Psyllid ID: psy17476


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFRLGLLAD
cccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEcccccccccccccEEEcccccccccccccccHHHHHHHHHHccccccccccccccHHEEEEEccccccccccccHHHHHcEEccccccccccccccHHHHHHHHHHHccccccccEEEccccccccEEEcccccccccccccccccccccccccccHHHccccccccccccccEEEEEccccccEEEEEEEccccccEEEEEEEEcccccEEEEcccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEEcccEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEccccccccccc
ccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcHEEEEEccccccccEEEEEEEccccccccccEEccccEEEEEcccccccEEEEcccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccccEEEEEcccccEEEEEHHHEcccccccccccHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccccccEEEEEEcccccHHHHHHccccccccccEEEEcccccccccccccccHHccccHHHHHHHHHcccccccEEEEEEccccccEEEEEEccccccEEEEEEEEEcccccEEEEcccccccHHHHHHHHHccccccHHEcccEEccccccccccccccccEccHHHEEEEEEEEEcccEEEEEEEEcccEEEEEEccccccHHHHHHHHHHHHccccccEccEEEEEcccccEEEEEEccccccccccc
MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIhretkkslypsslneisfilwpdqmirpKVVVALypfkaieggdlslekgaeyevmddTQEHWWKVkdkngirkpdqmirpKVVVALypfkaieggdlslekgaeyevmdDTQEHWWKVkdkngsvgyipsnyvKEKELlglqkyddvngLTLELIHQVLNYtrfssksdvWAYGVLMWEVFtcgkmpygrlkntevVDRVQRGiilekpkawyvgdmsRQRAESILKqedkegcfvvrnsstkglyTLSLytkvphphvkhyhikqnsrgefflsekhcchsipevkdkegcfvvrnsstkglyTLSLytkvphphvkhyhikqnsrgefflsekhcchsipevvnyhrhnsgglasrlktspcdrpvpataglshdkweidPAELMLLEelgsgqfgvvrrgkwrgsIDVAmmkegtmsedDFIEEAKVMTRLQHQNLVQLYGvcskhrpiyivtdtssfrlgllad
mrhgsllnYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRetkkslypssLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWwkvkdkngirkpdqmirPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVkdkngsvgyiPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGiilekpkawyvgdmSRQRAESilkqedkegcfvvrnsstkgLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSipevkdkegcfVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEElgsgqfgvvrrgkwrGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGvcskhrpiyivtdtssfrlgllad
MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFRLGLLAD
*****LLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMS******IL***DKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGG*****************AGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFRLGL***
*RHGSLLNYLRRH*****GNVGLLLDMCIQVCKGMAYLERHNY*****************************KVVVALYPF*********************************************VVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFRLGLLA*
MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFRLGLLAD
***GSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFR******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAMMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFRLGLLAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query513 2.2.26 [Sep-21-2011]
P08630 786 Tyrosine-protein kinase B yes N/A 0.397 0.259 0.735 4e-85
Q06187 659 Tyrosine-protein kinase B yes N/A 0.329 0.256 0.551 8e-51
P35991 659 Tyrosine-protein kinase B yes N/A 0.329 0.256 0.545 2e-50
P24604 630 Tyrosine-protein kinase T no N/A 0.335 0.273 0.541 3e-49
P42680 631 Tyrosine-protein kinase T no N/A 0.333 0.270 0.538 1e-48
Q8JH64 657 Tyrosine-protein kinase B no N/A 0.329 0.257 0.531 4e-48
P42681 527 Tyrosine-protein kinase T no N/A 0.333 0.324 0.505 4e-47
P42682 527 Tyrosine-protein kinase T no N/A 0.329 0.320 0.505 1e-46
P51813 675 Cytoplasmic tyrosine-prot no N/A 0.333 0.253 0.505 5e-45
P97504 651 Cytoplasmic tyrosine-prot no N/A 0.333 0.262 0.494 4e-44
>sp|P08630|BTKL_DROME Tyrosine-protein kinase Btk29A OS=Drosophila melanogaster GN=Btk29A PE=2 SV=2 Back     alignment and function desciption
 Score =  315 bits (808), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 153/208 (73%), Positives = 175/208 (84%), Gaps = 4/208 (1%)

Query: 299 VPHPHVKHYHIKQNSRGEFFLSE--KHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTK 356
           +P  +VK   +    R E+++ +  +    S+ +  DKEGCFVVR SSTKGLYTLSL+TK
Sbjct: 392 IPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRKSSTKGLYTLSLHTK 451

Query: 357 VPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPAT 416
           VP  HVKHYHIKQN+R E++LSEKHCC +IP+++NYHRHNSGGLA RLK+SPCDRPVP T
Sbjct: 452 VPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPT 511

Query: 417 AGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAK 474
           AGLSHDKWEI P ELML+EELGSGQFGVVRRGKWRGSID A  MMKEGTMSEDDFIEEAK
Sbjct: 512 AGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAK 571

Query: 475 VMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
           VMT+LQH NLVQLYGVCSKHRPIYIVT+
Sbjct: 572 VMTKLQHPNLVQLYGVCSKHRPIYIVTE 599




Required for proper ring canal development. Also required for the development of male genitalia and for adult survival.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 0EC: .EC: 2
>sp|Q06187|BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens GN=BTK PE=1 SV=3 Back     alignment and function description
>sp|P35991|BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus GN=Btk PE=1 SV=4 Back     alignment and function description
>sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus GN=Tec PE=1 SV=2 Back     alignment and function description
>sp|P42680|TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens GN=TEC PE=1 SV=2 Back     alignment and function description
>sp|Q8JH64|BTK_CHICK Tyrosine-protein kinase BTK OS=Gallus gallus GN=BTK PE=1 SV=1 Back     alignment and function description
>sp|P42681|TXK_HUMAN Tyrosine-protein kinase TXK OS=Homo sapiens GN=TXK PE=1 SV=3 Back     alignment and function description
>sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK OS=Mus musculus GN=Txk PE=1 SV=1 Back     alignment and function description
>sp|P51813|BMX_HUMAN Cytoplasmic tyrosine-protein kinase BMX OS=Homo sapiens GN=BMX PE=1 SV=1 Back     alignment and function description
>sp|P97504|BMX_MOUSE Cytoplasmic tyrosine-protein kinase BMX OS=Mus musculus GN=Bmx PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
383849754 711 PREDICTED: tyrosine-protein kinase Btk29 0.397 0.286 0.793 2e-90
380028436 722 PREDICTED: tyrosine-protein kinase Btk29 0.397 0.282 0.793 3e-90
307206152504 Tyrosine-protein kinase Btk29A [Harpegna 0.397 0.404 0.793 4e-90
328780764 694 PREDICTED: tyrosine-protein kinase Btk29 0.397 0.293 0.793 4e-90
340727645 691 PREDICTED: tyrosine-protein kinase Btk29 0.397 0.295 0.788 4e-90
242006732 644 predicted protein [Pediculus humanus cor 0.397 0.316 0.783 6e-90
350412029518 PREDICTED: tyrosine-protein kinase Btk29 0.397 0.393 0.793 8e-90
332018953422 Tyrosine-protein kinase Btk29A [Acromyrm 0.397 0.483 0.793 1e-89
345487249 711 PREDICTED: tyrosine-protein kinase Btk29 0.397 0.286 0.788 1e-89
307183119479 Tyrosine-protein kinase Btk29A [Camponot 0.397 0.425 0.788 1e-89
>gi|383849754|ref|XP_003700502.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  339 bits (869), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 183/208 (87%), Gaps = 4/208 (1%)

Query: 299 VPHPHVKHYHIKQNSRGEFFLSE--KHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTK 356
           +P  +VK   +    + E+++ +  +    S+ + +DKEGCFVVRNSSTKGLYTLSLYTK
Sbjct: 316 IPSNYVKEKELLGLQKYEWYVGDMSRQRAESLLKQEDKEGCFVVRNSSTKGLYTLSLYTK 375

Query: 357 VPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPAT 416
           VPHPHVKHYHIKQN+RGEF+LSEKHCC SIP++VNYHRHNSGGLASRLKTSPCDRPVP T
Sbjct: 376 VPHPHVKHYHIKQNTRGEFYLSEKHCCGSIPDLVNYHRHNSGGLASRLKTSPCDRPVPPT 435

Query: 417 AGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAK 474
           AGLSHDKWEIDPAEL LLEELGSGQFGVVRRGKWRGSIDVA  MMKEGTMSEDDFIEEAK
Sbjct: 436 AGLSHDKWEIDPAELHLLEELGSGQFGVVRRGKWRGSIDVAVKMMKEGTMSEDDFIEEAK 495

Query: 475 VMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
           VMT+LQHQNLVQLYGVCSK RPIYIVT+
Sbjct: 496 VMTKLQHQNLVQLYGVCSKDRPIYIVTE 523




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380028436|ref|XP_003697908.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Apis florea] Back     alignment and taxonomy information
>gi|307206152|gb|EFN84232.1| Tyrosine-protein kinase Btk29A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328780764|ref|XP_394126.4| PREDICTED: tyrosine-protein kinase Btk29A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340727645|ref|XP_003402150.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|242006732|ref|XP_002424201.1| predicted protein [Pediculus humanus corporis] gi|212507542|gb|EEB11463.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350412029|ref|XP_003489521.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332018953|gb|EGI59499.1| Tyrosine-protein kinase Btk29A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345487249|ref|XP_003425657.1| PREDICTED: tyrosine-protein kinase Btk29A-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307183119|gb|EFN70036.1| Tyrosine-protein kinase Btk29A [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
FB|FBgn0003502 786 Btk29A "Btk family kinase at 2 0.520 0.339 0.599 8.5e-81
UNIPROTKB|F1SEA4 596 TEC "Uncharacterized protein" 0.333 0.286 0.544 6.1e-66
UNIPROTKB|K7GR59 632 TEC "Uncharacterized protein" 0.333 0.270 0.544 6.1e-66
UNIPROTKB|D4A596 630 Tec "Protein Tec" [Rattus norv 0.333 0.271 0.544 2e-65
UNIPROTKB|F1NZY8 630 TEC "Uncharacterized protein" 0.333 0.271 0.555 2.6e-65
MGI|MGI:98662 630 Tec "tec protein tyrosine kina 0.333 0.271 0.544 3.3e-65
UNIPROTKB|F1PBW9 630 TEC "Uncharacterized protein" 0.333 0.271 0.538 6.8e-65
UNIPROTKB|F1MSH3 596 TEC "Uncharacterized protein" 0.333 0.286 0.538 6.8e-65
UNIPROTKB|P42680 631 TEC "Tyrosine-protein kinase T 0.333 0.270 0.538 1.1e-64
UNIPROTKB|F1S1L0 659 BTK "Uncharacterized protein" 0.329 0.256 0.551 2.9e-64
FB|FBgn0003502 Btk29A "Btk family kinase at 29A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 811 (290.5 bits), Expect = 8.5e-81, P = 8.5e-81
 Identities = 169/282 (59%), Positives = 206/282 (73%)

Query:   229 GKMPYGRLKNTEVVDR---VQRGIILEKPKAWYVGDMSRQR-AESILKQEDKEGCFVVRN 284
             G +P     N++  D    V+  + L   KA   GD+S ++ AE  +  + +E  + V++
Sbjct:   325 GGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKD 384

Query:   285 SSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSE--KHCCHSIPEVKDKEGCFVVRN 342
             +     Y       +P  +VK   +    R E+++ +  +    S+ +  DKEGCFVVR 
Sbjct:   385 ALGNVGY-------IPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRK 437

Query:   343 SSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLAS 402
             SSTKGLYTLSL+TKVP  HVKHYHIKQN+R E++LSEKHCC +IP+++NYHRHNSGGLA 
Sbjct:   438 SSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLAC 497

Query:   403 RLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVA--MMK 460
             RLK+SPCDRPVP TAGLSHDKWEI P ELML+EELGSGQFGVVRRGKWRGSID A  MMK
Sbjct:   498 RLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMK 557

Query:   461 EGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
             EGTMSEDDFIEEAKVMT+LQH NLVQLYGVCSKHRPIYIVT+
Sbjct:   558 EGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTE 599


GO:0004713 "protein tyrosine kinase activity" evidence=ISS;NAS;IDA
GO:0006468 "protein phosphorylation" evidence=ISS;NAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0007301 "female germline ring canal formation" evidence=IEP;IMP
GO:0008258 "head involution" evidence=IMP
GO:0045172 "germline ring canal" evidence=IDA;TAS
GO:0007485 "imaginal disc-derived male genitalia development" evidence=IMP;IDA
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0007619 "courtship behavior" evidence=NAS
GO:0007391 "dorsal closure" evidence=TAS
GO:0007254 "JNK cascade" evidence=TAS
GO:0007349 "cellularization" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0048477 "oogenesis" evidence=IMP
GO:0030723 "ovarian fusome organization" evidence=IMP
GO:0030717 "karyosome formation" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0007300 "ovarian nurse cell to oocyte transport" evidence=IMP
GO:0007435 "salivary gland morphogenesis" evidence=IMP
GO:0042023 "DNA endoreduplication" evidence=IMP
GO:0030833 "regulation of actin filament polymerization" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0046960 "sensitization" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
UNIPROTKB|F1SEA4 TEC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GR59 TEC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D4A596 Tec "Protein Tec" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZY8 TEC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:98662 Tec "tec protein tyrosine kinase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBW9 TEC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSH3 TEC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P42680 TEC "Tyrosine-protein kinase Tec" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1L0 BTK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
cd09934104 cd09934, SH2_Tec_family, Src homology 2 (SH2) doma 1e-44
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-42
cd05113 256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 4e-34
cd05114 256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 1e-31
cd05034 261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 5e-29
cd1176854 cd11768, SH3_Tec_like, Src Homology 3 domain of Te 2e-28
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-25
cd05068 261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-25
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 9e-25
cd10396108 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain 3e-24
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-23
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 1e-21
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-21
cd10399106 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain 1e-20
cd10397106 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain 3e-20
cd05070 260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 6e-20
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 7e-20
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 2e-19
cd10398106 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain 2e-19
cd10397106 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain 7e-19
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-18
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-18
pfam0001777 pfam00017, SH2, SH2 domain 4e-18
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 5e-18
cd05067 260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 5e-18
cd10398106 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain 7e-18
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 9e-18
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-17
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-17
cd1190556 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty 3e-17
smart0025284 smart00252, SH2, Src homology 2 domains 1e-16
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-16
cd05071 262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-16
cd05072 261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-16
cd05148 261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-16
smart0032656 smart00326, SH3, Src homology 3 domains 3e-16
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-14
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-14
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-14
cd05069 260 cd05069, PTKc_Yes, Catalytic domain of the Protein 3e-14
cd1190655 cd11906, SH3_BTK, Src Homology 3 domain of Bruton' 4e-14
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 6e-14
smart0025284 smart00252, SH2, Src homology 2 domains 1e-13
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 1e-13
pfam0001847 pfam00018, SH3_1, SH3 domain 1e-13
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-13
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 2e-13
cd1190856 cd11908, SH3_ITK, Src Homology 3 domain of Interle 4e-13
cd05040 257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 5e-13
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 5e-13
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 1e-12
cd05073 260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-12
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 1e-12
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 2e-12
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-12
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-12
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 4e-12
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 4e-12
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 5e-12
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 6e-12
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 7e-12
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 7e-12
cd1176551 cd11765, SH3_Nck_1, First Src Homology 3 domain of 9e-12
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 1e-11
cd1184953 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 1e-11
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 1e-11
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-11
pfam0001777 pfam00017, SH2, SH2 domain 2e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-11
cd1190755 cd11907, SH3_TXK, Src Homology 3 domain of TXK, al 2e-11
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-11
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 2e-11
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 6e-11
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 7e-11
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-10
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-10
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-10
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-10
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 2e-10
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 2e-10
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 2e-10
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-10
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 3e-10
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-10
cd05082 256 cd05082, PTKc_Csk, Catalytic domain of the Protein 4e-10
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 4e-10
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 5e-10
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 7e-10
pfam0001847 pfam00018, SH3_1, SH3 domain 8e-10
cd09933101 cd09933, SH2_Src_family, Src homology 2 (SH2) doma 9e-10
cd05060 257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-09
cd1200758 cd12007, SH3_Yes, Src homology 3 domain of Yes Pro 1e-09
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 1e-09
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-09
cd1190556 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty 2e-09
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-09
smart0032656 smart00326, SH3, Src homology 3 domains 2e-09
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-09
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 4e-09
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 4e-09
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 4e-09
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 4e-09
cd1036996 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain 5e-09
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 7e-09
cd09933101 cd09933, SH2_Src_family, Src homology 2 (SH2) doma 7e-09
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 8e-09
cd05053 293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 8e-09
cd1176454 cd11764, SH3_Eps8, Src Homology 3 domain of Epider 9e-09
cd1036996 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain 1e-08
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 1e-08
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 1e-08
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 1e-08
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 1e-08
cd09940102 cd09940, SH2_Vav_family, Src homology 2 (SH2) doma 1e-08
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 1e-08
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 1e-08
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 1e-08
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-08
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-08
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-08
cd05083 254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-08
cd1200456 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro 2e-08
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-08
cd1190359 cd11903, SH3_Nck2_3, Third Src Homology 3 domain o 2e-08
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 2e-08
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 2e-08
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 2e-08
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 3e-08
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 3e-08
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 3e-08
cd1200656 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn 3e-08
cd05055 302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 3e-08
cd1200954 cd12009, SH3_Blk, Src homology 3 domain of Blk Pro 3e-08
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 3e-08
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 4e-08
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 4e-08
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 4e-08
cd1034781 cd10347, SH2_Nterm_shark_like, N-terminal Src homo 6e-08
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 6e-08
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 7e-08
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 7e-08
cd1190856 cd11908, SH3_ITK, Src Homology 3 domain of Interle 9e-08
cd05036 277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 9e-08
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 9e-08
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 9e-08
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-07
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-07
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 1e-07
cd1175855 cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma 1e-07
cd1191155 cd11911, SH3_CIP4-like, Src Homology 3 domain of C 1e-07
cd1198553 cd11985, SH3_Stac2_C, C-terminal Src homology 3 do 1e-07
cd1176157 cd11761, SH3_FCHSD_1, First Src Homology 3 domain 1e-07
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 1e-07
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-07
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 2e-07
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 2e-07
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-07
cd1190457 cd11904, SH3_Nck1_3, Third Src Homology 3 domain o 2e-07
cd10343103 cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou 2e-07
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 2e-07
cd10367101 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain 2e-07
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 2e-07
cd10365101 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain 2e-07
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-07
cd1190655 cd11906, SH3_BTK, Src Homology 3 domain of Bruton' 3e-07
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 3e-07
cd10365101 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain 3e-07
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 3e-07
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 3e-07
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 3e-07
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 3e-07
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 3e-07
cd05107 401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 3e-07
cd09930104 cd09930, SH2_cSH2_p85_like, C-terminal Src homolog 3e-07
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 4e-07
cd05084 252 cd05084, PTKc_Fes, Catalytic domain of the Protein 4e-07
cd05032 277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 4e-07
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 4e-07
cd1200554 cd12005, SH3_Lck, Src homology 3 domain of Lck Pro 4e-07
cd1200856 cd12008, SH3_Src, Src homology 3 domain of Src Pro 4e-07
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 5e-07
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 5e-07
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 5e-07
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 5e-07
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 6e-07
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 6e-07
cd05105 400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 6e-07
cd10363104 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain 6e-07
cd1185555 cd11855, SH3_Sho1p, Src homology 3 domain of High 7e-07
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 7e-07
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-06
cd05099 314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-06
cd1035592 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma 1e-06
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-06
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 1e-06
cd0994598 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 1e-06
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 1e-06
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 1e-06
cd09929121 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom 1e-06
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 1e-06
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 1e-06
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-06
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 2e-06
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 2e-06
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-06
cd05066 267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-06
cd09940102 cd09940, SH2_Vav_family, Src homology 2 (SH2) doma 3e-06
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-06
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 3e-06
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3e-06
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 3e-06
cd10419101 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 3e-06
cd1189958 cd11899, SH3_Nck2_1, First Src Homology 3 domain o 3e-06
cd10366101 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain 3e-06
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 4e-06
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 4e-06
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 4e-06
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 5e-06
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 5e-06
cd10368101 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain 5e-06
cd10418101 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 5e-06
cd1207654 cd12076, SH3_Tks4_2, Second Src homology 3 domain 5e-06
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 6e-06
cd05092 280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 6e-06
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 6e-06
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 6e-06
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 6e-06
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 6e-06
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 7e-06
cd1190059 cd11900, SH3_Nck1_1, First Src Homology 3 domain o 7e-06
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 7e-06
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 8e-06
cd1190755 cd11907, SH3_TXK, Src Homology 3 domain of TXK, al 9e-06
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 9e-06
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 9e-06
cd05056 270 cd05056, PTKc_FAK, Catalytic domain of the Protein 1e-05
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 1e-05
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 1e-05
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 1e-05
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 1e-05
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 1e-05
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 1e-05
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 1e-05
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 2e-05
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 2e-05
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 2e-05
cd05100 334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 2e-05
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 2e-05
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2e-05
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 2e-05
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 2e-05
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 2e-05
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 2e-05
cd1180057 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src 2e-05
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 2e-05
cd10362101 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain 2e-05
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 3e-05
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-05
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 3e-05
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 3e-05
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 3e-05
cd05091 283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 3e-05
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 3e-05
cd05101 304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 3e-05
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 3e-05
cd1184758 cd11847, SH3_Brk, Src homology 3 domain of Brk (Br 3e-05
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 3e-05
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 4e-05
cd10366101 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain 4e-05
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 4e-05
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 4e-05
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 5e-05
cd10418101 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 5e-05
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 5e-05
cd05098 307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 6e-05
cd1178355 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain 6e-05
cd1184353 cd11843, SH3_PACSIN, Src homology 3 domain of Prot 6e-05
cd1037096 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai 6e-05
cd1188760 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a 6e-05
cd10344104 cd10344, SH2_SLAP, Src homology 2 domain found in 6e-05
cd1176551 cd11765, SH3_Nck_1, First Src Homology 3 domain of 7e-05
cd1200456 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro 7e-05
cd1198553 cd11985, SH3_Stac2_C, C-terminal Src homology 3 do 7e-05
cd1039198 cd10391, SH2_SHE, Src homology 2 domain found in S 7e-05
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 8e-05
cd0992381 cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom 9e-05
cd1185855 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain 9e-05
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 9e-05
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-04
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-04
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-04
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 1e-04
cd10363104 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain 1e-04
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 1e-04
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 1e-04
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 1e-04
cd1190255 cd11902, SH3_Nck2_2, Second Src Homology 3 domain 1e-04
cd1177557 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain 1e-04
cd1180853 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain 1e-04
cd1188854 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o 1e-04
cd1177755 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain 1e-04
cd10364101 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain 1e-04
cd1199252 cd11992, SH3_Intersectin2_3, Third Src homology 3 1e-04
cd1190155 cd11901, SH3_Nck1_2, Second Src Homology 3 domain 1e-04
cd1184953 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 2e-04
cd05050 288 cd05050, PTKc_Musk, Catalytic domain of the Protei 2e-04
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 2e-04
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 2e-04
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 2e-04
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 2e-04
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 2e-04
cd09927116 cd09927, SH2_Tensin_like, Src homology 2 domain fo 2e-04
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 2e-04
cd1202453 cd12024, SH3_NoxO1_2, Second or C-terminal Src hom 2e-04
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 2e-04
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 2e-04
cd1187353 cd11873, SH3_CD2AP-like_1, First Src Homology 3 do 2e-04
cd10367101 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain 3e-04
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 3e-04
cd10368101 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain 3e-04
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 3e-04
cd1201155 cd12011, SH3_SLAP2, Src homology 3 domain of Src-L 3e-04
cd1206957 cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rh 3e-04
cd1192557 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain 3e-04
cd09942110 cd09942, SH2_nSH2_p85_like, N-terminal Src homolog 3e-04
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 3e-04
cd1177452 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain 3e-04
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 3e-04
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 4e-04
cd10419101 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 4e-04
cd10344104 cd10344, SH2_SLAP, Src homology 2 domain found in 4e-04
cd10364101 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain 4e-04
cd1207257 cd12072, SH3_FNBP1L, Src Homology 3 domain of Form 4e-04
cd09938104 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src 4e-04
cd05115 257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 5e-04
cd1200758 cd12007, SH3_Yes, Src homology 3 domain of Yes Pro 5e-04
cd05062 277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 5e-04
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 5e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 5e-04
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 5e-04
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 5e-04
cd10388101 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo 5e-04
cd1188254 cd11882, SH3_GRAF-like, Src Homology 3 domain of G 5e-04
cd1176454 cd11764, SH3_Eps8, Src Homology 3 domain of Epider 6e-04
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 6e-04
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 6e-04
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 6e-04
cd1190359 cd11903, SH3_Nck2_3, Third Src Homology 3 domain o 7e-04
cd09925104 cd09925, SH2_SHC, Src homology 2 (SH2) domain foun 7e-04
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 7e-04
cd09942110 cd09942, SH2_nSH2_p85_like, N-terminal Src homolog 8e-04
cd1201654 cd12016, SH3_Tks_2, Second Src homology 3 domain o 8e-04
cd1206554 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPas 8e-04
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 9e-04
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 9e-04
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 9e-04
cd1198857 cd11988, SH3_Intersectin2_1, First Src homology 3 9e-04
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 9e-04
cd1185056 cd11850, SH3_Abl, Src homology 3 domain of the Pro 9e-04
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.001
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 0.001
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 0.001
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 0.001
cd05095 296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 0.001
cd1188854 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o 0.001
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 0.001
PLN00009 294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 0.001
cd10337136 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in 0.001
cd1206456 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase 0.001
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 0.001
cd05046 275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 0.002
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 0.002
cd1188760 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a 0.002
cd1199252 cd11992, SH3_Intersectin2_3, Third Src homology 3 0.002
cd1201753 cd12017, SH3_Tks_3, Third Src homology 3 domain of 0.002
cd1184855 cd11848, SH3_SLAP-like, Src homology 3 domain of S 0.002
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 0.002
cd09944108 cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom 0.002
cd10402105 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 0.002
cd1036190 cd10361, SH2_Fps_family, Src homology 2 (SH2) doma 0.002
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 0.002
cd1196955 cd11969, SH3_PLCgamma2, Src homology 3 domain of P 0.002
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 0.003
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 0.003
cd1192655 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain 0.003
cd1199956 cd11999, SH3_PACSIN_like, Src homology 3 domain of 0.003
cd1178455 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain 0.003
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 0.003
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 0.003
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 0.003
cd1200656 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn 0.004
cd1207654 cd12076, SH3_Tks4_2, Second Src homology 3 domain 0.004
cd10362101 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain 0.004
cd1039298 cd10392, SH2_SHF, Src homology 2 domain found in S 0.004
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 0.004
cd07846 286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 0.004
cd08217 265 cd08217, STKc_Nek2, Catalytic domain of the Protei 0.004
cd10358100 cd10358, SH2_PTK6_Brk, Src homology 2 domain found 0.004
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 0.004
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 0.004
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 0.004
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 0.004
cd0993798 cd09937, SH2_csk_like, Src homology 2 (SH2) domain 0.004
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 0.004
>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins Back     alignment and domain information
 Score =  152 bits (386), Expect = 1e-44
 Identities = 77/155 (49%), Positives = 88/155 (56%), Gaps = 59/155 (38%)

Query: 257 WYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPH-PHVKHYHIKQNSRG 315
           WYVGDMSRQRAES+LKQEDKEGCFVVRNSSTKGLYT+SL+TKVP  PHVKHYHIKQN+R 
Sbjct: 8   WYVGDMSRQRAESLLKQEDKEGCFVVRNSSTKGLYTVSLFTKVPGSPHVKHYHIKQNARS 67

Query: 316 EFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEF 375
           EF+L+EKHC  +IPE                               + +YH         
Sbjct: 68  EFYLAEKHCFETIPE-------------------------------LINYH--------- 87

Query: 376 FLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCD 410
                             +HNSGGLA+RLK   CD
Sbjct: 88  ------------------QHNSGGLATRLKYPVCD 104


The Tec protein tyrosine kinase is the founding member of a family that includes Btk, Itk, Bmx, and Txk. The members have a PH domain, a zinc-binding motif, a SH3 domain, a SH2 domain, and a protein kinase catalytic domain. Btk is involved in B-cell receptor signaling with mutations in Btk responsible for X-linked agammaglobulinemia (XLA) in humans and X-linked immunodeficiency (xid) in mice. Itk is involved in T-cell receptor signaling. Tec is expressed in both T and B cells, and is thought to function in activated and effector T lymphocytes to induce the expression of genes regulated by NFAT transcription factors. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 104

>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx Back     alignment and domain information
>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk Back     alignment and domain information
>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins Back     alignment and domain information
>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 Back     alignment and domain information
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) Back     alignment and domain information
>gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK Back     alignment and domain information
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins Back     alignment and domain information
>gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn Back     alignment and domain information
>gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins Back     alignment and domain information
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) Back     alignment and domain information
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains Back     alignment and domain information
>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins Back     alignment and domain information
>gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) Back     alignment and domain information
>gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family Back     alignment and domain information
>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin Back     alignment and domain information
>gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of Cdc42-Interacting Protein 4, Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn Back     alignment and domain information
>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor Protein 2 Back     alignment and domain information
>gnl|CDD|213002 cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rho GTPase-activating protein 27 Back     alignment and domain information
>gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins Back     alignment and domain information
>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins Back     alignment and domain information
>gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn Back     alignment and domain information
>gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding Protein 1-Like Back     alignment and domain information
>gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins Back     alignment and domain information
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 2 Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 Back     alignment and domain information
>gnl|CDD|212997 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains Back     alignment and domain information
>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor Proteins Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) Back     alignment and domain information
>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains Back     alignment and domain information
>gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) Back     alignment and domain information
>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in protein-tyrosine kinase-6 (PTK6) which is also known as breast tumor kinase (Brk) Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 513
KOG0197|consensus 468 100.0
KOG4278|consensus 1157 100.0
KOG0197|consensus468 99.95
KOG0615|consensus475 99.93
KOG0598|consensus357 99.92
KOG0581|consensus364 99.91
KOG0192|consensus362 99.91
KOG0595|consensus429 99.91
KOG0196|consensus996 99.91
KOG0194|consensus 474 99.9
KOG0198|consensus313 99.9
KOG0575|consensus592 99.89
KOG1025|consensus1177 99.89
KOG0592|consensus604 99.89
KOG0616|consensus355 99.89
KOG4721|consensus 904 99.88
KOG0599|consensus411 99.88
KOG0193|consensus678 99.88
KOG4226|consensus379 99.88
KOG1026|consensus774 99.87
KOG1095|consensus1025 99.87
KOG0578|consensus550 99.87
KOG0591|consensus375 99.86
KOG4278|consensus 1157 99.86
KOG0582|consensus516 99.86
KOG4257|consensus974 99.86
KOG0194|consensus474 99.86
KOG0610|consensus459 99.86
KOG0605|consensus550 99.85
KOG0588|consensus 786 99.85
KOG0199|consensus 1039 99.85
KOG0593|consensus396 99.84
KOG0661|consensus538 99.83
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.83
KOG0986|consensus591 99.83
KOG0583|consensus370 99.83
KOG1187|consensus361 99.82
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.82
KOG4279|consensus 1226 99.82
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.82
KOG0201|consensus467 99.81
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.81
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.81
KOG0200|consensus609 99.81
KOG0694|consensus694 99.81
KOG0667|consensus586 99.8
KOG0604|consensus400 99.8
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.8
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.8
KOG1024|consensus563 99.8
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.8
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.8
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.8
KOG0584|consensus632 99.8
KOG0597|consensus 808 99.8
KOG0589|consensus426 99.8
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.8
KOG0659|consensus318 99.8
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.8
PTZ00283496 serine/threonine protein kinase; Provisional 99.8
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.8
KOG0033|consensus355 99.8
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.8
KOG0600|consensus560 99.8
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.79
PHA02988283 hypothetical protein; Provisional 99.79
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.79
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.79
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.79
KOG0660|consensus359 99.79
KOG0984|consensus282 99.79
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.79
PTZ00267478 NIMA-related protein kinase; Provisional 99.79
KOG0594|consensus323 99.79
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.79
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.79
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.79
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.79
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.79
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.79
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.79
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.79
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.78
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.78
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.78
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.78
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.78
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.78
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.78
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.78
KOG0580|consensus281 99.78
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.78
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.78
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.78
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.78
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.78
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.78
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.77
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.77
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.77
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.77
KOG0611|consensus 668 99.77
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.77
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.77
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.77
KOG4717|consensus 864 99.77
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.77
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.77
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.77
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.77
KOG1094|consensus807 99.77
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.77
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.77
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.77
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.77
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.77
KOG0614|consensus732 99.77
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.77
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.77
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.76
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.76
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.76
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.76
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.76
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.76
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.76
KOG0608|consensus1034 99.76
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.76
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.76
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.76
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.76
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.76
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.76
KOG0607|consensus463 99.76
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.76
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.76
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.76
PTZ00284467 protein kinase; Provisional 99.75
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.75
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.75
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.75
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.75
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.75
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.75
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.75
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.75
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.75
KOG4250|consensus 732 99.75
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.75
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.75
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.75
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.75
KOG0983|consensus391 99.75
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.75
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.75
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.75
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.75
KOG0663|consensus419 99.75
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.74
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.74
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.74
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.74
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.74
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.74
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.74
KOG4645|consensus1509 99.74
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.74
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.74
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.74
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.74
PTZ00036440 glycogen synthase kinase; Provisional 99.74
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.74
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.74
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.74
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.74
KOG0577|consensus 948 99.74
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.74
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.74
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.74
PHA02882294 putative serine/threonine kinase; Provisional 99.74
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.74
KOG0603|consensus 612 99.74
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.73
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.73
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.73
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.73
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.73
KOG0585|consensus576 99.73
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.73
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.73
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.73
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.73
KOG0658|consensus364 99.73
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.73
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.73
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.73
KOG0696|consensus683 99.73
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.72
KOG0671|consensus415 99.72
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.72
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.72
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.72
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.72
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.72
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.72
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.72
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.72
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.72
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.72
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.72
PLN00181 793 protein SPA1-RELATED; Provisional 99.72
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.72
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.72
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.72
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.72
PHA03212391 serine/threonine kinase US3; Provisional 99.72
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.72
KOG0690|consensus516 99.71
PHA03209357 serine/threonine kinase US3; Provisional 99.71
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.71
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.71
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.71
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.71
KOG0612|consensus 1317 99.71
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.71
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.71
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.71
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.71
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.71
KOG0603|consensus612 99.71
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.71
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.71
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.71
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.71
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.71
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.71
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.71
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.71
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.71
PHA03207392 serine/threonine kinase US3; Provisional 99.7
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.7
KOG0032|consensus382 99.7
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.7
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.7
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.7
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.7
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.7
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.7
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.7
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.7
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.7
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.7
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.69
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.69
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.69
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.69
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.69
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.69
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.69
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.69
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.69
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.69
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.69
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.69
KOG0574|consensus502 99.69
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.69
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.68
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.68
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.68
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.68
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.68
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.68
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.68
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.68
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.68
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.68
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.68
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.68
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.68
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.68
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.68
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.68
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.68
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.68
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.67
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.67
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.67
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.67
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.67
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.67
KOG0579|consensus 1187 99.67
PHA03211461 serine/threonine kinase US3; Provisional 99.67
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.67
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.67
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.67
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.67
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.67
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.66
KOG0695|consensus593 99.66
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.66
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.66
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.66
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.66
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.66
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.66
KOG0665|consensus369 99.66
KOG0586|consensus596 99.66
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.66
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.66
KOG1989|consensus 738 99.66
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.65
KOG1006|consensus361 99.65
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.65
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.65
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.65
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.65
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.65
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.65
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.64
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.64
KOG1027|consensus903 99.64
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.64
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.64
KOG4236|consensus888 99.64
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.64
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.64
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.64
KOG0669|consensus376 99.64
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.64
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.64
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.64
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.64
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.64
KOG0596|consensus677 99.64
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.64
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.64
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.64
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.63
KOG1035|consensus 1351 99.63
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.63
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.63
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.63
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.63
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.63
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.63
KOG2052|consensus513 99.63
KOG2345|consensus302 99.63
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.63
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.63
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.62
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.62
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.62
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.62
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.62
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.62
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.62
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.61
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.61
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.61
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.61
PHA03210501 serine/threonine kinase US3; Provisional 99.61
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.61
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.61
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.61
PLN00009294 cyclin-dependent kinase A; Provisional 99.61
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.6
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.6
KOG0666|consensus438 99.6
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.6
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.6
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.59
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.59
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.59
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.59
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.59
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.59
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.59
KOG0664|consensus449 99.59
KOG0670|consensus752 99.59
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.58
KOG3653|consensus534 99.58
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.58
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.58
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.58
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.57
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.57
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.57
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.56
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.56
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.56
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.56
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.55
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.54
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.53
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.53
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.53
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.52
KOG0662|consensus292 99.51
KOG0595|consensus 429 99.5
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.48
KOG1151|consensus775 99.44
KOG1345|consensus378 99.43
KOG1290|consensus590 99.43
KOG1152|consensus772 99.4
KOG0192|consensus 362 99.39
KOG0587|consensus 953 99.38
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.37
KOG1167|consensus418 99.36
KOG0668|consensus338 99.35
PLN03224507 probable serine/threonine protein kinase; Provisio 99.35
KOG0615|consensus 475 99.32
KOG0600|consensus 560 99.31
KOG1026|consensus 774 99.31
KOG1187|consensus 361 99.3
KOG1094|consensus 807 99.27
KOG0575|consensus 592 99.24
KOG0196|consensus 996 99.23
KOG0663|consensus 419 99.22
KOG4257|consensus 974 99.21
KOG0605|consensus 550 99.2
KOG1095|consensus 1025 99.2
KOG0591|consensus 375 99.17
KOG0606|consensus 1205 99.16
KOG0581|consensus 364 99.16
KOG0580|consensus 281 99.15
KOG0593|consensus 396 99.15
KOG0597|consensus 808 99.15
KOG0598|consensus 357 99.12
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.12
KOG0195|consensus448 99.09
KOG0193|consensus 678 99.08
KOG0590|consensus601 99.07
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.06
KOG0659|consensus 318 99.06
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.06
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.05
KOG0574|consensus 502 99.04
KOG0611|consensus 668 99.04
KOG4721|consensus 904 99.04
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.04
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.04
KOG0661|consensus 538 99.04
KOG0576|consensus 829 99.03
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.02
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.02
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.02
KOG0585|consensus 576 99.02
KOG0032|consensus 382 99.02
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.01
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.01
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 98.99
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 98.99
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 98.99
PTZ00263 329 protein kinase A catalytic subunit; Provisional 98.99
KOG0616|consensus 355 98.99
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 98.98
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 98.98
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 98.97
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 98.97
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.97
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.96
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 98.96
KOG1164|consensus322 98.96
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 98.96
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 98.96
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.95
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 98.94
PLN00034 353 mitogen-activated protein kinase kinase; Provision 98.94
KOG0199|consensus 1039 98.94
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.94
KOG0582|consensus 516 98.93
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 98.93
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.93
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 98.93
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.93
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 98.93
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 98.92
KOG0577|consensus 948 98.92
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 98.92
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 98.91
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.91
KOG0586|consensus 596 98.91
KOG0198|consensus 313 98.91
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.9
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.9
KOG0583|consensus 370 98.9
KOG0694|consensus 694 98.9
KOG0610|consensus 459 98.89
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 98.89
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.89
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 98.89
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 98.89
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 98.88
KOG0201|consensus 467 98.88
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.88
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 98.88
PTZ00036 440 glycogen synthase kinase; Provisional 98.87
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 98.87
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.87
COG0515384 SPS1 Serine/threonine protein kinase [General func 98.87
>KOG0197|consensus Back     alignment and domain information
Probab=100.00  E-value=2.1e-34  Score=290.73  Aligned_cols=268  Identities=43%  Similarity=0.785  Sum_probs=223.0

Q ss_pred             CCCCcEEEEeccCCCCCCCCCCCCCCCE-EEEeecCCccceeeecC-CCccccccCCceeeccccccccccCCCCchhhh
Q psy17476        122 MIRPKVVVALYPFKAIEGGDLSLEKGAE-YEVMDDTQEHWWKVKDK-NGSVGYIPSNYVKEKELLGLQKYDDVNGLTLEL  199 (513)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~-~g~~g~~pp~~~~~~~~~~~~~~~~~~~~~~~~  199 (513)
                      ......++++|+|.+....+|.|.+|+. ..+.+.++..||.+++. .+..||+|.|++++..                 
T Consensus         8 ~~~~~~~valyd~~s~~~~dLsf~~Gd~~~~~~~~~~~~Ww~ar~~~~~~~g~ip~N~v~~~~-----------------   70 (468)
T KOG0197|consen    8 PSHETIVVALYDYASRTPEDLSFRKGDVVLILLETTNGDWWRARSLQLGQEGYIPSNYVARNR-----------------   70 (468)
T ss_pred             ccccceEEEeccccCCCccccccccCceEEEeeccCChhHHHHHHhhcCCCCcCcCceeeccc-----------------
Confidence            3445789999999999999999999999 88999999999998887 7889999999987531                 


Q ss_pred             hhhhcccccccccCccccceeeeeeeeecCCCCCCCCCcceeccccccccccCCCCCcCCCCCCHHHHHH-HHcCCCCCc
Q psy17476        200 IHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAES-ILKQEDKEG  278 (513)
Q Consensus       200 ~~~~i~~~~~~~~~Dvws~G~~l~el~t~g~~pf~~~~~~~~~~~i~~~~~~~~p~~w~~~~~~R~~aee-LL~~~~~~g  278 (513)
                                                   |..|+....                .++|+++.++|..|++ ++.+.+..|
T Consensus        71 -----------------------------~~~~~~~l~----------------~~~Wf~~~isR~~ae~~ll~p~~~~G  105 (468)
T KOG0197|consen   71 -----------------------------GSPAFIKLS----------------DEPWFFGKISREEAERQLLAPENKEG  105 (468)
T ss_pred             -----------------------------cCCCccccc----------------cCCchhccccHHHHHHhhcCCCCCcc
Confidence                                         222222111                1359999999999995 677788899


Q ss_pred             eEEEeecCC-CCceEEEEEeccCCCceeeEEEeeccccceecCCCccccChhhhhccCCcEEEEecCCCCcEEEEEEeee
Q psy17476        279 CFVVRNSST-KGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKV  357 (513)
Q Consensus       279 ~fliR~s~~-~~~~~lsl~~~~~~~~~~~~~i~~~~~g~~~~~~~~~~~~~~~~l~~~g~~LvR~s~~~~~~~lsv~~~~  357 (513)
                      .|+||++++ +++|++|++......                                                       
T Consensus       106 ~flvR~se~~~g~yslsv~~~~~~~-------------------------------------------------------  130 (468)
T KOG0197|consen  106 AFLVRESESDKGDYSLSVREGDSGG-------------------------------------------------------  130 (468)
T ss_pred             ceeeecccCCcCCeeEEEEeccccC-------------------------------------------------------
Confidence            999999964 999999987632111                                                       


Q ss_pred             CCCccceeEEEEcCCccEE--EecCcccCChhhhhhcccccCCCCccccCcCCCCC---CCCCcccCCCCccccCCcCce
Q psy17476        358 PHPHVKHYHIKQNSRGEFF--LSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDR---PVPATAGLSHDKWEIDPAELM  432 (513)
Q Consensus       358 ~~~~v~h~~I~~~~~~~~~--i~~~~~F~sl~eLi~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  432 (513)
                      ....+.||+|.+..++.++  +.+...|.++++++.||+.++.+++.++.. ++..   ..|+...+..+.|+++++.++
T Consensus       131 ~~~~v~hyri~~~~~~~~~~~~~~~~~F~~l~~lv~~~~~~~~gl~~~l~~-p~~~~~~~~p~~~~~~~d~wei~r~~l~  209 (468)
T KOG0197|consen  131 LGAKVKHYRIRQLDGGGLYPYIDERELFSSLQQLVNYYSKNADGLCTRLRD-PCSKQGHTKPQTPDLARDPWEIPREELK  209 (468)
T ss_pred             CccceeeeeeeEcCCCCeecCCCHHHhhhhHHHHHhhhhccCcchhhcccC-chhccCCCCCCCCccccCCeeecHHHHH
Confidence            1346788888887777666  888899999999999999999999988753 4433   556666677899999999999


Q ss_pred             eEeEecccccceEEEEEEeCceeeE--EeecCCCCHHHHHHHHHHHhcCCCCceeceeeEEEeCCeeEEEEccCCCC
Q psy17476        433 LLEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFR  507 (513)
Q Consensus       433 ~~~~lG~G~fG~V~~g~~~~~~~v~--~~k~~~~~~~~f~~E~~il~~l~HpNIV~l~g~~~~~~~~~lV~E~~~~G  507 (513)
                      +.+.||+|.||+|+.|.|++...|+  .+|......++|.+||+||++|+|+|||+|+|+|+.++++|||||||+.|
T Consensus       210 l~~~LG~G~FG~V~~g~~~~~~~vavk~ik~~~m~~~~f~~Ea~iMk~L~H~~lV~l~gV~~~~~piyIVtE~m~~G  286 (468)
T KOG0197|consen  210 LIRELGSGQFGEVWLGKWNGSTKVAVKTIKEGSMSPEAFLREAQIMKKLRHEKLVKLYGVCTKQEPIYIVTEYMPKG  286 (468)
T ss_pred             HHHHhcCCccceEEEEEEcCCCcccceEEeccccChhHHHHHHHHHHhCcccCeEEEEEEEecCCceEEEEEecccC
Confidence            9999999999999999999875554  56666777899999999999999999999999999999999999999998



>KOG4278|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
3gen_A 283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 2e-31
3k54_A 283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-31
3pix_A 274 Crystal Structure Of Btk Kinase Domain Complexed Wi 2e-30
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 1e-28
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 1e-28
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 2e-28
3ocs_A 271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 4e-28
3p08_A 267 Crystal Structure Of The Human Btk Kinase Domain Le 4e-28
3oct_A 265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 5e-28
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 8e-28
2ptk_A 453 Chicken Src Tyrosine Kinase Length = 453 1e-27
1k2p_A 263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 2e-26
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-23
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 3e-23
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 3e-23
3sxr_A 268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 3e-22
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 7e-22
1ad5_A 438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 7e-22
3t9t_A 267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 4e-20
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 2e-19
3qgw_A 286 Crystal Structure Of Itk Kinase Bound To An Inhibit 7e-19
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 5e-18
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 6e-18
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 6e-18
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 3e-16
2hwo_A 286 Crystal Structure Of Src Kinase Domain In Complex W 4e-16
2oiq_A 286 Crystal Structure Of Chicken C-Src Kinase Domain In 4e-16
3geq_A 286 Structural Basis For The Chemical Rescue Of Src Kin 4e-16
1yol_A 283 Crystal Structure Of Src Kinase Domain In Complex W 4e-16
1yoj_A 283 Crystal Structure Of Src Kinase Domain Length = 283 4e-16
3oez_A 286 Crystal Structure Of The L317i Mutant Of The Chicke 8e-16
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-15
3g6h_A 286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 2e-15
3svv_A 286 Crystal Structure Of T338c C-Src Covalently Bound T 2e-15
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 2e-15
2ekx_A110 Solution Structure Of The Human Bmx Sh2 Domain Leng 2e-15
2qq7_A 286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-15
2hz0_A 270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-15
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-15
3qri_A 277 The Crystal Structure Of Human Abl1 Kinase Domain I 3e-15
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 3e-15
2hyy_A 273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-15
2gqg_A 278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 3e-15
2hzi_A 277 Abl Kinase Domain In Complex With Pd180970 Length = 3e-15
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-15
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-15
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 3e-15
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 3e-15
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 3e-15
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 3e-15
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 3e-15
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 3e-15
2bdf_A 279 Src Kinase In Complex With Inhibitor Ap23451 Length 4e-15
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-14
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 1e-14
3bys_A 277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-14
2pl0_A 289 Lck Bound To Imatinib Length = 289 1e-14
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 1e-14
2of2_A 271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-14
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-14
3qrj_A 277 The Crystal Structure Of Human Abl1 Kinase Domain T 1e-14
2og8_A 265 Crystal Structure Of Aminoquinazoline 36 Bound To L 1e-14
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 1e-14
2ofu_A 273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 1e-14
3lck_A 271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 1e-14
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 1e-14
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 1e-14
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 1e-14
3bym_A 272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-14
2ge9_A125 Solution Structures Of The Sh2 Domain Of Bruton's T 2e-14
3gvu_A 292 The Crystal Structure Of Human Abl2 In Complex With 2e-14
3d7u_B 277 Structural Basis For The Recognition Of C-Src By It 2e-14
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-14
3a4o_X 286 Lyn Kinase Domain Length = 286 2e-14
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 3e-14
3mpm_A 267 Lck Complexed With A Pyrazolopyrimidine Length = 26 5e-14
3s9k_A118 Crystal Structure Of The Itk Sh2 Domain Length = 11 6e-14
3u4w_A 275 Src In Complex With Dna-Templated Macrocyclic Inhib 1e-13
1k9a_A 450 Crystal Structure Analysis Of Full-Length Carboxyl- 1e-13
1lui_A110 Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform 2e-13
2etz_A109 The Nmr Minimized Average Structure Of The Itk Sh2 2e-13
1yi6_A 276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-13
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 2e-13
2k79_B110 Solution Structure Of The Binary Complex Between Th 2e-13
1gl5_A67 Nmr Structure Of The Sh3 Domain From The Tec Protei 2e-13
2dm0_A125 Solution Structure Of The Sh2 Domain Of Human Tyros 3e-13
3bkb_A 377 Crystal Structure Of Human Feline Sarcoma Viral Onc 1e-11
3cd3_A 377 Crystal Structure Of Phosphorylated Human Feline Sa 1e-11
2hk5_A 270 Hck Kinase In Complex With Lck Targetted Inhibitor 3e-11
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 4e-11
3v5q_A 297 Discovery Of A Selective Trk Inhibitor With Efficac 8e-05
1qly_A58 Nmr Study Of The Sh3 Domain From Bruton's Tyrosine 4e-11
1aww_A67 Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 S 6e-11
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 8e-11
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 2e-05
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 8e-11
4gt5_A 306 Crystal Structure Of The Inactive Trka Kinase Domai 1e-05
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 9e-11
4f0i_A 300 Crystal Structure Of Apo Trka Length = 300 2e-05
2yuq_A85 Solution Structure Of The Sh3 Domain Of Human Tyros 2e-10
4id7_A 273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 5e-10
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 5e-10
4ewh_B 275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-10
3eqp_B 276 Crystal Structure Of Ack1 With Compound T95 Length 5e-10
4hzr_A 277 Crystal Structure Of Ack1 Kinase Domain Length = 27 5e-10
1u46_A 291 Crystal Structure Of The Unphosphorylated Kinase Do 6e-10
1u54_A 291 Crystal Structures Of The Phosphorylated And Unphos 6e-10
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 1e-09
4fl2_A636 Structural And Biophysical Characterization Of The 2e-09
4fl2_A 636 Structural And Biophysical Characterization Of The 1e-04
4fl3_A635 Structural And Biophysical Characterization Of The 2e-09
4fl3_A 635 Structural And Biophysical Characterization Of The 2e-04
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 2e-09
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 2e-09
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 2e-09
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 2e-09
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 2e-09
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 2e-09
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 2e-09
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 2e-09
2lmj_A66 Itk-Sh3 Length = 66 3e-09
1byg_A 278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 3e-09
3d7u_A 263 Structural Basis For The Recognition Of C-Src By It 3e-09
3d7t_A 269 Structural Basis For The Recognition Of C-Src By It 3e-09
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 5e-09
2ozo_A 613 Autoinhibited Intact Human Zap-70 Length = 613 7e-07
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 8e-09
1u59_A 287 Crystal Structure Of The Zap-70 Kinase Domain In Co 1e-04
1awj_A77 Intramolecular Itk-Proline Complex, Nmr, Minimized 2e-08
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-08
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-06
2k79_A63 Solution Structure Of The Binary Complex Between Th 3e-08
2rn8_A64 Nmr Structure Note: Murine Itk Sh3 Domain Length = 3e-08
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 5e-08
1fvr_A327 Tie2 Kinase Domain Length = 327 5e-08
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 5e-08
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 5e-08
2rei_A 318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 2e-04
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 9e-08
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 9e-08
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-07
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 1e-07
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-07
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 1e-07
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 5e-05
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 1e-07
4fnw_A 327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 6e-04
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-07
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 5e-05
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-07
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-07
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 1e-07
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-07
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 1e-07
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 1e-07
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 5e-05
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-07
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-07
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 1e-07
2yjr_A 342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 6e-04
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-07
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-04
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 1e-07
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-07
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 1e-07
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 1e-07
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-07
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 1e-07
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 1e-07
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 1e-07
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-07
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-07
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-07
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 1e-07
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 1e-07
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-07
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-04
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 2e-07
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 2e-07
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-04
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-07
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-04
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-07
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-04
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 2e-07
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 7e-06
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 2e-07
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 7e-06
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 2e-07
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 7e-06
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-07
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-06
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 2e-07
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 8e-06
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 2e-07
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 8e-06
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-07
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-06
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 2e-07
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-07
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-06
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 2e-07
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 2e-07
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 8e-06
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 2e-07
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-07
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 8e-06
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-07
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 8e-06
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 2e-07
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 8e-06
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 2e-07
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 8e-06
3h0h_A73 Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le 2e-07
1efn_A59 Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S 3e-07
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 5e-07
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 5e-07
2hda_A64 Yes Sh3 Domain Length = 64 6e-07
2yt6_A109 Solution Structure Of The Sh3_1 Domain Of Yamaguchi 7e-07
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 7e-07
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 4e-04
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 8e-07
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 8e-07
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 4e-04
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 9e-07
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 9e-07
4gt4_A 308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 2e-04
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 1e-06
3zzw_A 289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 2e-04
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 1e-06
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 2e-05
1wlp_B138 Solution Structure Of The P22phox-P47phox Complex L 1e-06
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 1e-06
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 2e-05
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 1e-06
3h0f_A73 Crystal Structure Of The Human Fyn Sh3 R96w Mutant 2e-06
4ag2_C84 Human Chymase - Fynomer Complex Length = 84 2e-06
3ua6_A64 Crystal Structure Of The Human Fyn Sh3 Domain Lengt 2e-06
1fyn_A62 Phosphotransferase Length = 62 2e-06
1m27_C61 Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX 2e-06
1a0n_B69 Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene 2e-06
1azg_B67 Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene 3e-06
3nhn_A193 Crystal Structure Of The Src-Family Kinase Hck Sh3- 3e-06
1shf_A59 Crystal Structure Of The Sh3 Domain In Human Fyn; C 3e-06
2ivs_A 314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 3e-06
4d8d_A58 Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant 3e-06
1avz_C57 V-1 Nef Protein In Complex With Wild Type Fyn Sh3 D 3e-06
2ivt_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-06
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 3e-06
3lvp_A 336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 2e-04
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 3e-06
1p4o_A 322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 3e-04
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 3e-06
3lw0_A 304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 2e-04
2ivv_A 314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-06
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 3e-06
1m7n_A 322 Crystal Structure Of Unactivated Apo Insulin-Like G 3e-04
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 3e-06
3i81_A 315 Crystal Structure Of Insulin-Like Growth Factor 1 R 3e-04
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 3e-06
1jqh_A 308 Igf-1 Receptor Kinase Domain Length = 308 3e-04
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 3e-06
3o23_A 305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 3e-04
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 3e-06
3d94_A 301 Crystal Structure Of The Insulin-Like Growth Factor 3e-04
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 3e-06
1k3a_A 299 Structure Of The Insulin-Like Growth Factor 1 Recep 3e-04
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 3e-06
2zm3_A 308 Complex Structure Of Insulin-Like Growth Factor Rec 3e-04
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 3e-06
3qqu_A 301 Cocrystal Structure Of Unphosphorylated Igf With Py 3e-04
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 3e-06
2oj9_A 307 Structure Of Igf-1r Kinase Domain Complexed With A 3e-04
3uf4_A164 Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P 3e-06
3uf4_A164 Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P 4e-05
1u5s_A71 Nmr Structure Of The Complex Between Nck-2 Sh3 Doma 4e-06
1g83_A165 Crystal Structure Of Fyn Sh3-Sh2 Length = 165 4e-06
1g83_A165 Crystal Structure Of Fyn Sh3-Sh2 Length = 165 2e-05
1g83_A165 Crystal Structure Of Fyn Sh3-Sh2 Length = 165 5e-05
2pzp_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-06
2fry_A61 Solution Structure Of The Third Sh3 Domain Of Human 4e-06
1wx6_A91 Solution Structure Of The Sh3 Domain Of The Human C 4e-06
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 5e-06
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 6e-06
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 6e-06
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 7e-06
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 7e-06
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 7e-06
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 7e-06
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 7e-06
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 7e-06
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 8e-06
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 8e-06
1uec_A193 Crystal Structure Of Autoinhibited Form Of Tandem S 9e-06
1ng2_A193 Structure Of Autoinhibited P47phox Length = 193 9e-06
1aot_F106 Nmr Structure Of The Fyn Sh2 Domain Complexed With 1e-05
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 1e-05
3qwy_A308 Ced-2 Length = 308 1e-05
2pvy_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
2pzr_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
3cly_A 334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 1e-05
2pvf_A 334 Crystal Structure Of Tyrosine Phosphorylated Activa 1e-05
2pwl_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
3qwx_X174 Ced-2 1-174 Length = 174 1e-05
2pz5_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-05
1a1a_A107 C-Src (Sh2 Domain With C188a Mutation) Complexed Wi 1e-05
1a1a_A107 C-Src (Sh2 Domain With C188a Mutation) Complexed Wi 4e-05
4h58_A 275 Braf In Complex With Compound 3 Length = 275 2e-05
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-05
2dly_A121 Solution Structure Of The Sh2 Domain Of Murine Fyn- 2e-05
2psq_A 370 Crystal Structure Of Unphosphorylated Unactivated W 2e-05
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 2e-05
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 2e-05
3b2t_A 311 Structure Of Phosphotransferase Length = 311 2e-05
1p14_A 306 Crystal Structure Of A Catalytic-Loop Mutant Of The 2e-05
3ri1_A 313 Crystal Structure Of The Catalytic Domain Of Fgfr2 2e-05
1gjo_A 316 The Fgfr2 Tyrosine Kinase Domain Length = 316 2e-05
4afz_C84 Human Chymase - Fynomer Complex Length = 84 2e-05
3ekk_A 307 Insulin Receptor Kinase Complexed With An Inhibitor 2e-05
1i44_A 306 Crystallographic Studies Of An Activation Loop Muta 2e-05
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2q0b_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-05
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
2py3_A 324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-05
1rqq_A 306 Crystal Structure Of The Insulin Receptor Kinase In 2e-05
1irk_A 306 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-05
1ir3_A 306 Phosphorylated Insulin Receptor Tyrosine Kinase In 2e-05
1x2q_A88 Solution Structure Of The Sh3 Domain Of The Signal 2e-05
1prl_C64 Two Binding Orientations For Peptides To Src Sh3 Do 3e-05
2z8c_A 303 Phosphorylated Insulin Receptor Tyrosine Kinase In 3e-05
1bkl_A113 Self-Associated Apo Src Sh2 Domain Length = 113 3e-05
1bkl_A113 Self-Associated Apo Src Sh2 Domain Length = 113 5e-04
1rjb_A 344 Crystal Structure Of Flt3 Length = 344 3e-05
4hck_A72 Human Hck Sh3 Domain, Nmr, 25 Structures Length = 7 3e-05
1bu1_A57 Src Family Kinase Hck Sh3 Domain Length = 57 3e-05
1ov3_A138 Structure Of The P22phox-P47phox Complex Length = 1 3e-05
1o4c_A108 Crystal Structure Of Sh2 In Complex With Phosphate. 3e-05
1o4c_A108 Crystal Structure Of Sh2 In Complex With Phosphate. 6e-05
1shd_A107 Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In 3e-05
1shd_A107 Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In 8e-05
4hxj_A60 Crystal Structure Of Sh3:rgt Complex Length = 60 3e-05
2oi3_A86 Nmr Structure Analysis Of The Hematopoetic Cell Kin 4e-05
1o41_A108 Crystal Structure Of Sh2 In Complex With Ru78300. L 4e-05
1o41_A108 Crystal Structure Of Sh2 In Complex With Ru78300. L 7e-05
3dtc_A 271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 4e-05
3hck_A107 Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domai 4e-05
1wa7_A65 Sh3 Domain Of Human Lyn Tyrosine Kinase Length = 65 4e-05
4afq_C85 Human Chymase - Fynomer Complex Length = 85 4e-05
1qwe_A64 C-Src Sh3 Domain Complexed With Ligand App12 Length 4e-05
4f59_A112 Triple Mutant Src Sh2 Domain Length = 112 4e-05
4f59_A112 Triple Mutant Src Sh2 Domain Length = 112 1e-04
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 5e-05
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 3e-04
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 5e-05
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 3e-04
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-05
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 3e-04
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 5e-05
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 3e-04
3tt0_A 382 Co-Structure Of Fibroblast Growth Factor Receptor 1 5e-05
1fgk_A 310 Crystal Structure Of The Tyrosine Kinase Domain Of 5e-05
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 5e-05
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 3e-04
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 5e-05
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 3e-04
1bkm_A113 Cocrystal Structure Of D-Amino Acid Substituted Pho 5e-05
1bkm_A113 Cocrystal Structure Of D-Amino Acid Substituted Pho 5e-04
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 5e-05
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 3e-04
3rhx_B 306 Crystal Structure Of The Catalytic Domain Of Fgfr1 5e-05
3fj5_A57 Crystal Structure Of The C-Src-Sh3 Domain Length = 5e-05
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 5e-05
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 4e-04
3c4f_A 302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 5e-05
3gql_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 5e-05
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-05
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 3e-04
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 5e-05
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 3e-04
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 5e-05
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 3e-04
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-05
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 3e-04
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 5e-05
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 4e-04
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 5e-05
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 3e-04
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 5e-05
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 3e-04
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 5e-05
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 3e-04
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 5e-05
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 3e-04
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 5e-05
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 3e-04
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 5e-05
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 3e-04
4f63_A 309 Crystal Structure Of Human Fibroblast Growth Factor 5e-05
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 5e-05
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 3e-04
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 5e-05
3js2_A 317 Crystal Structure Of Minimal Kinase Domain Of Fibro 5e-05
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 5e-05
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 4e-04
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 5e-05
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 4e-04
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 6e-05
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 4e-04
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 6e-05
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 4e-04
2l2p_A66 Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FR 6e-05
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 6e-05
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 4e-04
3kxx_A 317 Structure Of The Mutant Fibroblast Growth Factor Re 6e-05
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 6e-05
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 4e-04
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 6e-05
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 3e-04
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 6e-05
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 3e-04
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 6e-05
3gqi_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 6e-05
1lck_A175 Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K 6e-05
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 6e-05
4d8k_A175 Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc 6e-05
1uj0_A62 Crystal Structure Of Stam2 Sh3 Domain In Complex Wi 7e-05
2i0v_A 335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 7e-05
2i1m_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 7e-05
3bea_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 7e-05
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 7e-05
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 8e-05
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 8e-05
3lco_A 324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 8e-05
2ogv_A 317 Crystal Structure Of The Autoinhibited Human C-Fms 8e-05
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 9e-05
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 9e-05
2d8j_A77 Solution Structure Of The Sh3 Domain Of Fyn-Related 9e-05
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 9e-05
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 9e-05
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 9e-05
3lcd_A 329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 9e-05
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 9e-05
2g15_A318 Structural Characterization Of Autoinhibited C-Met 9e-05
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 9e-05
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 9e-05
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-05
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 9e-05
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-05
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 9e-05
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 9e-05
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-04
1skj_A113 Cocrystal Structure Of Urea-Substituted Phosphopept 1e-04
1skj_A113 Cocrystal Structure Of Urea-Substituted Phosphopept 5e-04
1sha_A104 Crystal Structure Of The Phosphotyrosine Recognitio 1e-04
1sha_A104 Crystal Structure Of The Phosphotyrosine Recognitio 6e-04
1p13_A102 Crystal Structure Of The Src Sh2 Domain Complexed W 1e-04
1p13_A102 Crystal Structure Of The Src Sh2 Domain Complexed W 6e-04
1wxb_A68 Solution Structure Of The Sh3 Domain From Human Epi 1e-04
1is0_A106 Crystal Structure Of A Complex Of The Src Sh2 Domai 1e-04
1is0_A106 Crystal Structure Of A Complex Of The Src Sh2 Domai 6e-04
1nzl_A103 Crystal Structure Of Src Sh2 Domain Bound To Doubly 1e-04
1nzl_A103 Crystal Structure Of Src Sh2 Domain Bound To Doubly 7e-04
1kc2_A103 Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c 1e-04
1kc2_A103 Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c 8e-04
2l0a_A72 Solution Nmr Structure Of Signal Transducing Adapte 1e-04
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-04
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 1e-04
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 1e-04
2k2m_A68 Structural Basis Of Pxxdy Motif Recognition In Sh3 1e-04
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 1e-04
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 1e-04
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 1e-04
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 1e-04
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-04
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-04
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-04
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 2e-04
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-04
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-04
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 2e-04
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 2e-04
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-04
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-04
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 2e-04
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 4e-04
2jxb_A86 Structure Of Cd3epsilon-Nck2 First Sh3 Domain Compl 2e-04
2lqn_A303 Solution Structure Of Crkl Length = 303 2e-04
2lqw_A303 Solution Structure Of Phosphorylated Crkl Length = 2e-04
2jw4_A72 Nmr Solution Structure Of The N-Terminal Sh3 Domain 2e-04
2b86_A67 Solution Structure Of The First Src Homology 3 Doma 2e-04
3cqt_A79 N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 2e-04
1f1w_A104 Src Sh2 Thref1trp Mutant Complexed With The Phospho 3e-04
1gri_A217 Grb2 Length = 217 3e-04
2js2_A63 Solution Structure Of First Sh3 Domain Of Adaptor N 3e-04
1x27_A167 Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S 4e-04
3reb_B90 Hiv-1 Nef Protein In Complex With Engineered Hck-Sh 4e-04
1bmb_A123 Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 5e-04
3n84_A112 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-04
1fhs_A112 The Three-Dimensional Solution Structure Of The Src 5e-04
3rbb_B61 Hiv-1 Nef Protein In Complex With Engineered Hck Sh 5e-04
2vwf_A58 Grb2 Sh3c (2) Length = 58 5e-04
3ove_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-04
3imd_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-04
1uhf_A69 Solution Structure Of The Third Sh3 Domain Of Human 5e-04
3gf9_A295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 5e-04
2aoa_A99 Crystal Structures Of A High-affinity Macrocyclic P 6e-04
2d8h_A80 Solution Structure Of The Sh3 Domain Of Hypothetica 6e-04
1zfp_E98 Growth Factor Receptor Binding Protein Sh2 Domain C 6e-04
1tze_E98 Signal Transduction Adaptor Growth Factor, Grb2 Sh2 6e-04
3mxc_A101 Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp 6e-04
2h46_E116 Native Domain-Swapped Dimer Crystal Structure Of Th 6e-04
2dl4_A68 Solution Structure Of The First Sh3 Domain Of Stac 6e-04
1bm2_A117 Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet 6e-04
1fyr_A114 Dimer Formation Through Domain Swapping In The Crys 6e-04
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 6e-04
1h92_A63 Sh3 Domain Of Human Lck Tyrosine Kinase Length = 63 6e-04
2a08_A60 Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 7e-04
2iim_A62 Sh3 Domain Of Human Lck Length = 62 7e-04
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 7e-04
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 7e-04
2y4i_B 319 Ksr2-Mek1 Heterodimer Length = 319 7e-04
2l3s_A163 Structure Of The Autoinhibited Crk Length = 163 8e-04
1oot_A60 Crystal Structure Of The Sh3 Domain From A S. Cerev 8e-04
2rol_A64 Structural Basis Of Pxxdy Motif Recognition In Sh3 9e-04
1kik_A57 Sh3 Domain Of Lymphocyte Specific Kinase (Lck) Leng 9e-04
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure

Iteration: 1

Score = 134 bits (336), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 61/94 (64%), Positives = 76/94 (80%), Gaps = 2/94 (2%) Query: 411 RPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDD 468 + P+TAGL + WEIDP +L L+ELG+GQFGVV+ GKWRG DVA M+KEG+MSED+ Sbjct: 6 KNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDE 65 Query: 469 FIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTD 502 FIEEAKVM L H+ LVQLYGVC+K RPI+I+T+ Sbjct: 66 FIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITE 99
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2EKX|A Chain A, Solution Structure Of The Human Bmx Sh2 Domain Length = 110 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2GE9|A Chain A, Solution Structures Of The Sh2 Domain Of Bruton's Tyrosine Kinase Length = 125 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|3S9K|A Chain A, Crystal Structure Of The Itk Sh2 Domain Length = 118 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|1LUI|A Chain A, Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform, Ensemble Of 20 Low Energy Structures Length = 110 Back     alignment and structure
>pdb|2ETZ|A Chain A, The Nmr Minimized Average Structure Of The Itk Sh2 Domain Bound To A Phosphopeptide Length = 109 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2K79|B Chain B, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 110 Back     alignment and structure
>pdb|1GL5|A Chain A, Nmr Structure Of The Sh3 Domain From The Tec Protein Tyrosine Kinase Length = 67 Back     alignment and structure
>pdb|2DM0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Tyrosine- Protein Kinase Txk Length = 125 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|1QLY|A Chain A, Nmr Study Of The Sh3 Domain From Bruton's Tyrosine Kinase, 20 Structures Length = 58 Back     alignment and structure
>pdb|1AWW|A Chain A, Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 Structures Length = 67 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|2YUQ|A Chain A, Solution Structure Of The Sh3 Domain Of Human Tyrosine- Protein Kinase ItkTSK Length = 85 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|2LMJ|A Chain A, Itk-Sh3 Length = 66 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1AWJ|A Chain A, Intramolecular Itk-Proline Complex, Nmr, Minimized Average Structure Length = 77 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|2K79|A Chain A, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 63 Back     alignment and structure
>pdb|2RN8|A Chain A, Nmr Structure Note: Murine Itk Sh3 Domain Length = 64 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 Back     alignment and structure
>pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2HDA|A Chain A, Yes Sh3 Domain Length = 64 Back     alignment and structure
>pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|1WLP|B Chain B, Solution Structure Of The P22phox-P47phox Complex Length = 138 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 Back     alignment and structure
>pdb|4AG2|C Chain C, Human Chymase - Fynomer Complex Length = 84 Back     alignment and structure
>pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 Back     alignment and structure
>pdb|1FYN|A Chain A, Phosphotransferase Length = 62 Back     alignment and structure
>pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 Back     alignment and structure
>pdb|1A0N|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3- Kinase, Family Of 25 Structures Length = 69 Back     alignment and structure
>pdb|1AZG|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3-Kinase, Minimized Average (Probmap) Structure Length = 67 Back     alignment and structure
>pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 Back     alignment and structure
>pdb|1SHF|A Chain A, Crystal Structure Of The Sh3 Domain In Human Fyn; Comparison Of The Three-Dimensional Structures Of Sh3 Domains In Tyrosine Kinases And Spectrin Length = 59 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|4D8D|A Chain A, Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant Length = 58 Back     alignment and structure
>pdb|1AVZ|C Chain C, V-1 Nef Protein In Complex With Wild Type Fyn Sh3 Domain Length = 57 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 Back     alignment and structure
>pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 Back     alignment and structure
>pdb|1U5S|A Chain A, Nmr Structure Of The Complex Between Nck-2 Sh3 Domain And Pinch-1 Lim4 Domain Length = 71 Back     alignment and structure
>pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 Back     alignment and structure
>pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 Back     alignment and structure
>pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2FRY|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Nck2 Adaptor Protein Length = 61 Back     alignment and structure
>pdb|1WX6|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Cytoplasmic Protein Nck2 Length = 91 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|1UEC|A Chain A, Crystal Structure Of Autoinhibited Form Of Tandem Sh3 Domain Of P47phox Length = 193 Back     alignment and structure
>pdb|1NG2|A Chain A, Structure Of Autoinhibited P47phox Length = 193 Back     alignment and structure
>pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|3QWY|A Chain A, Ced-2 Length = 308 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3QWX|X Chain X, Ced-2 1-174 Length = 174 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 Back     alignment and structure
>pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|4AFZ|C Chain C, Human Chymase - Fynomer Complex Length = 84 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 Back     alignment and structure
>pdb|1PRL|C Chain C, Two Binding Orientations For Peptides To Src Sh3 Domain: Development Of A General Model For Sh3-Ligand Interactions Length = 64 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 Back     alignment and structure
>pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|4HCK|A Chain A, Human Hck Sh3 Domain, Nmr, 25 Structures Length = 72 Back     alignment and structure
>pdb|1BU1|A Chain A, Src Family Kinase Hck Sh3 Domain Length = 57 Back     alignment and structure
>pdb|1OV3|A Chain A, Structure Of The P22phox-P47phox Complex Length = 138 Back     alignment and structure
>pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 Back     alignment and structure
>pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 Back     alignment and structure
>pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 Back     alignment and structure
>pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 Back     alignment and structure
>pdb|4HXJ|A Chain A, Crystal Structure Of Sh3:rgt Complex Length = 60 Back     alignment and structure
>pdb|2OI3|A Chain A, Nmr Structure Analysis Of The Hematopoetic Cell Kinase Sh3 Domain Complexed With An Artificial High Affinity Ligand (Pd1) Length = 86 Back     alignment and structure
>pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 Back     alignment and structure
>pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3HCK|A Chain A, Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domain, 20 Structures Length = 107 Back     alignment and structure
>pdb|4AFQ|C Chain C, Human Chymase - Fynomer Complex Length = 85 Back     alignment and structure
>pdb|1QWE|A Chain A, C-Src Sh3 Domain Complexed With Ligand App12 Length = 64 Back     alignment and structure
>pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 Back     alignment and structure
>pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 Back     alignment and structure
>pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3FJ5|A Chain A, Crystal Structure Of The C-Src-Sh3 Domain Length = 57 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|2L2P|A Chain A, Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FROM NMR RELAXATION Dispersion Experiments Length = 66 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 Back     alignment and structure
>pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|2D8J|A Chain A, Solution Structure Of The Sh3 Domain Of Fyn-Related Kinase Length = 77 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 Back     alignment and structure
>pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 Back     alignment and structure
>pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 Back     alignment and structure
>pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 Back     alignment and structure
>pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 Back     alignment and structure
>pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 Back     alignment and structure
>pdb|1WXB|A Chain A, Solution Structure Of The Sh3 Domain From Human Epidermal Growth Factor Receptor Pathway Substrate 8-Like Protein Length = 68 Back     alignment and structure
>pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 Back     alignment and structure
>pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 Back     alignment and structure
>pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 Back     alignment and structure
>pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 Back     alignment and structure
>pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 Back     alignment and structure
>pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 Back     alignment and structure
>pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|2K2M|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 68 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2JXB|A Chain A, Structure Of Cd3epsilon-Nck2 First Sh3 Domain Complex Length = 86 Back     alignment and structure
>pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 Back     alignment and structure
>pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 Back     alignment and structure
>pdb|2JW4|A Chain A, Nmr Solution Structure Of The N-Terminal Sh3 Domain Of Human Nckalpha Length = 72 Back     alignment and structure
>pdb|2B86|A Chain A, Solution Structure Of The First Src Homology 3 Domain Of Nck2 Length = 67 Back     alignment and structure
>pdb|3CQT|A Chain A, N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 Back     alignment and structure
>pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|2JS2|A Chain A, Solution Structure Of First Sh3 Domain Of Adaptor Nck Length = 63 Back     alignment and structure
>pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 Back     alignment and structure
>pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 Back     alignment and structure
>pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 Back     alignment and structure
>pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 Back     alignment and structure
>pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 Back     alignment and structure
>pdb|3RBB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck Sh3 Domain Length = 61 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 Back     alignment and structure
>pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 Back     alignment and structure
>pdb|1UHF|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Intersectin 2(Kiaa1256) Length = 69 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 Back     alignment and structure
>pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 Back     alignment and structure
>pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 Back     alignment and structure
>pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 Back     alignment and structure
>pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 Back     alignment and structure
>pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 Back     alignment and structure
>pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 Back     alignment and structure
>pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 Back     alignment and structure
>pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|1H92|A Chain A, Sh3 Domain Of Human Lck Tyrosine Kinase Length = 63 Back     alignment and structure
>pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 Back     alignment and structure
>pdb|2IIM|A Chain A, Sh3 Domain Of Human Lck Length = 62 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 Back     alignment and structure
>pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 Back     alignment and structure
>pdb|2ROL|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 64 Back     alignment and structure
>pdb|1KIK|A Chain A, Sh3 Domain Of Lymphocyte Specific Kinase (Lck) Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-65
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-17
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-14
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 7e-14
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-63
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-17
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-13
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-62
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 6e-18
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-17
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-13
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-09
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-60
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-19
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-14
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-13
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 5e-60
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-20
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-14
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-57
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-19
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-16
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-13
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 5e-49
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-18
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 8e-18
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-17
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-13
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-44
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 4e-21
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-15
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 7e-40
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 3e-17
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-10
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 9e-39
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-20
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-15
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 5e-38
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-21
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-15
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 6e-38
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 3e-21
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 9e-16
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-37
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 8e-21
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-14
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 3e-37
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-20
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-15
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-36
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-20
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-14
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 2e-35
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-20
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 3e-14
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-34
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-19
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 7e-15
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 2e-32
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 3e-19
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 3e-11
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-32
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-20
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 8e-16
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-32
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-15
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-15
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 7e-32
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 9e-20
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 4e-15
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 1e-31
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 7e-19
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-16
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 2e-31
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 4e-20
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 6e-12
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 2e-30
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 4e-12
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-09
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 2e-30
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-19
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-15
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-30
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 5e-18
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-12
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 8e-30
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 9e-21
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-14
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 1e-29
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-16
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 8e-16
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 4e-29
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 5e-19
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-09
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-28
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-15
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-14
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 2e-28
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 6e-17
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 3e-10
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 3e-28
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 5e-20
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 9e-15
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-28
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 2e-19
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 5e-16
4aoj_A 329 High affinity nerve growth factor receptor; transf 8e-28
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-19
4aoj_A329 High affinity nerve growth factor receptor; transf 2e-11
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-27
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-18
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 3e-13
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-27
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 1e-15
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-15
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 4e-27
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-27
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 9e-12
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-09
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 5e-27
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-11
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 9e-09
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 8e-27
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 7e-18
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 8e-10
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-26
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 6e-18
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 8e-14
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 2e-26
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-18
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-11
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 2e-26
3lzb_A327 Epidermal growth factor receptor; epidermal growth 3e-20
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-16
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 2e-26
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 3e-25
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 3e-26
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 2e-14
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 6e-26
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-17
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 4e-11
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 9e-26
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 3e-17
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 8e-12
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 2e-25
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-17
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 7e-12
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-25
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-18
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-12
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-25
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 6e-19
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 7e-11
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 2e-25
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-10
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-08
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 2e-25
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-16
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 5e-10
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-25
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-15
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 2e-15
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 3e-25
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 5e-25
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 4e-17
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 3e-10
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 5e-25
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 6e-25
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-24
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 1e-13
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 2e-24
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 1e-23
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-24
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-07
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-06
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 3e-24
3poz_A327 Epidermal growth factor receptor; kinase domain, a 6e-19
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-15
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 5e-24
2xir_A316 Vascular endothelial growth factor receptor 2; ang 8e-17
2xir_A316 Vascular endothelial growth factor receptor 2; ang 8e-11
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-24
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 1e-09
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-08
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 7e-24
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 1e-14
1awj_A77 ITK; transferase, regulatory intramolecular comple 7e-24
1awj_A77 ITK; transferase, regulatory intramolecular comple 5e-14
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 2e-23
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 2e-21
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 2e-23
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 4e-23
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 7e-21
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 5e-23
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 1e-16
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 2e-09
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 5e-23
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 5e-18
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 9e-12
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 3e-22
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 9e-21
2dly_A121 FYN-related kinase; BRK family kinase, structural 3e-22
2dly_A121 FYN-related kinase; BRK family kinase, structural 6e-20
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 3e-22
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 9e-13
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 3e-22
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 4e-22
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 1e-13
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 4e-22
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 5e-20
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 5e-22
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 4e-20
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 5e-22
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 3e-20
3maz_A125 Signal-transducing adaptor protein 1; modular doma 6e-22
3maz_A125 Signal-transducing adaptor protein 1; modular doma 2e-20
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 6e-22
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-20
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 1e-21
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 1e-12
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 1e-20
3pls_A 298 Macrophage-stimulating protein receptor; protein k 2e-20
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-18
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-14
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-20
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-07
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-05
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 2e-20
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 7e-20
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-17
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 7e-16
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 2e-20
1wxb_A68 Epidermal growth factor receptor pathway substrate 3e-20
1wxb_A68 Epidermal growth factor receptor pathway substrate 6e-12
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 3e-20
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 7e-12
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 3e-20
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 4e-20
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 4e-20
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-20
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-07
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 9e-06
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 5e-20
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 3e-12
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 5e-20
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 7e-20
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 1e-11
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 8e-20
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 4e-18
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 9e-18
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 8e-17
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 8e-20
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 1e-19
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 2e-19
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 4e-19
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 3e-19
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 1e-17
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 4e-13
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 4e-19
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-17
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 8e-13
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 5e-19
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 6e-19
1i07_A60 Epidermal growth factor receptor kinase substrate 7e-19
1i07_A60 Epidermal growth factor receptor kinase substrate 3e-11
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 8e-19
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 1e-10
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 9e-19
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-06
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-06
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 1e-18
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 1e-18
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 1e-18
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 2e-18
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 3e-18
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-14
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-09
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 5e-08
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 4e-18
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 3e-14
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 6e-18
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 4e-10
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 6e-18
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 6e-18
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 4e-16
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 2e-17
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 2e-17
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 2e-17
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 3e-17
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-13
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 3e-17
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 3e-17
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 1e-16
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 3e-11
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 5e-10
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 9e-07
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 1e-16
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 2e-16
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 2e-13
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 2e-16
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 3e-15
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 2e-16
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 4e-16
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 2e-16
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 3e-16
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 5e-15
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 7e-16
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 7e-16
2aug_A126 Growth factor receptor-bound protein 14; phosphory 9e-16
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 2e-15
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 6e-15
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 3e-09
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 2e-15
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 3e-15
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 7e-08
2cuc_A70 SH3 domain containing ring finger 2; structural ge 3e-15
2cuc_A70 SH3 domain containing ring finger 2; structural ge 2e-07
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 4e-15
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 2e-12
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 4e-15
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 1e-09
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 4e-15
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 1e-07
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 5e-15
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 5e-15
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 1e-07
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 5e-15
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 8e-08
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 6e-15
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 5e-07
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 6e-15
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 1e-07
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 6e-15
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 7e-15
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 8e-15
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 4e-07
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 1e-14
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 5e-07
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 1e-14
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 6e-13
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 1e-14
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 1e-14
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 1e-14
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 5e-13
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 2e-14
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 2e-13
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 2e-14
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 2e-14
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 1e-12
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 3e-14
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 1e-06
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 3e-14
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 5e-14
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 5e-14
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 2e-12
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 6e-14
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-11
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-11
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 2e-10
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-08
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 5e-04
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 7e-14
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 7e-04
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 7e-14
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 5e-11
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 9e-14
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 3e-05
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 1e-13
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 1e-13
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 2e-11
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 1e-13
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 6e-08
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 2e-13
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 2e-06
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 3e-13
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 3e-07
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 5e-13
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 9e-12
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 7e-13
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 2e-05
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 7e-13
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 4e-06
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 8e-13
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 7e-06
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 1e-12
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 3e-06
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 1e-12
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 2e-06
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 1e-12
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 7e-06
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 2e-12
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 2e-05
2dil_A69 Proline-serine-threonine phosphatase-interacting p 2e-12
2dil_A69 Proline-serine-threonine phosphatase-interacting p 1e-05
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 2e-12
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 2e-12
2vif_A141 Suppressor of cytokine signalling 6; growth regula 2e-12
2vif_A141 Suppressor of cytokine signalling 6; growth regula 2e-10
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 2e-12
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 4e-06
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 3e-12
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 5e-06
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 3e-12
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 4e-06
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 3e-12
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 3e-12
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 4e-07
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 3e-12
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 1e-05
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 3e-12
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 3e-06
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 4e-12
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 2e-06
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 4e-12
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 4e-05
1uti_A58 GRB2-related adaptor protein 2; signaling protein 4e-12
1uti_A58 GRB2-related adaptor protein 2; signaling protein 7e-07
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 5e-12
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 3e-05
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 6e-12
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 3e-05
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 7e-12
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 1e-06
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 8e-12
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 8e-06
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 9e-12
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 2e-06
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 9e-12
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 1e-10
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 9e-12
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 3e-07
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 1e-11
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 3e-06
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 1e-11
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 1e-06
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 1e-11
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 1e-06
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 1e-11
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 3e-06
3soc_A 322 Activin receptor type-2A; structural genomics cons 1e-11
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-11
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 7e-04
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 1e-11
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 2e-11
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 1e-07
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 2e-11
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 2e-11
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 1e-05
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 2e-11
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 1e-06
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 2e-11
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 3e-10
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 2e-11
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 2e-05
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 2e-11
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 7e-06
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 2e-11
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 3e-11
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 5e-07
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 3e-11
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 3e-11
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 4e-09
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-11
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-11
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 3e-11
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 4e-11
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 6e-05
2j6f_A62 CD2-associated protein; metal-binding, immune resp 4e-11
2j6f_A62 CD2-associated protein; metal-binding, immune resp 3e-04
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 4e-11
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 4e-05
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 4e-11
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 1e-04
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 5e-11
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 5e-11
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 5e-05
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 5e-11
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 5e-11
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 2e-04
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 6e-11
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 4e-05
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 7e-11
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 7e-11
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 7e-11
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 3e-05
3q4u_A 301 Activin receptor type-1; structural genomics conso 8e-11
3q4u_A301 Activin receptor type-1; structural genomics conso 8e-04
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 8e-11
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-04
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 9e-11
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-04
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 9e-11
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 1e-04
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 9e-11
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 9e-11
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 2e-04
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 1e-10
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 1e-10
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 2e-04
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 1e-10
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 1e-10
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 6e-06
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 1e-10
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 8e-05
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 1e-10
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 1e-05
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 1e-10
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 2e-05
3u23_A65 CD2-associated protein; structural genomics, struc 1e-10
3u23_A65 CD2-associated protein; structural genomics, struc 3e-04
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 1e-10
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 2e-04
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-10
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 9e-05
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 2e-10
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 3e-04
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-10
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 3e-10
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 3e-10
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 3e-04
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 4e-10
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 2e-04
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 4e-10
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 4e-10
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 4e-10
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 1e-05
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 4e-10
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 2e-04
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 4e-10
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 1e-04
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 4e-10
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 5e-10
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 7e-04
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 5e-10
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 1e-07
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 1e-06
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 9e-04
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 5e-10
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 5e-10
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 3e-05
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 5e-10
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 6e-10
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 7e-04
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 6e-10
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-04
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 7e-10
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 7e-05
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 7e-10
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 2e-05
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 7e-10
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 8e-10
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 7e-05
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 8e-10
3bhy_A 283 Death-associated protein kinase 3; death associate 8e-10
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 9e-10
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 1e-09
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 1e-09
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 5e-04
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 1e-09
2da9_A70 SH3-domain kinase binding protein 1; structural ge 1e-09
2da9_A70 SH3-domain kinase binding protein 1; structural ge 3e-04
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 1e-09
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 1e-09
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 8e-05
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 1e-09
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 2e-09
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 1e-04
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 2e-09
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 1e-04
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 2e-09
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 2e-09
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 2e-09
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 2e-09
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 2e-09
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 2e-09
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 3e-04
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 2e-09
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 3e-04
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 2e-09
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 2e-09
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 4e-04
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 3e-09
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 3e-09
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 3e-09
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 3e-09
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 4e-04
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 3e-09
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 3e-09
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 4e-09
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 5e-04
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 4e-09
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 6e-09
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 6e-09
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 1e-04
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 6e-09
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 7e-09
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 8e-09
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 1e-08
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 1e-08
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-08
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 2e-08
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 2e-08
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 2e-08
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 6e-04
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 2e-08
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 3e-08
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 3e-08
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 1e-05
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 3e-08
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 1e-04
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 4e-08
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 5e-08
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 6e-08
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 9e-08
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 1e-07
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 3e-07
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 4e-07
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 5e-07
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 5e-07
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 5e-07
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 5e-07
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 8e-07
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 8e-07
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 1e-06
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 4e-04
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 2e-06
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-06
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 4e-06
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-06
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 5e-06
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 5e-06
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 3e-04
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-06
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 7e-06
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 8e-06
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 8e-06
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 9e-06
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 9e-06
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 9e-06
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 1e-05
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-05
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-05
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-05
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 2e-05
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-05
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-05
3aln_A 327 Dual specificity mitogen-activated protein kinase; 3e-05
1u3o_A82 Huntingtin-associated protein-interacting protein; 3e-05
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 3e-05
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 3e-05
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-05
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 3e-05
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 4e-05
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 4e-05
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 4e-05
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 4e-05
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 5e-05
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 5e-05
2dyl_A 318 Dual specificity mitogen-activated protein kinase 6e-05
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 7e-05
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 8e-05
2a19_B 284 Interferon-induced, double-stranded RNA-activated 1e-04
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-04
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 1e-04
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 1e-04
1uur_A473 Stata protein, STAT protein; transcription activat 2e-04
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-04
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 2e-04
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 2e-04
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 2e-04
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 2e-04
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-04
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 2e-04
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-04
3niz_A 311 Rhodanese family protein; structural genomics, str 3e-04
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 3e-04
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 3e-04
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 3e-04
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 3e-04
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 3e-04
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 3e-04
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-04
3an0_A 340 Dual specificity mitogen-activated protein kinase; 4e-04
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-04
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 5e-04
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 5e-04
3o0g_A 292 Cell division protein kinase 5; kinase activator c 5e-04
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 6e-04
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 6e-04
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 6e-04
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 6e-04
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-04
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-04
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 8e-04
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 8e-04
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 8e-04
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 9e-04
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
 Score =  218 bits (558), Expect = 5e-65
 Identities = 85/250 (34%), Positives = 134/250 (53%), Gaps = 17/250 (6%)

Query: 260 GDMSRQRAE--SILKQEDKEGCFVVRNSSTKGLYTLSLY-TKVPHPHVKHYHIKQNSRGE 316
            D+S ++ E   I+   + +       S+ +  Y  S Y         + ++  + +R E
Sbjct: 100 TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRE 159

Query: 317 FFLSEKHCCHSIPEVKDKEGCFVVRNS-STKGLYTLSL--YTKVPHPHVKHYHIKQNSRG 373
              SE+   ++    ++  G F+VR S +TKG Y LS+  +      +VKHY I++   G
Sbjct: 160 ---SERLLLNA----ENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSG 212

Query: 374 EFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELML 433
            F+++ +   +S+ ++V Y+  ++ GL  RL T+ C    P T GL+ D WEI    L L
Sbjct: 213 GFYITSRTQFNSLQQLVAYYSKHADGLCHRL-TTVCPTSKPQTQGLAKDAWEIPRESLRL 271

Query: 434 LEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVC 491
             +LG G FG V  G W G+  VA   +K GTMS + F++EA+VM +L+H+ LVQLY V 
Sbjct: 272 EVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVV 331

Query: 492 SKHRPIYIVT 501
           S+  PIYIVT
Sbjct: 332 SE-EPIYIVT 340


>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Length = 96 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.98
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.97
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.97
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.95
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.95
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.95
4aoj_A329 High affinity nerve growth factor receptor; transf 99.95
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.95
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.94
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.94
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.94
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.94
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.94
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.94
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.93
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.93
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.93
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.92
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.92
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.89
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.89
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.89
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.89
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.87
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.87
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.84
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.84
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.84
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.84
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.84
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.84
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.84
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.84
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.84
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.84
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.84
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.83
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.83
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.83
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.83
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.83
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.83
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.83
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.83
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.83
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.83
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.82
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.82
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.82
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.82
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.82
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.82
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.82
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.82
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.82
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.82
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.82
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.82
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.82
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.81
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.81
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.81
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.81
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.81
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.81
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.81
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.81
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.81
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.81
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.81
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.81
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.81
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.81
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.81
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.81
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.81
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.81
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.81
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.81
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.81
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.8
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.8
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.8
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.8
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.8
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.8
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.8
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.8
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.8
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.8
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.8
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.8
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.8
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.8
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.8
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.8
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.8
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.8
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.8
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.79
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.79
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.79
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.79
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.79
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.79
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.79
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.79
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.79
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.79
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.79
3ork_A311 Serine/threonine protein kinase; structural genomi 99.79
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.79
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.79
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.79
3niz_A311 Rhodanese family protein; structural genomics, str 99.79
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.79
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.79
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.79
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.79
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.79
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.79
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.79
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.79
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.79
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.79
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.78
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.78
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.78
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.78
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.78
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.78
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.78
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.78
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.78
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.78
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.78
3soc_A322 Activin receptor type-2A; structural genomics cons 99.78
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.78
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.78
3q4u_A301 Activin receptor type-1; structural genomics conso 99.78
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.78
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.78
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.78
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.78
3bhy_A283 Death-associated protein kinase 3; death associate 99.78
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.78
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.78
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.78
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.78
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.78
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.78
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.77
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.77
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.77
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.77
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.77
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.77
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.77
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.77
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.77
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.77
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.77
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.77
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.77
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.77
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.77
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.77
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.77
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.77
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.77
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.77
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.76
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.76
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.76
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.76
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.76
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.76
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.76
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.76
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.76
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.76
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.76
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.76
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.76
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.76
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.76
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.76
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.76
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.76
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.76
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.76
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.76
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.76
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.76
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.76
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.76
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.76
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.76
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.76
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.76
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.76
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.76
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.75
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.75
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.75
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.75
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.75
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.75
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.75
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.75
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.75
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.75
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.75
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.75
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.75
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.74
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.74
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.74
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.74
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.74
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.74
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.74
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.74
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.74
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.74
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.74
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.74
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.73
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.73
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.73
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.73
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.73
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.73
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.73
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.73
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.73
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.72
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.72
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.72
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.72
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.72
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.72
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.72
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.72
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.71
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.71
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.7
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.7
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.7
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.7
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.69
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.69
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.69
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.68
3uqc_A286 Probable conserved transmembrane protein; structur 99.65
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.63
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.61
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.6
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.6
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.6
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.59
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.59
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.57
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.57
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.54
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.52
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.52
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.52
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.51
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.5
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.46
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.46
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.45
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.44
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.43
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.43
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.41
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.38
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.38
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.37
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.34
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.31
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.3
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.29
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.27
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.25
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.25
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.24
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.24
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.23
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.23
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.23
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.21
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.21
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.19
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.19
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.19
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.19
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.18
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.18
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.17
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.17
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.16
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.16
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.15
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.15
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.14
3uqc_A 286 Probable conserved transmembrane protein; structur 99.14
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.14
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.14
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.14
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.14
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.14
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.14
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.13
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.13
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.13
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.13
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.13
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.12
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.12
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.12
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.12
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.11
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.11
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.11
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.11
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.11
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.11
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.11
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.1
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.1
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.1
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.1
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.1
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.1
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.09
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.09
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.09
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.08
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.08
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.08
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.08
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.08
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.08
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.08
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.08
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.08
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.08
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.07
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.07
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.07
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.07
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.07
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.06
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.06
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.06
3niz_A 311 Rhodanese family protein; structural genomics, str 99.06
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.06
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.06
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.05
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.05
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.05
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.05
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.05
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.04
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.04
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.04
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.04
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.04
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.04
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.04
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.04
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.04
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.04
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.04
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.04
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.03
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.03
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.03
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.03
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.03
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.03
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.03
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.03
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.03
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.03
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.02
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.02
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.02
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.02
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.02
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.02
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.02
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.02
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.02
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.01
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.01
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.01
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.01
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.01
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.01
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.01
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.01
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.01
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.0
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.0
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.0
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.0
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.0
3aln_A 327 Dual specificity mitogen-activated protein kinase; 98.99
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 98.99
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 98.99
3bhy_A 283 Death-associated protein kinase 3; death associate 98.99
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 98.99
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.99
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 98.98
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 98.98
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 98.98
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 98.98
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 98.98
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 98.98
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 98.98
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 98.98
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 98.98
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 98.98
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 98.98
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 98.97
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 98.97
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 98.97
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 98.97
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.97
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 98.97
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 98.97
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 98.97
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 98.97
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 98.97
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 98.97
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 98.97
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 98.96
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.96
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 98.96
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 98.96
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 98.96
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 98.96
2a19_B 284 Interferon-induced, double-stranded RNA-activated 98.96
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 98.95
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 98.95
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.95
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 98.94
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 98.94
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 98.94
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.94
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 98.94
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 98.94
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 98.94
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 98.94
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.94
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 98.94
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.93
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 98.93
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 98.93
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.93
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 98.93
3rp9_A 458 Mitogen-activated protein kinase; structural genom 98.93
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 98.93
2vif_A141 Suppressor of cytokine signalling 6; growth regula 98.93
3ork_A 311 Serine/threonine protein kinase; structural genomi 98.93
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 98.92
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 98.92
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 98.92
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 98.92
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.92
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 98.92
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 98.91
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.91
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.91
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 98.91
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 98.91
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.9
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 98.9
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 98.9
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.9
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 98.9
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 98.9
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 98.9
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 98.9
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.89
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 98.89
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.89
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 98.89
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 98.89
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 98.88
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 98.88
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 98.87
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.87
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.86
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
Probab=99.98  E-value=4.7e-31  Score=277.44  Aligned_cols=256  Identities=39%  Similarity=0.724  Sum_probs=209.3

Q ss_pred             cEEEEeccCCCCCCCCCCCCCCCEEEEeecCCccceeeecC-CCccccccCCceeeccccccccccCCCCchhhhhhhhc
Q psy17476        126 KVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDK-NGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVL  204 (513)
Q Consensus       126 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~g~~g~~pp~~~~~~~~~~~~~~~~~~~~~~~~~~~~i  204 (513)
                      ..++++|||.+...++|+|++||.+.|++..++.||.++.. .|..|++|.+|+++.+.+                    
T Consensus         3 ~~~~al~~~~~~~~~el~~~~gd~~~v~~~~~~~ww~~~~~~~g~~G~~P~~yv~~~~~l--------------------   62 (452)
T 1fmk_A            3 TTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSI--------------------   62 (452)
T ss_dssp             EEEEESSCBCCCSSSBCCBCTTCEEEESCCCSSSEEEEEETTTCCEEEEEGGGEEETTSG--------------------
T ss_pred             eEEEECCccCCCCCCCCCccCCCEEEEeccCCCCceEEEEcCCCcccccCcccccccccc--------------------
Confidence            46899999999999999999999999999989999999886 689999999998753311                    


Q ss_pred             ccccccccCccccceeeeeeeeecCCCCCCCCCcceeccccccccccCCCCCcCCCCCCHHHHHHHHcCC-CCCceEEEe
Q psy17476        205 NYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQE-DKEGCFVVR  283 (513)
Q Consensus       205 ~~~~~~~~~Dvws~G~~l~el~t~g~~pf~~~~~~~~~~~i~~~~~~~~p~~w~~~~~~R~~aeeLL~~~-~~~g~fliR  283 (513)
                                                                      ...+|+++.++|..|+++|... ..+|.||||
T Consensus        63 ------------------------------------------------e~~~w~~g~~~r~~ae~~L~~~~~~~G~FLvR   94 (452)
T 1fmk_A           63 ------------------------------------------------QAEEWYFGKITRRESERLLLNAENPRGTFLVR   94 (452)
T ss_dssp             ------------------------------------------------GGSTTEEETCCHHHHHHHHTCTTSCTTEEEEE
T ss_pred             ------------------------------------------------cccccccCCccHHHHHHHhccCCCCCceEEEE
Confidence                                                            0124999999999999999764 467999999


Q ss_pred             ecCC-CCceEEEEEeccCCCceeeEEEeeccccceecCCCccccChhhhhccCCcEEEEecCCCCcEEEEEEeeeCCCcc
Q psy17476        284 NSST-KGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHV  362 (513)
Q Consensus       284 ~s~~-~~~~~lsl~~~~~~~~~~~~~i~~~~~g~~~~~~~~~~~~~~~~l~~~g~~LvR~s~~~~~~~lsv~~~~~~~~v  362 (513)
                      +|++ ++.|++|++.....                                                        ....+
T Consensus        95 ~s~~~~g~y~lsv~~~~~~--------------------------------------------------------~~~~v  118 (452)
T 1fmk_A           95 ESETTKGAYCLSVSDFDNA--------------------------------------------------------KGLNV  118 (452)
T ss_dssp             ECSSSTTCEEEEEEEEETT--------------------------------------------------------TEEEE
T ss_pred             eCCCCCCceEEEEEeeccC--------------------------------------------------------CCCcE
Confidence            9965 78899987642100                                                        02357


Q ss_pred             ceeEEEEcCCccEEEecCcccCChhhhhhcccccCCCCccccCcCCCCCCCCCcccCCCCccccCCcCceeEeEeccccc
Q psy17476        363 KHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQF  442 (513)
Q Consensus       363 ~h~~I~~~~~~~~~i~~~~~F~sl~eLi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lG~G~f  442 (513)
                      +|+.|....++.|++.+...|.++.+++.+|....++++.++. .+|+...+....+..+.|+++.++|++.+.||+|+|
T Consensus       119 ~h~~I~~~~~g~~~~~~~~~F~Sl~~Li~~y~~~~~~l~~~l~-~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~lG~G~f  197 (452)
T 1fmk_A          119 KHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLT-TVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCF  197 (452)
T ss_dssp             EEEEEEECTTSCEESSTTSEESSHHHHHHHHTTCCTTSSSCCC-EECCCCCCCCSSSSTTCSBCCGGGEEEEEEEEECSS
T ss_pred             EEEEEEEcCCCCEEEecCcccCCHHHHHHHhhhccccchhhcc-ccccccccccCCCCccccccChhHceeeeeecCCCC
Confidence            7888887777788888888899999999999998888776654 345544555556667899999999999999999999


Q ss_pred             ceEEEEEEeCceeeEEeec--CCCCHHHHHHHHHHHhcCCCCceeceeeEEEeCCeeEEEEccCCCC
Q psy17476        443 GVVRRGKWRGSIDVAMMKE--GTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFR  507 (513)
Q Consensus       443 G~V~~g~~~~~~~v~~~k~--~~~~~~~f~~E~~il~~l~HpNIV~l~g~~~~~~~~~lV~E~~~~G  507 (513)
                      |.||+|.+.++..++++..  .....++|.+|+++|++++|||||++++++.+ +.+|||||||++|
T Consensus       198 g~Vy~~~~~~~~~vavK~~~~~~~~~~~~~~E~~~l~~l~hp~iv~~~~~~~~-~~~~iv~e~~~~g  263 (452)
T 1fmk_A          198 GEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSE-EPIYIVTEYMSKG  263 (452)
T ss_dssp             CEEEEEEETTTEEEEEEECCTTSSCHHHHHHHHHHHHHCCCTTBCCEEEEECS-SSCEEEECCCTTC
T ss_pred             eEEEEEEECCCceEEEEEeccCCCCHHHHHHHHHHHHhCCCCCEeeEEEEEcC-CceEEEehhhcCC
Confidence            9999999987666554443  23346789999999999999999999999976 6789999999985



>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 513
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-23
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-07
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 4e-21
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-08
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-20
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-07
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 2e-20
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 5e-10
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-19
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 4e-08
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-18
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-06
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 9e-18
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-06
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 5e-05
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 3e-17
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 1e-09
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-16
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 0.001
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 5e-16
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 1e-08
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 1e-15
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-08
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 2e-15
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 3e-08
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 2e-15
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 5e-08
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 3e-15
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 3e-08
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 3e-15
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 7e-15
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 7e-15
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 3e-13
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 1e-14
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 6e-08
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-14
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.004
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 2e-14
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 4e-14
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 2e-14
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 2e-14
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 8e-08
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 2e-14
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 1e-13
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 3e-14
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 7e-14
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 3e-14
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 4e-07
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-14
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 5e-07
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 4e-14
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 4e-14
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 4e-14
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 6e-14
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 6e-05
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 8e-14
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 7e-07
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 8e-14
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-04
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 9e-14
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-07
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 1e-13
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 1e-13
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 1e-13
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 9e-07
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 2e-13
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 8e-11
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 2e-13
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 3e-10
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 2e-13
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 7e-13
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-13
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-06
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 2e-13
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 1e-06
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 3e-13
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 2e-06
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 4e-13
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 8e-09
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 4e-13
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 0.001
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 6e-13
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 9e-13
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 8e-13
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 7e-06
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 9e-13
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 9e-13
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-05
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 9e-13
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 1e-06
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 1e-12
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 5e-07
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-12
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-05
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 2e-12
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 2e-12
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 5e-12
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 2e-12
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 3e-08
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 2e-12
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-12
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-06
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 2e-12
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 4e-12
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-12
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-07
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 3e-12
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 3e-11
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 3e-12
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 3e-09
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 5e-12
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 5e-12
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 2e-06
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 6e-12
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 4e-11
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 6e-12
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-06
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-11
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 1e-11
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-11
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 0.002
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-11
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 1e-11
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 3e-05
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-11
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 0.001
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 0.002
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-11
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-05
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 2e-11
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 4e-09
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-11
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-04
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-11
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 0.001
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-11
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 0.001
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-11
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 8e-08
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-04
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 3e-11
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 4e-11
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 4e-11
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-11
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-07
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 4e-11
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 2e-10
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-11
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-11
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 0.004
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 7e-11
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 8e-07
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 7e-11
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 3e-09
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 7e-11
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 0.002
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 8e-11
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-04
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 1e-10
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-10
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 2e-10
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 8e-10
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-10
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-07
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-10
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 4e-10
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 1e-06
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 5e-10
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-05
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 5e-10
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 5e-10
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 6e-10
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 2e-04
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 7e-10
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 8e-10
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 5e-08
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 1e-09
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 0.002
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 1e-09
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 6e-05
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 2e-09
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-09
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-07
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 2e-09
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-09
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-09
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 0.002
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-09
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-09
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 3e-09
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 2e-08
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 4e-09
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-09
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 5e-09
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 4e-04
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 5e-09
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 2e-08
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 6e-09
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 8e-09
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 6e-09
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 5e-08
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 6e-09
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 7e-09
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 0.001
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-08
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 2e-08
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 7e-07
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-08
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-08
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-08
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 6e-08
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 7e-08
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-07
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-07
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-07
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-07
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 6e-07
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 1e-06
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-06
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-06
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 3e-06
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-06
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 3e-06
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-06
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 5e-06
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 0.003
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 5e-06
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-05
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-05
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-05
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-05
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-05
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 0.004
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 7e-04
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 98.6 bits (245), Expect = 1e-23
 Identities = 46/91 (50%), Positives = 59/91 (64%), Gaps = 3/91 (3%)

Query: 414 PATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAM--MKEGTMSEDDFIE 471
           P T GL+ D WEI    L L  +LG G FG V  G W G+  VA+  +K GTMS + F++
Sbjct: 2   PQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ 61

Query: 472 EAKVMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
           EA+VM +L+H+ LVQLY V S   PIYIVT+
Sbjct: 62  EAQVMKKLRHEKLVQLYAVVS-EEPIYIVTE 91


>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.93
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.93
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.93
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.93
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.93
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.92
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.92
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.92
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.92
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.92
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.92
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.92
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.91
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.91
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.91
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.91
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.91
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.91
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.91
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.91
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.91
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.9
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.9
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.9
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.9
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.9
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.9
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.9
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.9
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.9
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.9
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.9
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.89
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.89
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.89
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.89
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.89
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.88
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.88
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.88
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.87
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.87
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.86
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.86
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.85
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.85
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.85
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.84
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.84
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.83
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.83
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.82
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.82
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.8
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.8
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.78
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.77
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.76
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.67
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.64
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.62
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.6
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.54
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.54
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.5
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.49
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.49
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.48
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.48
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.48
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.48
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.47
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.47
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.46
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.45
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.45
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.45
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.45
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.44
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.44
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.44
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.43
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.42
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.41
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.4
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.4
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.39
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.38
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.38
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.38
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.38
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.37
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.37
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.36
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.33
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.33
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.32
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.31
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.31
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.28
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.28
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.27
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.26
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.25
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.25
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.25
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.25
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.25
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.24
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.24
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.23
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.23
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.22
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.21
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.2
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.2
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.2
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.2
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.2
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.19
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.19
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.19
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.19
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.18
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.15
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.15
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.14
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.13
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.11
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.11
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.09
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.07
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.04
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.04
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.03
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.0
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.0
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 98.98
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 98.98
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 98.92
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 98.88
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 98.87
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 98.85
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 98.84
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 98.82
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 98.78
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 98.77
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.76
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 98.71
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 98.71
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 98.58
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 98.53
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 98.49
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 98.49
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 98.48
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 98.47
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 98.45
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.45
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 98.42
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 98.4
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 98.39
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.38
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.37
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 98.37
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 98.36
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 98.33
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.33
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 98.31
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 98.3
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 98.29
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 98.29
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.27
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.26
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.24
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.21
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.21
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.2
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.2
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 98.19
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 98.17
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 98.16
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 98.15
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.13
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.03
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.01
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.99
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 97.97
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 97.92
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.9
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 97.78
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.78
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.77
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 97.65
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 97.63
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 97.52
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 97.52
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 97.2
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 97.13
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 97.02
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 96.76
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 96.74
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 96.7
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 96.63
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 96.58
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 96.31
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 96.25
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 96.15
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 96.13
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 95.98
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 95.96
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 95.83
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 95.77
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 95.75
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 95.74
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 95.65
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 95.57
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 95.57
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 95.54
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 95.53
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 95.48
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 95.38
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 95.22
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 95.13
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 95.09
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 94.85
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 94.8
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 94.76
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 94.71
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 94.66
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 94.53
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 94.37
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 94.31
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 94.04
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 93.54
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 93.42
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 93.15
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 93.03
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 92.93
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 92.81
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 92.78
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.72
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.78
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 90.46
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 90.18
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 89.41
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 89.31
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 89.3
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 89.25
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 89.02
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 88.26
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 88.09
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 87.56
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 86.5
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 84.84
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 84.5
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 83.2
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=9.9e-28  Score=235.80  Aligned_cols=166  Identities=28%  Similarity=0.488  Sum_probs=123.4

Q ss_pred             CCCCcHHHHHHhcCCCCCCchhHHHHHHHHHHHHHHHHHhcceeccccCcccccccCccccccccCCccCCCceEEEecc
Q psy17476          1 MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYP   80 (513)
Q Consensus         1 ~~~g~L~~~l~~~~~~~~~~~~~~~~~~~qi~~gl~ylH~~~iiHrdikp~N~~~~~~~~~~~~l~~~~~~~~~~~~~~~   80 (513)
                      |++|+|.+++.++...  +++..+..++.|||.||+|||+++||||||||+|||++.           +..+||      
T Consensus       109 ~~~g~L~~~~~~~~~~--l~~~~~~~i~~qia~gl~yLH~~~iiHrDlKp~NILl~~-----------~~~~Kl------  169 (299)
T d1jpaa_         109 MENGSLDSFLRQNDGQ--FTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNS-----------NLVCKV------  169 (299)
T ss_dssp             CTTEEHHHHHHTTTTC--SCHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEECT-----------TCCEEE------
T ss_pred             cCCCcceeeeccccCC--CCHHHHHHHHHHHHHHHHHHhhCCCccCccccceEEECC-----------CCcEEE------
Confidence            5799999999886543  688999999999999999999999999999999955444           445567      


Q ss_pred             ccccCCCCcccccCCeEEeeecCccceeeeeccCCCCCCCCCCCCcEEEEeccCCCCCCCCCCCCCCCEEEEeecCCccc
Q psy17476         81 FKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHW  160 (513)
Q Consensus        81 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~  160 (513)
                            +|||+++-.                                                          ..... .
T Consensus       170 ------~DFGla~~~----------------------------------------------------------~~~~~-~  184 (299)
T d1jpaa_         170 ------SDFGLSRFL----------------------------------------------------------EDDTS-D  184 (299)
T ss_dssp             ------CCC-----------------------------------------------------------------------
T ss_pred             ------CCcccceEc----------------------------------------------------------cCCCC-c
Confidence                  899998610                                                          00000 0


Q ss_pred             eeeecCCCccccccCCceeeccccccccccCCCCchhhhhhhhcccccccccCccccceeeeeeeeecCCCCCCCCCcce
Q psy17476        161 WKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTE  240 (513)
Q Consensus       161 ~~~~~~~g~~g~~pp~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~Dvws~G~~l~el~t~g~~pf~~~~~~~  240 (513)
                         ....+..+                    ..+++.+||||++....|+.++|||||||++|||+|+|+.||...+..+
T Consensus       185 ---~~~~~~~~--------------------~~~t~~y~aPE~~~~~~~~~~sDvwS~Gvvl~el~t~g~~Pf~~~~~~~  241 (299)
T d1jpaa_         185 ---PTYTSALG--------------------GKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQD  241 (299)
T ss_dssp             ----------------------------------CGGGSCHHHHHSCCCCHHHHHHHHHHHHHHHHTTSCCTTTTCCHHH
T ss_pred             ---ceeeeccc--------------------ccCCccccCHHHHhcCCCCcccccccchHHHHHHHhCCCCCCCCCCHHH
Confidence               00000000                    0134556778888888999999999999999999988999999999989


Q ss_pred             eccccccccccCCC------------CCcCCCCCCHHHHHHHHcC
Q psy17476        241 VVDRVQRGIILEKP------------KAWYVGDMSRQRAESILKQ  273 (513)
Q Consensus       241 ~~~~i~~~~~~~~p------------~~w~~~~~~R~~aeeLL~~  273 (513)
                      +...+.++.+++.|            .||..++..||++.+++..
T Consensus       242 ~~~~i~~~~~~~~~~~~~~~l~~li~~cl~~~P~~RPs~~ei~~~  286 (299)
T d1jpaa_         242 VINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNT  286 (299)
T ss_dssp             HHHHHHTTCCCCCCTTCCHHHHHHHHHHTCSSTTTSCCHHHHHHH
T ss_pred             HHHHHHcCCCCCCCccchHHHHHHHHHHcCCCHhHCcCHHHHHHH
Confidence            99999888877766            5899999999999888754



>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure