Psyllid ID: psy17076
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| 405973540 | 1096 | Metal transporter CNNM2 [Crassostrea gig | 0.845 | 0.054 | 0.516 | 9e-11 | |
| 328720335 | 986 | PREDICTED: metal transporter CNNM2-like | 0.718 | 0.051 | 0.627 | 2e-10 | |
| 328720337 | 950 | PREDICTED: metal transporter CNNM2-like | 0.718 | 0.053 | 0.627 | 2e-10 | |
| 328720333 | 931 | PREDICTED: metal transporter CNNM2-like | 0.718 | 0.054 | 0.627 | 2e-10 | |
| 347967171 | 854 | AGAP002094-PA [Anopheles gambiae str. PE | 0.845 | 0.070 | 0.5 | 6e-10 | |
| 357621730 | 962 | ancient conserved domain protein 2 [Dana | 0.845 | 0.062 | 0.533 | 7e-10 | |
| 242021399 | 834 | conserved hypothetical protein [Pediculu | 0.718 | 0.061 | 0.588 | 1e-09 | |
| 350403868 | 950 | PREDICTED: metal transporter CNNM2-like | 0.845 | 0.063 | 0.5 | 3e-09 | |
| 170073576 | 553 | MAM3 [Culex quinquefasciatus] gi|1678702 | 0.845 | 0.108 | 0.45 | 3e-09 | |
| 260817760 | 800 | hypothetical protein BRAFLDRAFT_86581 [B | 0.845 | 0.075 | 0.5 | 4e-09 |
| >gi|405973540|gb|EKC38248.1| Metal transporter CNNM2 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
Score = 70.9 bits (172), Expect = 9e-11, Method: Composition-based stats.
Identities = 31/60 (51%), Positives = 47/60 (78%)
Query: 11 MEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
++ T LK DEVNIISGAL++++K V+E+MTK++D YMLDI ++L+F +SEI++ G
Sbjct: 597 VKVTKEFNDLKNDEVNIISGALDLSKKSVKEVMTKIEDVYMLDINSVLDFETVSEIMKRG 656
|
Source: Crassostrea gigas Species: Crassostrea gigas Genus: Crassostrea Family: Ostreidae Order: Ostreoida Class: Bivalvia Phylum: Mollusca Superkingdom: Eukaryota |
| >gi|328720335|ref|XP_001945496.2| PREDICTED: metal transporter CNNM2-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328720337|ref|XP_003247005.1| PREDICTED: metal transporter CNNM2-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328720333|ref|XP_003247004.1| PREDICTED: metal transporter CNNM2-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|347967171|ref|XP_320945.5| AGAP002094-PA [Anopheles gambiae str. PEST] gi|333469727|gb|EAA01004.5| AGAP002094-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|357621730|gb|EHJ73464.1| ancient conserved domain protein 2 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|242021399|ref|XP_002431132.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516381|gb|EEB18394.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|170073576|ref|XP_001870397.1| MAM3 [Culex quinquefasciatus] gi|167870221|gb|EDS33604.1| MAM3 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|260817760|ref|XP_002603753.1| hypothetical protein BRAFLDRAFT_86581 [Branchiostoma floridae] gi|229289076|gb|EEN59764.1| hypothetical protein BRAFLDRAFT_86581 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| RGD|1308728 | 878 | Cnnm1 "cyclin M1" [Rattus norv | 0.718 | 0.058 | 0.529 | 6.5e-09 | |
| UNIPROTKB|F1MD84 | 941 | CNNM1 "Uncharacterized protein | 0.718 | 0.054 | 0.529 | 7.1e-09 | |
| UNIPROTKB|F1PMJ7 | 948 | CNNM1 "Uncharacterized protein | 0.718 | 0.053 | 0.529 | 7.2e-09 | |
| UNIPROTKB|F1S8W6 | 949 | CNNM1 "Uncharacterized protein | 0.718 | 0.053 | 0.529 | 7.2e-09 | |
| UNIPROTKB|Q9NRU3 | 951 | CNNM1 "Metal transporter CNNM1 | 0.718 | 0.053 | 0.529 | 7.2e-09 | |
| MGI|MGI:1891366 | 951 | Cnnm1 "cyclin M1" [Mus musculu | 0.718 | 0.053 | 0.529 | 7.2e-09 | |
| FB|FBgn0262124 | 834 | uex "unextended" [Drosophila m | 0.845 | 0.071 | 0.433 | 9.9e-09 | |
| UNIPROTKB|F1ND49 | 598 | CNNM2 "Uncharacterized protein | 0.718 | 0.085 | 0.509 | 1.3e-08 | |
| UNIPROTKB|Q6P4Q7 | 775 | CNNM4 "Metal transporter CNNM4 | 0.718 | 0.065 | 0.509 | 2.4e-08 | |
| UNIPROTKB|F1S849 | 827 | CNNM2 "Uncharacterized protein | 0.718 | 0.061 | 0.529 | 2.6e-08 |
| RGD|1308728 Cnnm1 "cyclin M1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 145 (56.1 bits), Expect = 6.5e-09, P = 6.5e-09
Identities = 27/51 (52%), Positives = 39/51 (76%)
Query: 20 LKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
L K+E+NII GALE+ K VEE++T L DC+ML + +L+F +SEI+R+G
Sbjct: 339 LVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSG 389
|
|
| UNIPROTKB|F1MD84 CNNM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PMJ7 CNNM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8W6 CNNM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NRU3 CNNM1 "Metal transporter CNNM1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891366 Cnnm1 "cyclin M1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0262124 uex "unextended" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P4Q7 CNNM4 "Metal transporter CNNM4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S849 CNNM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 0.002 |
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Score = 33.8 bits (78), Expect = 0.002
Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
Query: 19 ALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
L+++E +I+ L++ + V EIMT D LD+ + +I I+ +G
Sbjct: 188 VLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESG 238
|
Length = 429 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| PRK11573 | 413 | hypothetical protein; Provisional | 99.5 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.47 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.46 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.44 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.31 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.28 | |
| KOG2118|consensus | 498 | 98.78 | ||
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 96.94 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 95.18 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 93.05 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 88.08 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 85.28 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 84.04 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 83.37 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 82.75 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 81.56 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 81.33 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 81.25 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 80.32 |
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=99.50 E-value=1.2e-14 Score=106.01 Aligned_cols=64 Identities=11% Similarity=0.318 Sum_probs=57.6
Q ss_pred chhccceeeecccCCCcCCHHHHHHHHHhhcCCCceeecceeecccEEEeeCCCCccHHHHHHHHHcCC
Q psy17076 3 KKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE 71 (71)
Q Consensus 3 ~~~~~l~~~~~~~~~g~i~~~e~~ml~~~l~l~d~~V~eIMtPR~~v~~l~~~~~l~~~~~~~i~~sgh 71 (71)
.|++++++.... .++++|++||.|+|+|++++|+||||||++|++++.+++++ ++++.+.++||
T Consensus 157 eEl~~lv~~~~~----~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~~~~~~ 220 (413)
T PRK11573 157 EELRTIVHESRS----QISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQLTHSPH 220 (413)
T ss_pred HHHHHHHHHHhh----hcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHHHhCCC
Confidence 477777764322 59999999999999999999999999999999999999999 79999999998
|
|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118|consensus | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.2 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.13 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.1 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.99 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.67 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 98.58 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 98.43 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.1 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 97.97 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.93 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 97.75 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 97.74 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 97.68 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 97.67 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 97.48 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.37 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.34 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 97.2 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 96.98 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 96.67 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 96.65 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 96.6 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 96.49 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 96.48 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 96.46 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 96.18 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 95.94 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 95.93 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 95.44 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 95.43 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 95.42 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 95.29 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 95.26 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 95.14 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 95.03 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 94.56 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 94.1 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 93.74 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 93.7 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 93.66 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 93.54 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 92.78 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 92.51 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 92.36 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 92.06 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 91.99 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 91.94 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 91.91 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 91.78 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 91.74 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 90.86 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 90.77 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 90.59 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 90.2 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 90.0 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 89.86 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 89.83 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 89.75 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 89.38 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 89.35 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 89.14 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 89.09 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 89.07 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 88.94 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 88.85 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 88.82 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 88.65 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 88.63 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 88.34 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 88.16 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 88.11 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 88.09 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 87.6 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 87.46 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 87.02 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 86.89 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 86.62 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 86.44 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 86.05 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 85.6 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 85.49 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 85.12 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 85.0 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 84.6 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 84.47 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 84.15 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 84.15 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 84.14 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 83.74 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 83.31 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 81.26 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 80.49 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 80.08 |
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
Probab=99.20 E-value=6e-12 Score=78.06 Aligned_cols=66 Identities=9% Similarity=0.162 Sum_probs=59.1
Q ss_pred chhccceeeecccCCCcCCHHHHHHHHHhhcCCCceeecceeecccEEEeeCCCCccHHHHHHHHHcCC
Q psy17076 3 KKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE 71 (71)
Q Consensus 3 ~~~~~l~~~~~~~~~g~i~~~e~~ml~~~l~l~d~~V~eIMtPR~~v~~l~~~~~l~~~~~~~i~~sgh 71 (71)
.||+.|+. .+.+.|.++++|++++.++++|++.+|++||+||.++++++.++++. ++++.+.++||
T Consensus 6 ~el~~li~--~~~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~i~-~a~~~m~~~~~ 71 (156)
T 3oi8_A 6 EDVLNLLR--QAHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE-RITAYVIDTAH 71 (156)
T ss_dssp HHHHHHHH--HHHHTTSSCHHHHHHHHHHHHHTTCBGGGTCEEGGGCCCEETTCCHH-HHHHHHHHHCC
T ss_pred HHHHHHHH--hHHhcCCcCHHHHHHHHHHhccCCCCHhheeeeHHHeEEECCCCCHH-HHHHHHHHCCC
Confidence 46777765 45567999999999999999999999999999999999999999999 79999998775
|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 97.99 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.86 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.21 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 96.31 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 95.85 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 95.79 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 95.26 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 94.89 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 94.62 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 94.44 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 94.29 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 94.17 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 93.18 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 92.39 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 91.69 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 91.64 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 91.24 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 90.97 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 90.92 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 90.64 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 89.0 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 88.42 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 86.91 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 86.74 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 86.48 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 86.22 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 86.11 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 85.71 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 85.49 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 85.48 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 81.19 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 81.18 |
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Hypothetical protein YkuL species: Bacillus subtilis [TaxId: 1423]
Probab=97.99 E-value=8e-07 Score=52.33 Aligned_cols=35 Identities=17% Similarity=0.289 Sum_probs=33.2
Q ss_pred CceeecceeecccEEEeeCCCCccHHHHHHHHHcCC
Q psy17076 36 QKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE 71 (71)
Q Consensus 36 d~~V~eIMtPR~~v~~l~~~~~l~~~~~~~i~~sgh 71 (71)
|++|+++|+|..+|++++.+.++. ++++.+.++||
T Consensus 1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~ 35 (132)
T d1yava3 1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGY 35 (132)
T ss_dssp TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCC
T ss_pred CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCC
Confidence 679999999999999999999999 79999999986
|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|