICTED: tetratricopeptide repeat prot 0.633 0.429 0.625 3e-75
348531224 475 PREDICTED: tetratricopeptide repeat prot 0.997 0.715 0.390 7e-75
307197616 496 Tetratricopeptide repeat protein 8 [Harp 0.636 0.437 0.603 3e-74
383855556 496 PREDICTED: tetratricopeptide repeat prot 0.636 0.437 0.580 1e-71
350417804 496 PREDICTED: tetratricopeptide repeat prot 0.630 0.433 0.576 2e-71
340729289 764 PREDICTED: tetratricopeptide repeat prot 0.636 0.284 0.571 4e-71
66548094 496 PREDICTED: tetratricopeptide repeat prot 0.636 0.437 0.571 9e-71
307177659336 Tetratricopeptide repeat protein 8 [Camp 0.636 0.645 0.580 5e-70
197097962 505 tetratricopeptide repeat protein 8 [Pong 0.636 0.429 0.582 1e-69
>gi|432937169|ref|XP_004082370.1| PREDICTED: tetratricopeptide repeat protein 8-like isoform 2 [Oryzias latipes] Back     alignment and taxonomy information
 Score =  288 bits (737), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 235/432 (54%), Gaps = 96/432 (22%)

Query: 3   SLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVT-----APALTS----- 52
           SLT  + +D++E ++EGIA+ +LD N+IA  ARPGTSL+    +      PA+       
Sbjct: 47  SLTEMVYIDEIEVDQEGIAEMMLDENSIAQVARPGTSLRLPGTSQGGGPTPAVRPMTQSG 106

Query: 53  -------RPRTESGRP-----------VSGVVRPGTLAS----RGGT--LEQSLKTPRTA 88
                  RP T+SGRP            +   RP T +S    R GT   E         
Sbjct: 107 RPITGFVRPSTQSGRPGTMEQAIKTPRTASTARPVTSSSGRFVRLGTTLFEYIFHHENDV 166

Query: 89  KSARPLTSQAAR---------TIRLGT-------------------------------AS 108
           K+A  L +QA            ++LG                                A 
Sbjct: 167 KNALDLAAQATEHAQFKDWWWKVQLGKCYYRLGLYREAEKQFRSALNQQEVVDTYLYLAK 226

Query: 109 MLSQPDGPFIQVSRLNL------------------AKIFEGLNNMPMSVKYYKLILKRDA 150
           +  + D P   V+ LNL                  A+I E LNN+  + +YYK +LK+D 
Sbjct: 227 VYQRMDQP---VTALNLFKQGLDHFPGEVTLLTGVARIHEELNNISSATEYYKDVLKQDN 283

Query: 151 TCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCF 210
           T +EAIACIG NHFY DQPE+AL FYRRLLQMG+YN +L+NNL LCCFY+QQYDM ++ F
Sbjct: 284 THVEAIACIGSNHFYTDQPEIALRFYRRLLQMGVYNCQLYNNLGLCCFYAQQYDMALSSF 343

Query: 211 ERALSLAL-NENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAR 269
           ERAL L   +E  A+VWYNI HVA+GI D  LA QC  LAL++++ H  + NNLAVLE R
Sbjct: 344 ERALGLVCSDEEQAEVWYNIGHVAVGIGDLTLAYQCFKLALALNNDHAEAYNNLAVLELR 403

Query: 270 EGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWD 329
           +GHIE+A  +LQ AA+ +P++YE H+N +++S   GDLQ SY   +KS D  P H  +  
Sbjct: 404 KGHIEQAKAFLQTAASLAPHMYEPHFNFSILSEKIGDLQSSYTAAQKSEDAFPEHVDTQK 463

Query: 330 ILRKLEQYFSYL 341
           +L++L Q+F+ L
Sbjct: 464 LLKQLRQHFAVL 475




Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|328699792|ref|XP_001944378.2| PREDICTED: tetratricopeptide repeat protein 8-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|348531224|ref|XP_003453110.1| PREDICTED: tetratricopeptide repeat protein 8-like isoform 2 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|307197616|gb|EFN78804.1| Tetratricopeptide repeat protein 8 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383855556|ref|XP_003703276.1| PREDICTED: tetratricopeptide repeat protein 8-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417804|ref|XP_003491603.1| PREDICTED: tetratricopeptide repeat protein 8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729289|ref|XP_003402937.1| PREDICTED: tetratricopeptide repeat protein 8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66548094|ref|XP_397338.2| PREDICTED: tetratricopeptide repeat protein 8-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307177659|gb|EFN66705.1| Tetratricopeptide repeat protein 8 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|197097962|ref|NP_001125804.1| tetratricopeptide repeat protein 8 [Pongo abelii] gi|55729257|emb|CAH91364.1| hypothetical protein [Pongo abelii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
UNIPROTKB|Q8TAM2541 TTC8 "Tetratricopeptide repeat 0.636 0.401 0.577 2.8e-101
RGD|1307769515 Ttc8 "tetratricopeptide repeat 0.636 0.421 0.573 3.2e-100
UNIPROTKB|E2REN6540 TTC8 "Uncharacterized protein" 0.636 0.401 0.564 4.1e-100
UNIPROTKB|B3KSL8276 TTC8 "Tetratricopeptide repeat 0.636 0.786 0.577 1.2e-65
UNIPROTKB|F1N4X0506 TTC8 "Uncharacterized protein" 0.636 0.428 0.577 3.2e-65
ZFIN|ZDB-GENE-030131-8846507 ttc8 "tetratricopeptide repeat 0.636 0.428 0.564 4.1e-65
MGI|MGI:1923510515 Ttc8 "tetratricopeptide repeat 0.636 0.421 0.568 1.8e-64
UNIPROTKB|F1SDY6506 TTC8 "Uncharacterized protein" 0.636 0.428 0.566 7.6e-64
UNIPROTKB|E1C4G5515 TTC8 "Uncharacterized protein" 0.636 0.421 0.532 1.9e-60
FB|FBgn0031255549 BBS8 "BBS8" [Drosophila melano 0.530 0.329 0.406 3.6e-44
UNIPROTKB|Q8TAM2 TTC8 "Tetratricopeptide repeat protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 668 (240.2 bits), Expect = 2.8e-101, Sum P(2) = 2.8e-101
 Identities = 126/218 (57%), Positives = 165/218 (75%)

Query:   125 LAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGL 184
             +A+I+E +NNM  + +YYK +LK+D T +EAIACIG NHFY+DQPE+AL FYRRLLQMG+
Sbjct:   324 IARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGI 383

Query:   185 YNAELFNNLALCCFYSQQYDMVVTCFERALSLALNEN-AADVWYNISHVAIGISDTRLAI 243
             YN +LFNNL LCCFY+QQYDM +T FERALSLA NE  AADVWYN+ HVA+GI DT LA 
Sbjct:   384 YNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAH 443

Query:   244 QCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNL 303
             QC  LAL  +++H  + NNLAVLE R+GH+E+A   LQ A++ +P++YE H+N A IS+ 
Sbjct:   444 QCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDK 503

Query:   304 AGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQYFSYL 341
              GDLQ SY   +KS    P H  +  ++++L Q+F+ L
Sbjct:   504 IGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML 541


GO:0032391 "photoreceptor connecting cilium" evidence=IEA
GO:0045444 "fat cell differentiation" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0060170 "cilium membrane" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0034464 "BBSome" evidence=IDA
GO:0005813 "centrosome" evidence=IDA
GO:0005932 "microtubule basal body" evidence=IDA
GO:0042384 "cilium assembly" evidence=TAS
GO:0005929 "cilium" evidence=IDA
GO:0048560 "establishment of anatomical structure orientation" evidence=IMP
GO:0050893 "sensory processing" evidence=TAS
RGD|1307769 Ttc8 "tetratricopeptide repeat domain 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2REN6 TTC8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B3KSL8 TTC8 "Tetratricopeptide repeat domain 8, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4X0 TTC8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8846 ttc8 "tetratricopeptide repeat domain 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1923510 Ttc8 "tetratricopeptide repeat domain 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDY6 TTC8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4G5 TTC8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0031255 BBS8 "BBS8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VD72TTC8_MOUSENo assigned EC number0.56880.63630.4213yesN/A
Q8TAM2TTC8_HUMANNo assigned EC number0.57790.63630.4011yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-07
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 7e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-05
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 8e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 0.003
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 55.1 bits (133), Expect = 8e-10
 Identities = 24/101 (23%), Positives = 42/101 (41%), Gaps = 2/101 (1%)

Query: 188 ELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLH 247
           E   NL    +    YD  +  +E+AL L  + + AD +YN++     +     A++   
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALEL--DPDNADAYYNLAAAYYKLGKYEEALEDYE 58

Query: 248 LALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSP 288
            AL +D  +  +  NL +   + G  E A    + A    P
Sbjct: 59  KALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDP 99


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
KOG1129|consensus478 100.0
KOG4626|consensus 966 100.0
KOG4626|consensus 966 100.0
KOG1126|consensus638 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.95
KOG1126|consensus638 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.94
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.93
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.93
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.93
KOG1155|consensus559 99.93
KOG1125|consensus579 99.92
KOG1173|consensus611 99.92
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.92
PRK11189296 lipoprotein NlpI; Provisional 99.92
PRK12370553 invasion protein regulator; Provisional 99.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.92
KOG1155|consensus559 99.91
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
KOG0547|consensus606 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
PRK12370553 invasion protein regulator; Provisional 99.9
KOG0547|consensus606 99.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.89
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.88
PLN02789320 farnesyltranstransferase 99.87
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
KOG1125|consensus579 99.86
KOG1129|consensus478 99.85
KOG2076|consensus 895 99.85
KOG2003|consensus 840 99.85
KOG1173|consensus 611 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
KOG0624|consensus 504 99.83
PRK11189296 lipoprotein NlpI; Provisional 99.83
KOG2002|consensus 1018 99.83
PLN02789320 farnesyltranstransferase 99.83
KOG2002|consensus 1018 99.82
KOG0624|consensus 504 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.82
KOG2076|consensus 895 99.82
KOG1840|consensus508 99.82
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.81
KOG1174|consensus564 99.81
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.81
PRK15359144 type III secretion system chaperone protein SscB; 99.81
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.8
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.8
KOG0548|consensus539 99.8
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.79
PRK15359144 type III secretion system chaperone protein SscB; 99.78
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.78
PRK10370198 formate-dependent nitrite reductase complex subuni 99.78
KOG4162|consensus799 99.77
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.77
KOG1840|consensus508 99.77
KOG2003|consensus 840 99.76
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.76
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.75
KOG3060|consensus289 99.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
PRK10370198 formate-dependent nitrite reductase complex subuni 99.74
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.74
KOG0550|consensus 486 99.73
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.73
KOG0548|consensus539 99.72
KOG0495|consensus 913 99.72
PRK14574 822 hmsH outer membrane protein; Provisional 99.72
KOG0550|consensus 486 99.71
KOG0495|consensus 913 99.7
KOG0553|consensus 304 99.7
KOG4162|consensus799 99.7
KOG1174|consensus 564 99.68
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.68
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.68
KOG3060|consensus289 99.68
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.67
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.66
KOG1156|consensus 700 99.66
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.65
KOG1128|consensus 777 99.63
KOG0553|consensus304 99.63
KOG1127|consensus 1238 99.62
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.62
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.57
KOG1127|consensus 1238 99.57
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.57
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.56
PLN03218 1060 maturation of RBCL 1; Provisional 99.55
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.55
KOG1128|consensus 777 99.54
KOG1130|consensus 639 99.53
PLN03218 1060 maturation of RBCL 1; Provisional 99.52
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.5
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.49
KOG2376|consensus 652 99.49
KOG1156|consensus 700 99.48
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.48
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.48
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.48
KOG1130|consensus 639 99.47
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.46
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.45
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.44
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.4
PLN03077 857 Protein ECB2; Provisional 99.4
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.39
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.38
PLN03077 857 Protein ECB2; Provisional 99.38
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.37
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.37
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.37
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.37
KOG4340|consensus 459 99.36
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.36
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.36
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.36
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.36
KOG3785|consensus 557 99.35
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
KOG3785|consensus 557 99.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.35
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.34
KOG1915|consensus 677 99.32
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.32
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.31
PRK15331165 chaperone protein SicA; Provisional 99.3
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.3
PRK11906458 transcriptional regulator; Provisional 99.3
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.29
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.29
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.28
KOG1915|consensus 677 99.28
PRK10803263 tol-pal system protein YbgF; Provisional 99.27
KOG0543|consensus397 99.27
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.27
KOG1070|consensus1710 99.27
KOG0543|consensus397 99.27
PRK11906458 transcriptional regulator; Provisional 99.26
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.25
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.25
PRK10803263 tol-pal system protein YbgF; Provisional 99.24
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.23
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.23
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.22
PRK15331165 chaperone protein SicA; Provisional 99.2
PF12688120 TPR_5: Tetratrico peptide repeat 99.18
PRK04841 903 transcriptional regulator MalT; Provisional 99.14
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.13
PRK04841 903 transcriptional regulator MalT; Provisional 99.13
PF12688120 TPR_5: Tetratrico peptide repeat 99.12
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.12
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.11
KOG4234|consensus271 99.09
KOG2376|consensus 652 99.08
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.08
KOG1941|consensus 518 99.06
KOG4648|consensus 536 99.06
COG4105254 ComL DNA uptake lipoprotein [General function pred 99.06
PF13512142 TPR_18: Tetratricopeptide repeat 99.04
KOG4648|consensus 536 99.04
KOG1070|consensus1710 99.03
PF1337173 TPR_9: Tetratricopeptide repeat 99.03
KOG4340|consensus 459 99.03
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.02
KOG4234|consensus271 99.02
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.0
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.0
COG4700251 Uncharacterized protein conserved in bacteria cont 98.97
PF1337173 TPR_9: Tetratricopeptide repeat 98.95
COG4700251 Uncharacterized protein conserved in bacteria cont 98.93
KOG3081|consensus299 98.92
KOG1586|consensus288 98.9
KOG2047|consensus 835 98.88
PF13512142 TPR_18: Tetratricopeptide repeat 98.88
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.87
KOG2047|consensus 835 98.86
KOG3081|consensus299 98.86
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.85
KOG2796|consensus366 98.85
KOG1941|consensus 518 98.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.84
KOG2796|consensus366 98.81
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.8
KOG4555|consensus175 98.77
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.77
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.75
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.75
KOG2053|consensus 932 98.74
KOG4555|consensus175 98.74
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.69
KOG2610|consensus 491 98.68
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.67
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.66
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.64
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.63
KOG2610|consensus 491 98.61
KOG1585|consensus308 98.55
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.54
KOG4642|consensus 284 98.49
KOG3617|consensus 1416 98.47
KOG4642|consensus284 98.47
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.47
PF1342844 TPR_14: Tetratricopeptide repeat 98.46
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.41
PF1342844 TPR_14: Tetratricopeptide repeat 98.41
KOG0376|consensus 476 98.4
KOG3617|consensus 1416 98.37
KOG0545|consensus329 98.32
KOG1585|consensus308 98.31
PF1343134 TPR_17: Tetratricopeptide repeat 98.26
KOG0545|consensus329 98.25
PF1343134 TPR_17: Tetratricopeptide repeat 98.25
KOG2471|consensus 696 98.24
KOG1586|consensus288 98.23
KOG0530|consensus318 98.21
KOG2471|consensus 696 98.21
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.2
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.19
KOG4507|consensus 886 98.19
KOG0376|consensus 476 98.19
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.18
KOG2053|consensus 932 98.16
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.16
KOG2300|consensus629 98.13
KOG0551|consensus 390 98.1
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.1
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.09
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.09
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.08
KOG0551|consensus 390 98.07
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.06
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 98.06
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.04
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.99
KOG0530|consensus318 97.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.95
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.94
KOG2300|consensus629 97.93
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.91
KOG1258|consensus 577 97.86
KOG1550|consensus 552 97.81
KOG1914|consensus 656 97.79
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.79
KOG1308|consensus377 97.78
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.76
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.75
KOG1258|consensus577 97.71
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.69
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.69
KOG1308|consensus377 97.67
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.66
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.65
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.63
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.61
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.56
KOG4507|consensus 886 97.54
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.53
KOG1914|consensus 656 97.51
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.48
KOG1550|consensus 552 97.46
PRK10941269 hypothetical protein; Provisional 97.46
KOG0985|consensus 1666 97.46
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.44
KOG2396|consensus 568 97.42
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.35
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.3
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.27
KOG2422|consensus 665 97.27
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.26
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.25
KOG3824|consensus 472 97.22
PRK10941269 hypothetical protein; Provisional 97.19
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.18
KOG3616|consensus 1636 97.18
KOG3824|consensus 472 97.17
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.14
KOG1464|consensus 440 97.13
KOG0985|consensus 1666 97.12
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.12
KOG2396|consensus 568 97.09
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.07
KOG3616|consensus 1636 97.05
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.04
KOG3364|consensus149 97.03
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.01
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.93
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.93
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.91
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.88
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.85
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.83
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.83
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.8
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.78
KOG3364|consensus149 96.77
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.77
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.76
KOG3783|consensus546 96.75
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.75
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.72
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.71
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.68
KOG2041|consensus 1189 96.66
KOG1310|consensus 758 96.63
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.63
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.62
KOG3807|consensus 556 96.61
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.54
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.53
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.52
KOG4814|consensus 872 96.5
KOG1839|consensus1236 96.49
COG5191 435 Uncharacterized conserved protein, contains HAT (H 96.48
KOG3807|consensus 556 96.44
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.43
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.41
KOG0890|consensus 2382 96.4
KOG4814|consensus 872 96.25
KOG1310|consensus 758 96.23
KOG1839|consensus1236 96.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.02
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.01
KOG2581|consensus 493 95.98
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.83
KOG0529|consensus 421 95.82
COG5191 435 Uncharacterized conserved protein, contains HAT (H 95.75
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.69
KOG2041|consensus 1189 95.61
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.52
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.51
KOG2581|consensus 493 95.5
COG2912269 Uncharacterized conserved protein [Function unknow 95.44
COG3629280 DnrI DNA-binding transcriptional activator of the 95.23
KOG2422|consensus 665 95.18
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.16
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.13
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.1
COG3629280 DnrI DNA-binding transcriptional activator of the 94.94
KOG0529|consensus 421 94.91
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.86
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 94.75
COG2912269 Uncharacterized conserved protein [Function unknow 94.75
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.62
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.58
KOG1464|consensus 440 94.56
KOG1538|consensus 1081 94.45
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.34
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.21
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.21
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 94.19
KOG0890|consensus 2382 94.06
KOG4014|consensus248 94.03
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.96
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.92
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.87
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 93.83
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 93.65
COG4941415 Predicted RNA polymerase sigma factor containing a 93.58
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.52
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.5
COG3947361 Response regulator containing CheY-like receiver a 93.13
KOG0686|consensus 466 92.92
smart00299140 CLH Clathrin heavy chain repeat homology. 92.92
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 92.88
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.76
COG3947361 Response regulator containing CheY-like receiver a 92.74
KOG0546|consensus372 92.71
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.63
KOG2114|consensus 933 92.56
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.56
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 92.17
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 91.95
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 91.87
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.8
COG4941415 Predicted RNA polymerase sigma factor containing a 91.65
KOG0546|consensus372 91.53
PRK11619 644 lytic murein transglycosylase; Provisional 91.51
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.42
KOG1463|consensus411 91.35
COG3014 449 Uncharacterized protein conserved in bacteria [Fun 91.17
COG4455 273 ImpE Protein of avirulence locus involved in tempe 91.05
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 90.83
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 90.67
KOG1463|consensus411 90.54
PF1304150 PPR_2: PPR repeat family 90.48
PF1285434 PPR_1: PPR repeat 90.45
COG5159 421 RPN6 26S proteasome regulatory complex component [ 90.41
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 90.35
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 90.27
PF1304150 PPR_2: PPR repeat family 90.21
KOG4014|consensus248 90.18
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 90.08
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.61
KOG1538|consensus 1081 89.59
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 89.44
COG4455 273 ImpE Protein of avirulence locus involved in tempe 89.04
KOG4151|consensus 748 88.92
KOG2114|consensus 933 88.81
PF1285434 PPR_1: PPR repeat 88.79
KOG0687|consensus393 88.65
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 88.6
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 88.51
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 88.14
smart00299140 CLH Clathrin heavy chain repeat homology. 87.97
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 87.55
PHA02537230 M terminase endonuclease subunit; Provisional 87.23
COG5159 421 RPN6 26S proteasome regulatory complex component [ 87.16
KOG0276|consensus794 86.68
COG5187 412 RPN7 26S proteasome regulatory complex component, 86.59
KOG1920|consensus 1265 85.92
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 85.73
COG5187 412 RPN7 26S proteasome regulatory complex component, 85.72
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 85.57
KOG4521|consensus 1480 85.37
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 85.32
KOG0687|consensus 393 84.33
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 84.28
PF13226277 DUF4034: Domain of unknown function (DUF4034) 83.14
KOG0276|consensus794 82.97
PRK09687280 putative lyase; Provisional 82.2
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 82.01
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 82.0
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.96
PF04348 536 LppC: LppC putative lipoprotein; InterPro: IPR0074 81.94
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 81.86
PRK11619 644 lytic murein transglycosylase; Provisional 81.56
PF13226 277 DUF4034: Domain of unknown function (DUF4034) 81.37
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 81.15
TIGR02710380 CRISPR-associated protein, TIGR02710 family. Membe 80.47
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 80.39
KOG3783|consensus546 80.3
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 80.27
KOG2063|consensus 877 80.13
>KOG1129|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-46  Score=298.07  Aligned_cols=335  Identities=27%  Similarity=0.307  Sum_probs=303.1

Q ss_pred             CcchhhhhhcccccccccccchhhccccccccCCCCCCccCCcccCC--CCCCCCCCCCCCCCcceeccCCCccCCCCch
Q psy16588          1 MRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTA--PALTSRPRTESGRPVSGVVRPGTLASRGGTL   78 (341)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (341)
                      |||||++||+||+++++.|+++.++|.+.|++.+|||+|+++|.++.  +++..+|.+..|+|++|+++|....+++|++
T Consensus        45 mraLt~~vYvDeld~dd~G~Ae~~ld~n~IA~~aRPGtS~k~p~t~~~g~sq~~rp~t~aGrpv~g~~rp~~~S~rpGsm  124 (478)
T KOG1129|consen   45 MRALTQRVYVDELDEDDGGEAEEELDFNRIATAARPGTSIKTPFTPRPGTSQRARPATSAGRPVAGSSRPRLNSSRPGSM  124 (478)
T ss_pred             HHHHhhheehhhccccccchHHHHhhhhhhccCCCCCCcccCCCCCCCCCchhhcchhhcCCCCccccCccccCCCCccH
Confidence            68999999999999999999999999999999999999999999887  6788899999999999999999999999999


Q ss_pred             HhhhcccccccccCCccchhHhhhhhhhhhcccCCCCCchhHhhhcHH--------------------------------
Q psy16588         79 EQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLA--------------------------------  126 (341)
Q Consensus        79 ~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~--------------------------------  126 (341)
                      ++|+++.|.+.+++++++.+++..|+|++++...++.+|+..+++++-                                
T Consensus       125 ~qA~rt~rta~tar~~~S~sgr~~RlgtaSmaa~~dG~f~nlsRLN~tkYa~~p~l~kaLFey~fyhenDv~~aH~~~~~  204 (478)
T KOG1129|consen  125 AQARRTTRTARTARSLGSRSGRASRLGTASMAAFNDGKFYNLSRLNPTKYAERPTLVKALFEYLFYHENDVQKAHSLCQA  204 (478)
T ss_pred             HhhccCccccccccccccccchhhhhhhhhhhccCCcceeehhhcCchhhccChHHHHHHHHHHHHhhhhHHHHHHHHHH
Confidence            999999999999999999999999999999999999999888887765                                


Q ss_pred             --------------------------HHHHHcCCchHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHH
Q psy16588        127 --------------------------KIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLL  180 (341)
Q Consensus       127 --------------------------~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al  180 (341)
                                                .+|++.|-+.+|.+.++..++..| .++.+..++.+|....+.+.|+..|.+.+
T Consensus       205 ~~~~~~a~~s~~~~~~~dwwWk~Q~gkCylrLgm~r~AekqlqssL~q~~-~~dTfllLskvY~ridQP~~AL~~~~~gl  283 (478)
T KOG1129|consen  205 VLEVERAKPSGSTGCTLDWWWKQQMGKCYLRLGMPRRAEKQLQSSLTQFP-HPDTFLLLSKVYQRIDQPERALLVIGEGL  283 (478)
T ss_pred             HHHHHhccccccccchHhHHHHHHHHHHHHHhcChhhhHHHHHHHhhcCC-chhHHHHHHHHHHHhccHHHHHHHHhhhh
Confidence                                      788888889999999999888877 67888888888988888899999999888


Q ss_pred             HcCCCcHHHHHHHHHHHHHcCChhHHHHHHHHHHhhccccchHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCHHHH
Q psy16588        181 QMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQ  260 (341)
Q Consensus       181 ~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~  260 (341)
                      ...|.+...+...+.++...+++++|.++|+.+++.+|.+  .++...+|..|+..++.+-|+.+|++.+.+.-.+++.+
T Consensus       284 d~fP~~VT~l~g~ARi~eam~~~~~a~~lYk~vlk~~~~n--vEaiAcia~~yfY~~~PE~AlryYRRiLqmG~~speLf  361 (478)
T KOG1129|consen  284 DSFPFDVTYLLGQARIHEAMEQQEDALQLYKLVLKLHPIN--VEAIACIAVGYFYDNNPEMALRYYRRILQMGAQSPELF  361 (478)
T ss_pred             hcCCchhhhhhhhHHHHHHHHhHHHHHHHHHHHHhcCCcc--ceeeeeeeeccccCCChHHHHHHHHHHHHhcCCChHHH
Confidence            8889888888888999999999999999999999998888  88888888888888888999999999988888889999


Q ss_pred             HHHHHHHHHhCCHHHHHHHHHHHHHhCCC---chhHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHH
Q psy16588        261 NNLAVLEAREGHIERASTYLQAAAASSPY---LYETHYNQAVISNLAGDLQESYNIVKKSLDLHPGHSYSWDILRKLEQY  337 (341)
Q Consensus       261 ~~l~~~~~~~g~~~~A~~~~~~al~~~p~---~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~  337 (341)
                      +++|.+++..++++-++..|++++....+   -.++|+++|.+....|++.-|..+|+-++..+++|.+++.+++.+...
T Consensus       362 ~NigLCC~yaqQ~D~~L~sf~RAlstat~~~~aaDvWYNlg~vaV~iGD~nlA~rcfrlaL~~d~~h~ealnNLavL~~r  441 (478)
T KOG1129|consen  362 CNIGLCCLYAQQIDLVLPSFQRALSTATQPGQAADVWYNLGFVAVTIGDFNLAKRCFRLALTSDAQHGEALNNLAVLAAR  441 (478)
T ss_pred             hhHHHHHHhhcchhhhHHHHHHHHhhccCcchhhhhhhccceeEEeccchHHHHHHHHHHhccCcchHHHHHhHHHHHhh
Confidence            99999999999999999999999886542   346899999999999999999999999999999999999988887765


Q ss_pred             h
Q psy16588        338 F  338 (341)
Q Consensus       338 ~  338 (341)
                      -
T Consensus       442 ~  442 (478)
T KOG1129|consen  442 S  442 (478)
T ss_pred             c
Confidence            3



>KOG4626|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1258|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1914|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>KOG4014|consensus Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>COG3014 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4014|consensus Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG4521|consensus Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF13226 DUF4034: Domain of unknown function (DUF4034) Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13226 DUF4034: Domain of unknown function (DUF4034) Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR02710 CRISPR-associated protein, TIGR02710 family Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 6e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-05
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-07
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 7e-07
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 5e-06
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 4e-04
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 3e-05
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-04
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Iteration: 1

Score = 55.1 bits (131), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 2/122 (1%) Query: 150 ATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTC 209 EA +G ++ + A+ +Y++ L++ NAE + NL + YD + Sbjct: 6 GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEY 65 Query: 210 FERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAR 269 +++AL L + N A+ WYN+ + D AI+ AL +D ++ ++ NL + + Sbjct: 66 YQKALEL--DPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQK 123 Query: 270 EG 271 +G Sbjct: 124 QG 125
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-20
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-18
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-19
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 6e-18
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-18
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-14
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-13
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 4e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-17
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-13
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-13
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-09
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-13
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-09
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-13
3u4t_A 272 TPR repeat-containing protein; structural genomics 5e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-04
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-08
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 6e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-09
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-12
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-11
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 9e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-11
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-09
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-08
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-08
4g1t_A 472 Interferon-induced protein with tetratricopeptide 8e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 8e-09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-07
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-09
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 6e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-07
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-07
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 4e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 7e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 8e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 9e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 8e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score = 90.7 bits (226), Expect = 1e-20
 Identities = 34/219 (15%), Positives = 81/219 (36%), Gaps = 6/219 (2%)

Query: 123 LNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQM 182
           + LA       +   + ++   + +++      +  +   HF   + + +  F    ++ 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 183 GLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLA 242
               AE ++NL        Q    +  +  A  L L  +  D + N++   +   D   A
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHA--LRLKPDFIDGYINLAAALVAAGDMEGA 120

Query: 243 IQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISN 302
           +Q    AL  +      +++L  L    G +E A      A  + P       N   + N
Sbjct: 121 VQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFN 180

Query: 303 LAGDLQESYNIVKKSLDLHPGHSYSW----DILRKLEQY 337
             G++  + +  +K++ L P    ++    ++L++   +
Sbjct: 181 AQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIF 219


>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 100.0
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.97
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.97
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.96
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
3u4t_A272 TPR repeat-containing protein; structural genomics 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.95
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.95
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.95
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.95
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.95
3u4t_A272 TPR repeat-containing protein; structural genomics 99.95
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.95
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.94
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.93
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.93
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.93
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.93
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.92
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.92
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.92
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.92
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.91
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.91
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.91
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.9
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.9
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.9
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.9
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.9
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.9
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.89
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.89
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.89
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.89
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.89
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.88
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.88
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.87
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.87
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.87
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.86
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.86
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.86
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.86
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.86
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.86
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.86
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.86
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.85
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.85
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.85
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.84
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.84
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.83
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.83
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.82
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.82
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.82
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.81
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.81
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.8
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.8
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.8
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.79
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.79
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.78
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.78
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.78
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.78
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.78
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.78
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.78
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.78
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.77
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.77
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.77
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.77
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.77
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.76
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.76
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.75
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.75
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.75
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.74
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.74
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.74
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.74
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.74
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.74
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.73
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.73
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.72
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.72
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.72
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.72
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.71
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.71
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.71
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.7
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.7
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.7
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.69
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.69
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.69
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.69
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.68
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.67
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.67
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.67
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.66
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.66
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.65
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.65
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.65
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.64
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.64
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.63
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.63
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.62
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.62
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.62
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.62
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.61
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.61
3k9i_A117 BH0479 protein; putative protein binding protein, 99.61
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.6
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.6
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.59
3k9i_A117 BH0479 protein; putative protein binding protein, 99.59
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.55
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.54
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.49
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.42
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.42
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.39
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.38
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.36
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.32
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.31
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.3
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.3
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.3
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.29
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.28
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.24
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.14
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.06
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.99
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.97
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.97
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.95
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.94
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.92
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.91
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.86
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.85
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.84
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.84
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.81
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.47
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.35
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.31
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.13
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.11
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.02
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.0
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.8
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.77
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.49
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.39
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.38
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.32
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.3
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 97.12
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.98
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.94
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.86
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.83
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.81
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.69
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.67
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.65
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.56
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.56
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 96.47
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.42
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.4
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 96.38
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.04
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 96.02
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.91
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.85
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 95.81
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 95.63
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 94.68
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 94.02
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.51
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 90.67
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.34
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 87.82
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 86.97
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 85.06
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 84.15
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 83.27
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 82.93
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 82.79
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 81.3
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=1.6e-31  Score=215.54  Aligned_cols=201  Identities=14%  Similarity=0.072  Sum_probs=179.9

Q ss_pred             CCCCchhHhhhcHHHHHHHcCCchHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCcHHHHHH
Q psy16588        113 PDGPFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNN  192 (341)
Q Consensus       113 ~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~  192 (341)
                      |.++   ..++.+|.++...|++++|+..|+++++.+|+++.+++.+|.++...|++++|+..|+++++.+|++..+++.
T Consensus         2 p~~~---~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~   78 (217)
T 2pl2_A            2 QTAE---QNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMV   78 (217)
T ss_dssp             --CC---HHHHHHHHHHHHTTCHHHHHHHHHHHHTTSSSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHH
T ss_pred             CCcH---HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHH
Confidence            4455   7789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHc-----------CChhHHHHHHHHHHhhccccchHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCHHHHH
Q psy16588        193 LALCCFYS-----------QQYDMVVTCFERALSLALNENAADVWYNISHVAIGISDTRLAIQCLHLALSIDSSHGLSQN  261 (341)
Q Consensus       193 la~~~~~~-----------~~~~~A~~~~~~al~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~  261 (341)
                      +|.++...           |++++|+..|+++++++|++  ..++..+|.++...|++++|+..|+++++++ +++.++.
T Consensus        79 lg~~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~--~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~-~~~~~~~  155 (217)
T 2pl2_A           79 LSEAYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRY--APLHLQRGLVYALLGERDKAEASLKQALALE-DTPEIRS  155 (217)
T ss_dssp             HHHHHHHHHHTCSSHHHHHHHHHHHHHHHHHHHHHCTTC--HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-CCHHHHH
T ss_pred             HHHHHHHhhhhhhhhcccccCHHHHHHHHHHHHHhCccc--HHHHHHHHHHHHHcCChHHHHHHHHHHHhcc-cchHHHH
Confidence            99999999           99999999999999999999  9999999999999999999999999999999 9999999


Q ss_pred             HHHHHHHHhCCHHHHHHHHHHHHHhCCCchhHHHHHHHHHHHcCCHHHHHHHHHHHHh
Q psy16588        262 NLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQESYNIVKKSLD  319 (341)
Q Consensus       262 ~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~  319 (341)
                      ++|.++...|++++|+..|+++++++|++..++.++|.++...|++++|+..|+++..
T Consensus       156 ~la~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~  213 (217)
T 2pl2_A          156 ALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLLKGKAEEAARAAALEHH  213 (217)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHSTTCHHHHHHHHHHHTC----------------
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHccCHHHHHHHHHHHhh
Confidence            9999999999999999999999999999999999999999999999999999998753



>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-21
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-16
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-09
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.002
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-09
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-08
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-07
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.003
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-04
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.001
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 92.8 bits (229), Expect = 1e-21
 Identities = 48/224 (21%), Positives = 98/224 (43%), Gaps = 6/224 (2%)

Query: 116 PFIQVSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLF 175
           P   V+  NL  +F     + +++ +++  +  D   ++A   +G         + A+  
Sbjct: 166 PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA 225

Query: 176 YRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIG 235
           Y R L +   +A +  NLA   +     D+ +  + RA+   L  +  D + N+++    
Sbjct: 226 YLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI--ELQPHFPDAYCNLANALKE 283

Query: 236 ISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHY 295
                 A  C + AL +  +H  S NNLA ++  +G+IE A    + A    P     H 
Sbjct: 284 KGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHS 343

Query: 296 NQAVISNLAGDLQESYNIVKKSLDLHPGHSYSW----DILRKLE 335
           N A +    G LQE+    K+++ + P  + ++    + L++++
Sbjct: 344 NLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.93
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.84
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.79
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.79
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.78
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.77
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.75
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.75
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.75
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.74
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.72
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.71
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.69
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.69
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.69
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.65
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.65
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.59
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.59
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.59
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 99.52
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.45
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.41
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.39
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.36
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.33
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.28
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.27
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.2
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.16
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.81
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.6
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.6
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.58
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.23
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.11
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.07
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.85
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 83.46
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.4e-29  Score=214.61  Aligned_cols=209  Identities=18%  Similarity=0.154  Sum_probs=192.3

Q ss_pred             HhhhcHHHHHHHcCCchHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCcHHHHHHHHHHHHH
Q psy16588        120 VSRLNLAKIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFY  199 (341)
Q Consensus       120 ~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~  199 (341)
                      ...+..|..++..|++++|+..|+++++.+|+++.+|+.+|.++...|++++|+.+|.++++++|++...+..+|.++..
T Consensus        20 ~~~~~~g~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~   99 (323)
T d1fcha_          20 PQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTN   99 (323)
T ss_dssp             SSHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHhhhccccccccccccccccccc
Confidence            44678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCChhHHHHHHHHHHhhccc-------------------------------------------------cchHHHHHHHH
Q psy16588        200 SQQYDMVVTCFERALSLALN-------------------------------------------------ENAADVWYNIS  230 (341)
Q Consensus       200 ~~~~~~A~~~~~~al~~~~~-------------------------------------------------~~~~~~~~~la  230 (341)
                      .|++++|+..+++++...|.                                                 .....++..+|
T Consensus       100 ~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~~~p~~~~~~~~~~l~  179 (323)
T d1fcha_         100 ESLQRQACEILRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLG  179 (323)
T ss_dssp             TTCHHHHHHHHHHHHHTSTTTGGGCC---------------CTTHHHHHHHHHHHHHHHHHHHHHHSTTSCCHHHHHHHH
T ss_pred             cccccccccchhhHHHhccchHHHHHhhhhhhhhcccccchhhHHHHHHhhHHHHHHHHHHHHHHHhhcccccccchhhH
Confidence            99999999988887765332                                                 22245678899


Q ss_pred             HHHHhcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhCCCchhHHHHHHHHHHHcCCHHHH
Q psy16588        231 HVAIGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLAGDLQES  310 (341)
Q Consensus       231 ~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A  310 (341)
                      .++...|++++|+..|++++..+|+++.+|..+|.++...|++++|+..|+++++++|+++.+++++|.+|..+|++++|
T Consensus       180 ~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~~A  259 (323)
T d1fcha_         180 VLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREA  259 (323)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHHHHHHHhhhhcccccccccccccccchhhhhhcccccccchhHHHHHHHHHHHhhccHHHHHHHHHHHHHCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCCHHHH
Q psy16588        311 YNIVKKSLDLHPGHSYSW  328 (341)
Q Consensus       311 ~~~~~~al~~~p~~~~~~  328 (341)
                      +..|+++++++|++...+
T Consensus       260 ~~~~~~al~l~p~~~~~~  277 (323)
T d1fcha_         260 VEHFLEALNMQRKSRGPR  277 (323)
T ss_dssp             HHHHHHHHHHHHTC----
T ss_pred             HHHHHHHHHhCCcChhhh
Confidence            999999999999886644



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure