Psyllid ID: psy17076


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MKKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
cHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHcEEcccEEEEcccccccHHHHHHHHHccc
ccccccEEEEEEcccccccccHHHHHHHHHHHHHHHccHHHHccccccEEEEccccEccHHHHHHHHHccc
mkkkfktgipmeaTSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
mkkkfktgipmeatsnlvalkkDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
MKKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
****************LVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIV****
*KKKFKTGIPMEATSN**ALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
********IPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
***KFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRT**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
Q0GA42 951 Metal transporter CNNM1 O yes N/A 0.718 0.053 0.529 7e-10
Q9NRU3 951 Metal transporter CNNM1 O yes N/A 0.718 0.053 0.529 7e-10
Q5U2P1 875 Metal transporter CNNM2 O no N/A 0.718 0.058 0.529 1e-08
Q9H8M5 875 Metal transporter CNNM2 O no N/A 0.718 0.058 0.529 1e-08
Q3TWN3 875 Metal transporter CNNM2 O no N/A 0.718 0.058 0.529 1e-08
Q69ZF7 771 Metal transporter CNNM4 O no N/A 0.718 0.066 0.509 2e-08
Q6P4Q7 775 Metal transporter CNNM4 O no N/A 0.718 0.065 0.509 2e-08
P0C588 772 Metal transporter CNNM4 O no N/A 0.718 0.066 0.509 2e-08
A0JPA0 769 Metal transporter CNNM4 O no N/A 0.845 0.078 0.4 2e-08
Q12296 706 Protein MAM3 OS=Saccharom yes N/A 0.971 0.097 0.362 2e-06
>sp|Q0GA42|CNNM1_MOUSE Metal transporter CNNM1 OS=Mus musculus GN=Cnnm1 PE=1 SV=5 Back     alignment and function desciption
 Score = 62.4 bits (150), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 27/51 (52%), Positives = 39/51 (76%)

Query: 20  LKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
           L K+E+NII GALE+  K VEE++T L DC+ML  + +L+F  +SEI+R+G
Sbjct: 410 LVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSG 460




Probable metal transporter.
Mus musculus (taxid: 10090)
>sp|Q9NRU3|CNNM1_HUMAN Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=3 Back     alignment and function description
>sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 Back     alignment and function description
>sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 Back     alignment and function description
>sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 Back     alignment and function description
>sp|Q69ZF7|CNNM4_MOUSE Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2 Back     alignment and function description
>sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3 Back     alignment and function description
>sp|P0C588|CNNM4_RAT Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1 Back     alignment and function description
>sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 Back     alignment and function description
>sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
405973540 1096 Metal transporter CNNM2 [Crassostrea gig 0.845 0.054 0.516 9e-11
328720335 986 PREDICTED: metal transporter CNNM2-like 0.718 0.051 0.627 2e-10
328720337 950 PREDICTED: metal transporter CNNM2-like 0.718 0.053 0.627 2e-10
328720333 931 PREDICTED: metal transporter CNNM2-like 0.718 0.054 0.627 2e-10
347967171 854 AGAP002094-PA [Anopheles gambiae str. PE 0.845 0.070 0.5 6e-10
357621730 962 ancient conserved domain protein 2 [Dana 0.845 0.062 0.533 7e-10
242021399 834 conserved hypothetical protein [Pediculu 0.718 0.061 0.588 1e-09
350403868 950 PREDICTED: metal transporter CNNM2-like 0.845 0.063 0.5 3e-09
170073576 553 MAM3 [Culex quinquefasciatus] gi|1678702 0.845 0.108 0.45 3e-09
260817760 800 hypothetical protein BRAFLDRAFT_86581 [B 0.845 0.075 0.5 4e-09
>gi|405973540|gb|EKC38248.1| Metal transporter CNNM2 [Crassostrea gigas] Back     alignment and taxonomy information
 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 31/60 (51%), Positives = 47/60 (78%)

Query: 11  MEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
           ++ T     LK DEVNIISGAL++++K V+E+MTK++D YMLDI ++L+F  +SEI++ G
Sbjct: 597 VKVTKEFNDLKNDEVNIISGALDLSKKSVKEVMTKIEDVYMLDINSVLDFETVSEIMKRG 656




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|328720335|ref|XP_001945496.2| PREDICTED: metal transporter CNNM2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720337|ref|XP_003247005.1| PREDICTED: metal transporter CNNM2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720333|ref|XP_003247004.1| PREDICTED: metal transporter CNNM2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|347967171|ref|XP_320945.5| AGAP002094-PA [Anopheles gambiae str. PEST] gi|333469727|gb|EAA01004.5| AGAP002094-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357621730|gb|EHJ73464.1| ancient conserved domain protein 2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242021399|ref|XP_002431132.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516381|gb|EEB18394.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170073576|ref|XP_001870397.1| MAM3 [Culex quinquefasciatus] gi|167870221|gb|EDS33604.1| MAM3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|260817760|ref|XP_002603753.1| hypothetical protein BRAFLDRAFT_86581 [Branchiostoma floridae] gi|229289076|gb|EEN59764.1| hypothetical protein BRAFLDRAFT_86581 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
RGD|1308728 878 Cnnm1 "cyclin M1" [Rattus norv 0.718 0.058 0.529 6.5e-09
UNIPROTKB|F1MD84 941 CNNM1 "Uncharacterized protein 0.718 0.054 0.529 7.1e-09
UNIPROTKB|F1PMJ7 948 CNNM1 "Uncharacterized protein 0.718 0.053 0.529 7.2e-09
UNIPROTKB|F1S8W6 949 CNNM1 "Uncharacterized protein 0.718 0.053 0.529 7.2e-09
UNIPROTKB|Q9NRU3 951 CNNM1 "Metal transporter CNNM1 0.718 0.053 0.529 7.2e-09
MGI|MGI:1891366 951 Cnnm1 "cyclin M1" [Mus musculu 0.718 0.053 0.529 7.2e-09
FB|FBgn0262124 834 uex "unextended" [Drosophila m 0.845 0.071 0.433 9.9e-09
UNIPROTKB|F1ND49 598 CNNM2 "Uncharacterized protein 0.718 0.085 0.509 1.3e-08
UNIPROTKB|Q6P4Q7 775 CNNM4 "Metal transporter CNNM4 0.718 0.065 0.509 2.4e-08
UNIPROTKB|F1S849 827 CNNM2 "Uncharacterized protein 0.718 0.061 0.529 2.6e-08
RGD|1308728 Cnnm1 "cyclin M1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 145 (56.1 bits), Expect = 6.5e-09, P = 6.5e-09
 Identities = 27/51 (52%), Positives = 39/51 (76%)

Query:    20 LKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
             L K+E+NII GALE+  K VEE++T L DC+ML  + +L+F  +SEI+R+G
Sbjct:   339 LVKEELNIIQGALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSG 389




GO:0005886 "plasma membrane" evidence=IEA
UNIPROTKB|F1MD84 CNNM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMJ7 CNNM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8W6 CNNM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRU3 CNNM1 "Metal transporter CNNM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1891366 Cnnm1 "cyclin M1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0262124 uex "unextended" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4Q7 CNNM4 "Metal transporter CNNM4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S849 CNNM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0GA42CNNM1_MOUSENo assigned EC number0.52940.71830.0536yesN/A
Q9NRU3CNNM1_HUMANNo assigned EC number0.52940.71830.0536yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
COG1253 429 COG1253, TlyC, Hemolysins and related proteins con 0.002
>gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
 Score = 33.8 bits (78), Expect = 0.002
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 19  ALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTG 70
            L+++E  +I+  L++  + V EIMT   D   LD+   +   +I  I+ +G
Sbjct: 188 VLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESG 238


Length = 429

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
PRK11573 413 hypothetical protein; Provisional 99.5
COG1253 429 TlyC Hemolysins and related proteins containing CB 99.47
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 99.46
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 99.44
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.31
COG4536 423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.28
KOG2118|consensus 498 98.78
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 96.94
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 95.18
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 93.05
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 88.08
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 85.28
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 84.04
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 83.37
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 82.75
PLN02274 505 inosine-5'-monophosphate dehydrogenase 81.56
COG4109 432 Predicted transcriptional regulator containing CBS 81.33
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 81.25
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 80.32
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.50  E-value=1.2e-14  Score=106.01  Aligned_cols=64  Identities=11%  Similarity=0.318  Sum_probs=57.6

Q ss_pred             chhccceeeecccCCCcCCHHHHHHHHHhhcCCCceeecceeecccEEEeeCCCCccHHHHHHHHHcCC
Q psy17076          3 KKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE   71 (71)
Q Consensus         3 ~~~~~l~~~~~~~~~g~i~~~e~~ml~~~l~l~d~~V~eIMtPR~~v~~l~~~~~l~~~~~~~i~~sgh   71 (71)
                      .|++++++....    .++++|++||.|+|+|++++|+||||||++|++++.+++++ ++++.+.++||
T Consensus       157 eEl~~lv~~~~~----~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~~~~~~  220 (413)
T PRK11573        157 EELRTIVHESRS----QISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQLTHSPH  220 (413)
T ss_pred             HHHHHHHHHHhh----hcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHHHhCCC
Confidence            477777764322    59999999999999999999999999999999999999999 79999999998



>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2118|consensus Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.2
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.13
3ocm_A 173 Putative membrane protein; structural genomics, PS 99.1
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 98.99
3oco_A153 Hemolysin-like protein containing CBS domains; str 98.67
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 98.58
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 98.43
3k6e_A 156 CBS domain protein; streptococcus pneumoniae TIGR4 98.1
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 97.97
3kxr_A 205 Magnesium transporter, putative; cystathionine bet 97.93
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 97.75
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 97.74
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 97.68
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 97.67
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 97.48
2yvy_A 278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.37
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 97.34
3ctu_A 156 CBS domain protein; structural genomics, PSI-2, pr 97.2
2emq_A 157 Hypothetical conserved protein; CBS domains, NPPSF 96.98
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 96.67
1yav_A 159 Hypothetical protein BSU14130; cystathionine beta 96.65
2oux_A 286 Magnesium transporter; 10001B, structural genomics 96.6
4esy_A 170 CBS domain containing membrane protein; structural 96.49
3lqn_A 150 CBS domain protein; csgid, structural genomics, un 96.48
4gqw_A 152 CBS domain-containing protein CBSX1, chloroplasti; 96.46
3org_A 632 CMCLC; transporter, transport protein; 3.50A {Cyan 96.18
3sl7_A 180 CBS domain-containing protein CBSX2; CBS-PAIR prot 95.94
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 95.93
4fry_A 157 Putative signal-transduction protein with CBS DOM; 95.44
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 95.43
2pfi_A 164 Chloride channel protein CLC-Ka; cystathionine bet 95.42
3fhm_A 165 Uncharacterized protein ATU1752; CBS domain, proka 95.29
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 95.26
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 95.14
2j9l_A 185 Chloride channel protein 5; ION channel, ION trans 95.03
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 94.56
3ddj_A 296 CBS domain-containing protein; structural genomics 94.1
1pbj_A125 Hypothetical protein; structural genomics, domain, 93.74
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 93.7
1o50_A 157 CBS domain-containing predicted protein TM0935; CB 93.66
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 93.54
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 92.78
2rih_A 141 Conserved protein with 2 CBS domains; bateman doma 92.51
4fry_A157 Putative signal-transduction protein with CBS DOM; 92.36
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 92.06
3fv6_A 159 YQZB protein; CBS domain dimer, metabolism regulat 91.99
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 91.94
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 91.91
2o16_A 160 Acetoin utilization protein ACUB, putative; struct 91.78
1pbj_A125 Hypothetical protein; structural genomics, domain, 91.74
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 90.86
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 90.77
1pvm_A184 Conserved hypothetical protein TA0289; structural 90.59
1o50_A157 CBS domain-containing predicted protein TM0935; CB 90.2
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 90.0
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 89.86
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 89.83
1vr9_A 213 CBS domain protein/ACT domain protein; structural 89.75
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 89.38
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 89.35
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 89.14
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 89.09
3ddj_A 296 CBS domain-containing protein; structural genomics 89.07
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 88.94
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 88.85
3lqn_A150 CBS domain protein; csgid, structural genomics, un 88.82
2o16_A160 Acetoin utilization protein ACUB, putative; struct 88.65
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 88.63
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 88.34
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 88.16
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 88.11
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 88.09
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 87.6
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 87.46
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 87.02
1pvm_A 184 Conserved hypothetical protein TA0289; structural 86.89
3oco_A153 Hemolysin-like protein containing CBS domains; str 86.62
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 86.44
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 86.05
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 85.6
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 85.49
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 85.12
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 85.0
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 84.6
2nyc_A 144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 84.47
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 84.15
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 84.15
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 84.14
4esy_A170 CBS domain containing membrane protein; structural 83.74
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 83.31
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 81.26
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 80.49
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 80.08
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
Probab=99.20  E-value=6e-12  Score=78.06  Aligned_cols=66  Identities=9%  Similarity=0.162  Sum_probs=59.1

Q ss_pred             chhccceeeecccCCCcCCHHHHHHHHHhhcCCCceeecceeecccEEEeeCCCCccHHHHHHHHHcCC
Q psy17076          3 KKFKTGIPMEATSNLVALKKDEVNIISGALEMTQKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE   71 (71)
Q Consensus         3 ~~~~~l~~~~~~~~~g~i~~~e~~ml~~~l~l~d~~V~eIMtPR~~v~~l~~~~~l~~~~~~~i~~sgh   71 (71)
                      .||+.|+.  .+.+.|.++++|++++.++++|++.+|++||+||.++++++.++++. ++++.+.++||
T Consensus         6 ~el~~li~--~~~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~i~-~a~~~m~~~~~   71 (156)
T 3oi8_A            6 EDVLNLLR--QAHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE-RITAYVIDTAH   71 (156)
T ss_dssp             HHHHHHHH--HHHHTTSSCHHHHHHHHHHHHHTTCBGGGTCEEGGGCCCEETTCCHH-HHHHHHHHHCC
T ss_pred             HHHHHHHH--hHHhcCCcCHHHHHHHHHHhccCCCCHhheeeeHHHeEEECCCCCHH-HHHHHHHHCCC
Confidence            46777765  45567999999999999999999999999999999999999999999 79999998775



>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 97.99
d2ooxe1 179 Uncharacterized protein C1556.08c {Schizosaccharom 97.86
d2v8qe2 159 5'-AMP-activated protein kinase subunit gamma-1, A 97.21
d2d4za3 160 Chloride channel protein, CBS tandem {Marbled elec 96.31
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 95.85
d3ddja1 141 Uncharacterized protein SSO3205 {Sulfolobus solfat 95.79
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 95.26
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 94.89
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 94.62
d2o16a3 139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 94.44
d2j9la1 169 Chloride channel protein 5, ClC-5 {Human (Homo sap 94.29
d3ddja2 135 Uncharacterized protein SSO3205 {Sulfolobus solfat 94.17
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 93.18
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 92.39
d2yvxa2 144 Magnesium transporter MgtE {Thermus thermophilus [ 91.69
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 91.64
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 91.24
d2v8qe1 145 5'-AMP-activated protein kinase subunit gamma-1, A 90.97
d1pvma4 142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 90.92
d2yzqa1 156 Uncharacterized protein PH1780 {Pyrococcus horikos 90.64
d2ooxe2 153 Uncharacterized protein C1556.08c {Schizosaccharom 89.0
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 88.42
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 86.91
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 86.74
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 86.48
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 86.22
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 86.11
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 85.71
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 85.49
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 85.48
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 81.19
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 81.18
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein YkuL
species: Bacillus subtilis [TaxId: 1423]
Probab=97.99  E-value=8e-07  Score=52.33  Aligned_cols=35  Identities=17%  Similarity=0.289  Sum_probs=33.2

Q ss_pred             CceeecceeecccEEEeeCCCCccHHHHHHHHHcCC
Q psy17076         36 QKKVEEIMTKLDDCYMLDIETILNFTVISEIVRTGE   71 (71)
Q Consensus        36 d~~V~eIMtPR~~v~~l~~~~~l~~~~~~~i~~sgh   71 (71)
                      |++|+++|+|..+|++++.+.++. ++++.+.++||
T Consensus         1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~   35 (132)
T d1yava3           1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGY   35 (132)
T ss_dssp             TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCC
T ss_pred             CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCC
Confidence            679999999999999999999999 79999999986



>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure