Psyllid ID: psy17476
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 513 | ||||||
| 383849754 | 711 | PREDICTED: tyrosine-protein kinase Btk29 | 0.397 | 0.286 | 0.793 | 2e-90 | |
| 380028436 | 722 | PREDICTED: tyrosine-protein kinase Btk29 | 0.397 | 0.282 | 0.793 | 3e-90 | |
| 307206152 | 504 | Tyrosine-protein kinase Btk29A [Harpegna | 0.397 | 0.404 | 0.793 | 4e-90 | |
| 328780764 | 694 | PREDICTED: tyrosine-protein kinase Btk29 | 0.397 | 0.293 | 0.793 | 4e-90 | |
| 340727645 | 691 | PREDICTED: tyrosine-protein kinase Btk29 | 0.397 | 0.295 | 0.788 | 4e-90 | |
| 242006732 | 644 | predicted protein [Pediculus humanus cor | 0.397 | 0.316 | 0.783 | 6e-90 | |
| 350412029 | 518 | PREDICTED: tyrosine-protein kinase Btk29 | 0.397 | 0.393 | 0.793 | 8e-90 | |
| 332018953 | 422 | Tyrosine-protein kinase Btk29A [Acromyrm | 0.397 | 0.483 | 0.793 | 1e-89 | |
| 345487249 | 711 | PREDICTED: tyrosine-protein kinase Btk29 | 0.397 | 0.286 | 0.788 | 1e-89 | |
| 307183119 | 479 | Tyrosine-protein kinase Btk29A [Camponot | 0.397 | 0.425 | 0.788 | 1e-89 |
| >gi|383849754|ref|XP_003700502.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 339 bits (869), Expect = 2e-90, Method: Compositional matrix adjust.
Identities = 165/208 (79%), Positives = 183/208 (87%), Gaps = 4/208 (1%)
Query: 299 VPHPHVKHYHIKQNSRGEFFLSE--KHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTK 356
+P +VK + + E+++ + + S+ + +DKEGCFVVRNSSTKGLYTLSLYTK
Sbjct: 316 IPSNYVKEKELLGLQKYEWYVGDMSRQRAESLLKQEDKEGCFVVRNSSTKGLYTLSLYTK 375
Query: 357 VPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPAT 416
VPHPHVKHYHIKQN+RGEF+LSEKHCC SIP++VNYHRHNSGGLASRLKTSPCDRPVP T
Sbjct: 376 VPHPHVKHYHIKQNTRGEFYLSEKHCCGSIPDLVNYHRHNSGGLASRLKTSPCDRPVPPT 435
Query: 417 AGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAK 474
AGLSHDKWEIDPAEL LLEELGSGQFGVVRRGKWRGSIDVA MMKEGTMSEDDFIEEAK
Sbjct: 436 AGLSHDKWEIDPAELHLLEELGSGQFGVVRRGKWRGSIDVAVKMMKEGTMSEDDFIEEAK 495
Query: 475 VMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
VMT+LQHQNLVQLYGVCSK RPIYIVT+
Sbjct: 496 VMTKLQHQNLVQLYGVCSKDRPIYIVTE 523
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380028436|ref|XP_003697908.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307206152|gb|EFN84232.1| Tyrosine-protein kinase Btk29A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328780764|ref|XP_394126.4| PREDICTED: tyrosine-protein kinase Btk29A-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340727645|ref|XP_003402150.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|242006732|ref|XP_002424201.1| predicted protein [Pediculus humanus corporis] gi|212507542|gb|EEB11463.1| predicted protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|350412029|ref|XP_003489521.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332018953|gb|EGI59499.1| Tyrosine-protein kinase Btk29A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345487249|ref|XP_003425657.1| PREDICTED: tyrosine-protein kinase Btk29A-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307183119|gb|EFN70036.1| Tyrosine-protein kinase Btk29A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 513 | ||||||
| FB|FBgn0003502 | 786 | Btk29A "Btk family kinase at 2 | 0.520 | 0.339 | 0.599 | 8.5e-81 | |
| UNIPROTKB|F1SEA4 | 596 | TEC "Uncharacterized protein" | 0.333 | 0.286 | 0.544 | 6.1e-66 | |
| UNIPROTKB|K7GR59 | 632 | TEC "Uncharacterized protein" | 0.333 | 0.270 | 0.544 | 6.1e-66 | |
| UNIPROTKB|D4A596 | 630 | Tec "Protein Tec" [Rattus norv | 0.333 | 0.271 | 0.544 | 2e-65 | |
| UNIPROTKB|F1NZY8 | 630 | TEC "Uncharacterized protein" | 0.333 | 0.271 | 0.555 | 2.6e-65 | |
| MGI|MGI:98662 | 630 | Tec "tec protein tyrosine kina | 0.333 | 0.271 | 0.544 | 3.3e-65 | |
| UNIPROTKB|F1PBW9 | 630 | TEC "Uncharacterized protein" | 0.333 | 0.271 | 0.538 | 6.8e-65 | |
| UNIPROTKB|F1MSH3 | 596 | TEC "Uncharacterized protein" | 0.333 | 0.286 | 0.538 | 6.8e-65 | |
| UNIPROTKB|P42680 | 631 | TEC "Tyrosine-protein kinase T | 0.333 | 0.270 | 0.538 | 1.1e-64 | |
| UNIPROTKB|F1S1L0 | 659 | BTK "Uncharacterized protein" | 0.329 | 0.256 | 0.551 | 2.9e-64 |
| FB|FBgn0003502 Btk29A "Btk family kinase at 29A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 811 (290.5 bits), Expect = 8.5e-81, P = 8.5e-81
Identities = 169/282 (59%), Positives = 206/282 (73%)
Query: 229 GKMPYGRLKNTEVVDR---VQRGIILEKPKAWYVGDMSRQR-AESILKQEDKEGCFVVRN 284
G +P N++ D V+ + L KA GD+S ++ AE + + +E + V++
Sbjct: 325 GGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKD 384
Query: 285 SSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSE--KHCCHSIPEVKDKEGCFVVRN 342
+ Y +P +VK + R E+++ + + S+ + DKEGCFVVR
Sbjct: 385 ALGNVGY-------IPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCFVVRK 437
Query: 343 SSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLAS 402
SSTKGLYTLSL+TKVP HVKHYHIKQN+R E++LSEKHCC +IP+++NYHRHNSGGLA
Sbjct: 438 SSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPDLINYHRHNSGGLAC 497
Query: 403 RLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVA--MMK 460
RLK+SPCDRPVP TAGLSHDKWEI P ELML+EELGSGQFGVVRRGKWRGSID A MMK
Sbjct: 498 RLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELGSGQFGVVRRGKWRGSIDTAVKMMK 557
Query: 461 EGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
EGTMSEDDFIEEAKVMT+LQH NLVQLYGVCSKHRPIYIVT+
Sbjct: 558 EGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTE 599
|
|
| UNIPROTKB|F1SEA4 TEC "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GR59 TEC "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A596 Tec "Protein Tec" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZY8 TEC "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98662 Tec "tec protein tyrosine kinase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PBW9 TEC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSH3 TEC "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P42680 TEC "Tyrosine-protein kinase Tec" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S1L0 BTK "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 513 | |||
| cd09934 | 104 | cd09934, SH2_Tec_family, Src homology 2 (SH2) doma | 1e-44 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 1e-42 | |
| cd05113 | 256 | cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro | 4e-34 | |
| cd05114 | 256 | cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro | 1e-31 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 5e-29 | |
| cd11768 | 54 | cd11768, SH3_Tec_like, Src Homology 3 domain of Te | 2e-28 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 2e-25 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 2e-25 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 9e-25 | |
| cd10396 | 108 | cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain | 3e-24 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 2e-23 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 1e-21 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 3e-21 | |
| cd10399 | 106 | cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain | 1e-20 | |
| cd10397 | 106 | cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain | 3e-20 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 6e-20 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 7e-20 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 2e-19 | |
| cd10398 | 106 | cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain | 2e-19 | |
| cd10397 | 106 | cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain | 7e-19 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 2e-18 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 2e-18 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 4e-18 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 5e-18 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 5e-18 | |
| cd10398 | 106 | cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain | 7e-18 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 9e-18 | |
| cd05113 | 256 | cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro | 2e-17 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 2e-17 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 3e-17 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 1e-16 | |
| cd05114 | 256 | cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro | 2e-16 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 2e-16 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 2e-16 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 3e-16 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 3e-16 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 1e-14 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 1e-14 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 2e-14 | |
| cd05069 | 260 | cd05069, PTKc_Yes, Catalytic domain of the Protein | 3e-14 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 4e-14 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 6e-14 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 1e-13 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 1e-13 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 1e-13 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 2e-13 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 2e-13 | |
| cd11908 | 56 | cd11908, SH3_ITK, Src Homology 3 domain of Interle | 4e-13 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 5e-13 | |
| cd05049 | 280 | cd05049, PTKc_Trk, Catalytic domain of the Protein | 5e-13 | |
| cd05116 | 257 | cd05116, PTKc_Syk, Catalytic domain of the Protein | 1e-12 | |
| cd05073 | 260 | cd05073, PTKc_Hck, Catalytic domain of the Protein | 1e-12 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 1e-12 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 2e-12 | |
| cd05046 | 275 | cd05046, PTK_CCK4, Pseudokinase domain of the Prot | 2e-12 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 3e-12 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 4e-12 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 4e-12 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 5e-12 | |
| cd05115 | 257 | cd05115, PTKc_Zap-70, Catalytic domain of the Prot | 6e-12 | |
| cd05094 | 291 | cd05094, PTKc_TrkC, Catalytic domain of the Protei | 7e-12 | |
| cd05036 | 277 | cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro | 7e-12 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 9e-12 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 1e-11 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 1e-11 | |
| cd05084 | 252 | cd05084, PTKc_Fes, Catalytic domain of the Protein | 1e-11 | |
| cd05092 | 280 | cd05092, PTKc_TrkA, Catalytic domain of the Protei | 1e-11 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 2e-11 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 2e-11 | |
| cd11907 | 55 | cd11907, SH3_TXK, Src Homology 3 domain of TXK, al | 2e-11 | |
| cd05083 | 254 | cd05083, PTKc_Chk, Catalytic domain of the Protein | 2e-11 | |
| cd05082 | 256 | cd05082, PTKc_Csk, Catalytic domain of the Protein | 2e-11 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 6e-11 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 7e-11 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 1e-10 | |
| cd05114 | 256 | cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro | 2e-10 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 2e-10 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 2e-10 | |
| cd05093 | 288 | cd05093, PTKc_TrkB, Catalytic domain of the Protei | 2e-10 | |
| cd05085 | 250 | cd05085, PTKc_Fer, Catalytic domain of the Protein | 2e-10 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 2e-10 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 2e-10 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 3e-10 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 3e-10 | |
| cd05082 | 256 | cd05082, PTKc_Csk, Catalytic domain of the Protein | 4e-10 | |
| cd05044 | 269 | cd05044, PTKc_c-ros, Catalytic domain of the Prote | 4e-10 | |
| cd05050 | 288 | cd05050, PTKc_Musk, Catalytic domain of the Protei | 5e-10 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 7e-10 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 8e-10 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 9e-10 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 1e-09 | |
| cd12007 | 58 | cd12007, SH3_Yes, Src homology 3 domain of Yes Pro | 1e-09 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 1e-09 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 2e-09 | |
| cd11905 | 56 | cd11905, SH3_Tec, Src Homology 3 domain of Tec (Ty | 2e-09 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 2e-09 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 2e-09 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 2e-09 | |
| cd05063 | 268 | cd05063, PTKc_EphR_A2, Catalytic domain of the Pro | 4e-09 | |
| cd05089 | 297 | cd05089, PTKc_Tie1, Catalytic domain of the Protei | 4e-09 | |
| cd05051 | 296 | cd05051, PTKc_DDR, Catalytic domain of the Protein | 4e-09 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 4e-09 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 5e-09 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 7e-09 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 7e-09 | |
| cd05088 | 303 | cd05088, PTKc_Tie2, Catalytic domain of the Protei | 8e-09 | |
| cd05053 | 293 | cd05053, PTKc_FGFR, Catalytic domain of the Protei | 8e-09 | |
| cd11764 | 54 | cd11764, SH3_Eps8, Src Homology 3 domain of Epider | 9e-09 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 1e-08 | |
| cd05064 | 266 | cd05064, PTKc_EphR_A10, Catalytic domain of the Pr | 1e-08 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 1e-08 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 1e-08 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 1e-08 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 1e-08 | |
| cd05047 | 270 | cd05047, PTKc_Tie, Catalytic domain of Tie Protein | 1e-08 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 1e-08 | |
| cd05075 | 272 | cd05075, PTKc_Axl, Catalytic domain of the Protein | 1e-08 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 2e-08 | |
| cd05049 | 280 | cd05049, PTKc_Trk, Catalytic domain of the Protein | 2e-08 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 2e-08 | |
| cd05083 | 254 | cd05083, PTKc_Chk, Catalytic domain of the Protein | 2e-08 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 2e-08 | |
| cd05035 | 273 | cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li | 2e-08 | |
| cd11903 | 59 | cd11903, SH3_Nck2_3, Third Src Homology 3 domain o | 2e-08 | |
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 2e-08 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 2e-08 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 2e-08 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 3e-08 | |
| cd05051 | 296 | cd05051, PTKc_DDR, Catalytic domain of the Protein | 3e-08 | |
| cd05065 | 269 | cd05065, PTKc_EphR_B, Catalytic domain of the Prot | 3e-08 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 3e-08 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 3e-08 | |
| cd12009 | 54 | cd12009, SH3_Blk, Src homology 3 domain of Blk Pro | 3e-08 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 3e-08 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 4e-08 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 4e-08 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 4e-08 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 6e-08 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 6e-08 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 7e-08 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 7e-08 | |
| cd11908 | 56 | cd11908, SH3_ITK, Src Homology 3 domain of Interle | 9e-08 | |
| cd05036 | 277 | cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro | 9e-08 | |
| cd05065 | 269 | cd05065, PTKc_EphR_B, Catalytic domain of the Prot | 9e-08 | |
| cd05090 | 283 | cd05090, PTKc_Ror1, Catalytic domain of the Protei | 9e-08 | |
| cd05113 | 256 | cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro | 1e-07 | |
| cd05069 | 260 | cd05069, PTKc_Yes, Catalytic domain of the Protein | 1e-07 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 1e-07 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 1e-07 | |
| cd11911 | 55 | cd11911, SH3_CIP4-like, Src Homology 3 domain of C | 1e-07 | |
| cd11985 | 53 | cd11985, SH3_Stac2_C, C-terminal Src homology 3 do | 1e-07 | |
| cd11761 | 57 | cd11761, SH3_FCHSD_1, First Src Homology 3 domain | 1e-07 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 1e-07 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 2e-07 | |
| cd05085 | 250 | cd05085, PTKc_Fer, Catalytic domain of the Protein | 2e-07 | |
| cd05063 | 268 | cd05063, PTKc_EphR_A2, Catalytic domain of the Pro | 2e-07 | |
| cd05053 | 293 | cd05053, PTKc_FGFR, Catalytic domain of the Protei | 2e-07 | |
| cd11904 | 57 | cd11904, SH3_Nck1_3, Third Src Homology 3 domain o | 2e-07 | |
| cd10343 | 103 | cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou | 2e-07 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 2e-07 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 2e-07 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 2e-07 | |
| cd10365 | 101 | cd10365, SH2_Src_Src, Src homology 2 (SH2) domain | 2e-07 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 3e-07 | |
| cd11906 | 55 | cd11906, SH3_BTK, Src Homology 3 domain of Bruton' | 3e-07 | |
| cd05073 | 260 | cd05073, PTKc_Hck, Catalytic domain of the Protein | 3e-07 | |
| cd10365 | 101 | cd10365, SH2_Src_Src, Src homology 2 (SH2) domain | 3e-07 | |
| cd05054 | 337 | cd05054, PTKc_VEGFR, Catalytic domain of the Prote | 3e-07 | |
| cd05043 | 280 | cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece | 3e-07 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 3e-07 | |
| cd05111 | 279 | cd05111, PTK_HER3, Pseudokinase domain of the Prot | 3e-07 | |
| cd05111 | 279 | cd05111, PTK_HER3, Pseudokinase domain of the Prot | 3e-07 | |
| cd05107 | 401 | cd05107, PTKc_PDGFR_beta, Catalytic domain of the | 3e-07 | |
| cd09930 | 104 | cd09930, SH2_cSH2_p85_like, C-terminal Src homolog | 3e-07 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 4e-07 | |
| cd05084 | 252 | cd05084, PTKc_Fes, Catalytic domain of the Protein | 4e-07 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 4e-07 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 4e-07 | |
| cd12005 | 54 | cd12005, SH3_Lck, Src homology 3 domain of Lck Pro | 4e-07 | |
| cd12008 | 56 | cd12008, SH3_Src, Src homology 3 domain of Src Pro | 4e-07 | |
| cd05062 | 277 | cd05062, PTKc_IGF-1R, Catalytic domain of the Prot | 5e-07 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 5e-07 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 5e-07 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 5e-07 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 6e-07 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 6e-07 | |
| cd05105 | 400 | cd05105, PTKc_PDGFR_alpha, Catalytic domain of the | 6e-07 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 6e-07 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 7e-07 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 7e-07 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 1e-06 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 1e-06 | |
| cd10355 | 92 | cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma | 1e-06 | |
| cd05074 | 273 | cd05074, PTKc_Tyro3, Catalytic domain of the Prote | 1e-06 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 1e-06 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 1e-06 | |
| cd05097 | 295 | cd05097, PTKc_DDR_like, Catalytic domain of Discoi | 1e-06 | |
| cd05091 | 283 | cd05091, PTKc_Ror2, Catalytic domain of the Protei | 1e-06 | |
| cd09929 | 121 | cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom | 1e-06 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 1e-06 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 1e-06 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 2e-06 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 2e-06 | |
| cd05106 | 374 | cd05106, PTKc_CSF-1R, Catalytic domain of the Prot | 2e-06 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 3e-06 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 3e-06 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 3e-06 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 3e-06 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 3e-06 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 3e-06 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 3e-06 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 3e-06 | |
| cd11899 | 58 | cd11899, SH3_Nck2_1, First Src Homology 3 domain o | 3e-06 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 3e-06 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 4e-06 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 4e-06 | |
| cd05109 | 279 | cd05109, PTKc_HER2, Catalytic domain of the Protei | 4e-06 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 5e-06 | |
| cd05044 | 269 | cd05044, PTKc_c-ros, Catalytic domain of the Prote | 5e-06 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 5e-06 | |
| cd10418 | 101 | cd10418, SH2_Src_Fyn_isoform_a_like, Src homology | 5e-06 | |
| cd12076 | 54 | cd12076, SH3_Tks4_2, Second Src homology 3 domain | 5e-06 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 6e-06 | |
| cd05092 | 280 | cd05092, PTKc_TrkA, Catalytic domain of the Protei | 6e-06 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 6e-06 | |
| cd05101 | 304 | cd05101, PTKc_FGFR2, Catalytic domain of the Prote | 6e-06 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 6e-06 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 6e-06 | |
| cd05082 | 256 | cd05082, PTKc_Csk, Catalytic domain of the Protein | 7e-06 | |
| cd11900 | 59 | cd11900, SH3_Nck1_1, First Src Homology 3 domain o | 7e-06 | |
| cd05095 | 296 | cd05095, PTKc_DDR2, Catalytic domain of the Protei | 7e-06 | |
| cd05044 | 269 | cd05044, PTKc_c-ros, Catalytic domain of the Prote | 8e-06 | |
| cd11907 | 55 | cd11907, SH3_TXK, Src Homology 3 domain of TXK, al | 9e-06 | |
| cd05107 | 401 | cd05107, PTKc_PDGFR_beta, Catalytic domain of the | 9e-06 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 9e-06 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 1e-05 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 1e-05 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 1e-05 | |
| cd09926 | 106 | cd09926, SH2_CRK_like, Src homology 2 domain found | 1e-05 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 1e-05 | |
| cd05100 | 334 | cd05100, PTKc_FGFR3, Catalytic domain of the Prote | 1e-05 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 1e-05 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 1e-05 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 2e-05 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 2e-05 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 2e-05 | |
| cd05100 | 334 | cd05100, PTKc_FGFR3, Catalytic domain of the Prote | 2e-05 | |
| cd05102 | 338 | cd05102, PTKc_VEGFR3, Catalytic domain of the Prot | 2e-05 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 2e-05 | |
| cd05042 | 269 | cd05042, PTKc_Aatyk, Catalytic domain of the Prote | 2e-05 | |
| cd05103 | 343 | cd05103, PTKc_VEGFR2, Catalytic domain of the Prot | 2e-05 | |
| cd05061 | 288 | cd05061, PTKc_InsR, Catalytic domain of the Protei | 2e-05 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 2e-05 | |
| cd11800 | 57 | cd11800, SH3_DNMBP_C2_like, Second C-terminal Src | 2e-05 | |
| cd05096 | 304 | cd05096, PTKc_DDR1, Catalytic domain of the Protei | 2e-05 | |
| cd10362 | 101 | cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain | 2e-05 | |
| cd05073 | 260 | cd05073, PTKc_Hck, Catalytic domain of the Protein | 3e-05 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 3e-05 | |
| cd05051 | 296 | cd05051, PTKc_DDR, Catalytic domain of the Protein | 3e-05 | |
| cd05105 | 400 | cd05105, PTKc_PDGFR_alpha, Catalytic domain of the | 3e-05 | |
| cd05097 | 295 | cd05097, PTKc_DDR_like, Catalytic domain of Discoi | 3e-05 | |
| cd05091 | 283 | cd05091, PTKc_Ror2, Catalytic domain of the Protei | 3e-05 | |
| cd05109 | 279 | cd05109, PTKc_HER2, Catalytic domain of the Protei | 3e-05 | |
| cd05101 | 304 | cd05101, PTKc_FGFR2, Catalytic domain of the Prote | 3e-05 | |
| cd05098 | 307 | cd05098, PTKc_FGFR1, Catalytic domain of the Prote | 3e-05 | |
| cd11847 | 58 | cd11847, SH3_Brk, Src homology 3 domain of Brk (Br | 3e-05 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 3e-05 | |
| cd05106 | 374 | cd05106, PTKc_CSF-1R, Catalytic domain of the Prot | 4e-05 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 4e-05 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 4e-05 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 4e-05 | |
| cd05094 | 291 | cd05094, PTKc_TrkC, Catalytic domain of the Protei | 5e-05 | |
| cd10418 | 101 | cd10418, SH2_Src_Fyn_isoform_a_like, Src homology | 5e-05 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 5e-05 | |
| cd05098 | 307 | cd05098, PTKc_FGFR1, Catalytic domain of the Prote | 6e-05 | |
| cd11783 | 55 | cd11783, SH3_SH3RF_3, Third Src Homology 3 domain | 6e-05 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 6e-05 | |
| cd10370 | 96 | cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai | 6e-05 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 6e-05 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 6e-05 | |
| cd11765 | 51 | cd11765, SH3_Nck_1, First Src Homology 3 domain of | 7e-05 | |
| cd12004 | 56 | cd12004, SH3_Lyn, Src homology 3 domain of Lyn Pro | 7e-05 | |
| cd11985 | 53 | cd11985, SH3_Stac2_C, C-terminal Src homology 3 do | 7e-05 | |
| cd10391 | 98 | cd10391, SH2_SHE, Src homology 2 domain found in S | 7e-05 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 8e-05 | |
| cd09923 | 81 | cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom | 9e-05 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 9e-05 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 9e-05 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 1e-04 | |
| cd05069 | 260 | cd05069, PTKc_Yes, Catalytic domain of the Protein | 1e-04 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 1e-04 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 1e-04 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 1e-04 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 1e-04 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 1e-04 | |
| cd05086 | 268 | cd05086, PTKc_Aatyk2, Catalytic domain of the Prot | 1e-04 | |
| cd11902 | 55 | cd11902, SH3_Nck2_2, Second Src Homology 3 domain | 1e-04 | |
| cd11775 | 57 | cd11775, SH3_Sla1p_3, Third Src Homology 3 domain | 1e-04 | |
| cd11808 | 53 | cd11808, SH3_Alpha_Spectrin, Src homology 3 domain | 1e-04 | |
| cd11888 | 54 | cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o | 1e-04 | |
| cd11777 | 55 | cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain | 1e-04 | |
| cd10364 | 101 | cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain | 1e-04 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 1e-04 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 1e-04 | |
| cd11849 | 53 | cd11849, SH3_SPIN90, Src homology 3 domain of SH3 | 2e-04 | |
| cd05050 | 288 | cd05050, PTKc_Musk, Catalytic domain of the Protei | 2e-04 | |
| cd05064 | 266 | cd05064, PTKc_EphR_A10, Catalytic domain of the Pr | 2e-04 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 2e-04 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 2e-04 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 2e-04 | |
| cd05061 | 288 | cd05061, PTKc_InsR, Catalytic domain of the Protei | 2e-04 | |
| cd09927 | 116 | cd09927, SH2_Tensin_like, Src homology 2 domain fo | 2e-04 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 2e-04 | |
| cd12024 | 53 | cd12024, SH3_NoxO1_2, Second or C-terminal Src hom | 2e-04 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 2e-04 | |
| cd05079 | 284 | cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma | 2e-04 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 2e-04 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 3e-04 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 3e-04 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 3e-04 | |
| cd10360 | 79 | cd10360, SH2_Srm, Src homology 2 (SH2) domain foun | 3e-04 | |
| cd12011 | 55 | cd12011, SH3_SLAP2, Src homology 3 domain of Src-L | 3e-04 | |
| cd12069 | 57 | cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rh | 3e-04 | |
| cd11925 | 57 | cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain | 3e-04 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 3e-04 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 3e-04 | |
| cd11774 | 52 | cd11774, SH3_Sla1p_2, Second Src Homology 3 domain | 3e-04 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 3e-04 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 4e-04 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 4e-04 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 4e-04 | |
| cd10364 | 101 | cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain | 4e-04 | |
| cd12072 | 57 | cd12072, SH3_FNBP1L, Src Homology 3 domain of Form | 4e-04 | |
| cd09938 | 104 | cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src | 4e-04 | |
| cd05115 | 257 | cd05115, PTKc_Zap-70, Catalytic domain of the Prot | 5e-04 | |
| cd12007 | 58 | cd12007, SH3_Yes, Src homology 3 domain of Yes Pro | 5e-04 | |
| cd05062 | 277 | cd05062, PTKc_IGF-1R, Catalytic domain of the Prot | 5e-04 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 5e-04 | |
| cd05080 | 283 | cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma | 5e-04 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 5e-04 | |
| cd05104 | 375 | cd05104, PTKc_Kit, Catalytic domain of the Protein | 5e-04 | |
| cd10388 | 101 | cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo | 5e-04 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 5e-04 | |
| cd11764 | 54 | cd11764, SH3_Eps8, Src Homology 3 domain of Epider | 6e-04 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 6e-04 | |
| cd05096 | 304 | cd05096, PTKc_DDR1, Catalytic domain of the Protei | 6e-04 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 6e-04 | |
| cd11903 | 59 | cd11903, SH3_Nck2_3, Third Src Homology 3 domain o | 7e-04 | |
| cd09925 | 104 | cd09925, SH2_SHC, Src homology 2 (SH2) domain foun | 7e-04 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 7e-04 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 8e-04 | |
| cd12016 | 54 | cd12016, SH3_Tks_2, Second Src homology 3 domain o | 8e-04 | |
| cd12065 | 54 | cd12065, SH3_GRAF2, Src Homology 3 domain of GTPas | 8e-04 | |
| cd05093 | 288 | cd05093, PTKc_TrkB, Catalytic domain of the Protei | 9e-04 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 9e-04 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 9e-04 | |
| cd11988 | 57 | cd11988, SH3_Intersectin2_1, First Src homology 3 | 9e-04 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 9e-04 | |
| cd11850 | 56 | cd11850, SH3_Abl, Src homology 3 domain of the Pro | 9e-04 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 0.001 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 0.001 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 0.001 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 0.001 | |
| cd05095 | 296 | cd05095, PTKc_DDR2, Catalytic domain of the Protei | 0.001 | |
| cd11888 | 54 | cd11888, SH3_ARHGAP9_like, Src Homology 3 domain o | 0.001 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 0.001 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 0.001 | |
| cd10337 | 136 | cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in | 0.001 | |
| cd12064 | 56 | cd12064, SH3_GRAF, Src Homology 3 domain of GTPase | 0.001 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 0.001 | |
| cd05046 | 275 | cd05046, PTK_CCK4, Pseudokinase domain of the Prot | 0.002 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 0.002 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 0.002 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 0.002 | |
| cd12017 | 53 | cd12017, SH3_Tks_3, Third Src homology 3 domain of | 0.002 | |
| cd11848 | 55 | cd11848, SH3_SLAP-like, Src homology 3 domain of S | 0.002 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 0.002 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 0.002 | |
| cd10402 | 105 | cd10402, SH2_C-SH2_Zap70, C-terminal Src homology | 0.002 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 0.002 | |
| cd05087 | 269 | cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t | 0.002 | |
| cd11969 | 55 | cd11969, SH3_PLCgamma2, Src homology 3 domain of P | 0.002 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 0.003 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 0.003 | |
| cd11926 | 55 | cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain | 0.003 | |
| cd11999 | 56 | cd11999, SH3_PACSIN_like, Src homology 3 domain of | 0.003 | |
| cd11784 | 55 | cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain | 0.003 | |
| cd11978 | 56 | cd11978, SH3_VAV3_2, C-terminal (or second) Src ho | 0.003 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 0.003 | |
| cd05081 | 284 | cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) | 0.003 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 0.004 | |
| cd12076 | 54 | cd12076, SH3_Tks4_2, Second Src homology 3 domain | 0.004 | |
| cd10362 | 101 | cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain | 0.004 | |
| cd10392 | 98 | cd10392, SH2_SHF, Src homology 2 domain found in S | 0.004 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 0.004 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 0.004 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 0.004 | |
| cd10358 | 100 | cd10358, SH2_PTK6_Brk, Src homology 2 domain found | 0.004 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 0.004 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 0.004 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 0.004 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 0.004 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 0.004 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 0.004 |
| >gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins | Back alignment and domain information |
|---|
Score = 152 bits (386), Expect = 1e-44
Identities = 77/155 (49%), Positives = 88/155 (56%), Gaps = 59/155 (38%)
Query: 257 WYVGDMSRQRAESILKQEDKEGCFVVRNSSTKGLYTLSLYTKVPH-PHVKHYHIKQNSRG 315
WYVGDMSRQRAES+LKQEDKEGCFVVRNSSTKGLYT+SL+TKVP PHVKHYHIKQN+R
Sbjct: 8 WYVGDMSRQRAESLLKQEDKEGCFVVRNSSTKGLYTVSLFTKVPGSPHVKHYHIKQNARS 67
Query: 316 EFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQNSRGEF 375
EF+L+EKHC +IPE + +YH
Sbjct: 68 EFYLAEKHCFETIPE-------------------------------LINYH--------- 87
Query: 376 FLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCD 410
+HNSGGLA+RLK CD
Sbjct: 88 ------------------QHNSGGLATRLKYPVCD 104
|
The Tec protein tyrosine kinase is the founding member of a family that includes Btk, Itk, Bmx, and Txk. The members have a PH domain, a zinc-binding motif, a SH3 domain, a SH2 domain, and a protein kinase catalytic domain. Btk is involved in B-cell receptor signaling with mutations in Btk responsible for X-linked agammaglobulinemia (XLA) in humans and X-linked immunodeficiency (xid) in mice. Itk is involved in T-cell receptor signaling. Tec is expressed in both T and B cells, and is thought to function in activated and effector T lymphocytes to induce the expression of genes regulated by NFAT transcription factors. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 104 |
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx | Back alignment and domain information |
|---|
| >gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk | Back alignment and domain information |
|---|
| >gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) | Back alignment and domain information |
|---|
| >gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase expressed in hepatocellular carcinoma) | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) | Back alignment and domain information |
|---|
| >gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) | Back alignment and domain information |
|---|
| >gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called Resting lymphocyte kinase (Rlk) | Back alignment and domain information |
|---|
| >gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) | Back alignment and domain information |
|---|
| >gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor kinase) Protein Tyrosine Kinase (PTK), also called PTK6 | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) | Back alignment and domain information |
|---|
| >gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin | Back alignment and domain information |
|---|
| >gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of Cdc42-Interacting Protein 4, Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein interacting with Nck, 90 kDa (SPIN90) | Back alignment and domain information |
|---|
| >gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) | Back alignment and domain information |
|---|
| >gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor Protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|213002 cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rho GTPase-activating protein 27 | Back alignment and domain information |
|---|
| >gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212784 cd11850, SH3_Abl, Src homology 3 domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho GTPase-activating protein 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212997 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) | Back alignment and domain information |
|---|
| >gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in protein-tyrosine kinase-6 (PTK6) which is also known as breast tumor kinase (Brk) | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 513 | |||
| KOG0197|consensus | 468 | 100.0 | ||
| KOG4278|consensus | 1157 | 100.0 | ||
| KOG0197|consensus | 468 | 99.95 | ||
| KOG0615|consensus | 475 | 99.93 | ||
| KOG0598|consensus | 357 | 99.92 | ||
| KOG0581|consensus | 364 | 99.91 | ||
| KOG0192|consensus | 362 | 99.91 | ||
| KOG0595|consensus | 429 | 99.91 | ||
| KOG0196|consensus | 996 | 99.91 | ||
| KOG0194|consensus | 474 | 99.9 | ||
| KOG0198|consensus | 313 | 99.9 | ||
| KOG0575|consensus | 592 | 99.89 | ||
| KOG1025|consensus | 1177 | 99.89 | ||
| KOG0592|consensus | 604 | 99.89 | ||
| KOG0616|consensus | 355 | 99.89 | ||
| KOG4721|consensus | 904 | 99.88 | ||
| KOG0599|consensus | 411 | 99.88 | ||
| KOG0193|consensus | 678 | 99.88 | ||
| KOG4226|consensus | 379 | 99.88 | ||
| KOG1026|consensus | 774 | 99.87 | ||
| KOG1095|consensus | 1025 | 99.87 | ||
| KOG0578|consensus | 550 | 99.87 | ||
| KOG0591|consensus | 375 | 99.86 | ||
| KOG4278|consensus | 1157 | 99.86 | ||
| KOG0582|consensus | 516 | 99.86 | ||
| KOG4257|consensus | 974 | 99.86 | ||
| KOG0194|consensus | 474 | 99.86 | ||
| KOG0610|consensus | 459 | 99.86 | ||
| KOG0605|consensus | 550 | 99.85 | ||
| KOG0588|consensus | 786 | 99.85 | ||
| KOG0199|consensus | 1039 | 99.85 | ||
| KOG0593|consensus | 396 | 99.84 | ||
| KOG0661|consensus | 538 | 99.83 | ||
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 99.83 | |
| KOG0986|consensus | 591 | 99.83 | ||
| KOG0583|consensus | 370 | 99.83 | ||
| KOG1187|consensus | 361 | 99.82 | ||
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.82 | |
| KOG4279|consensus | 1226 | 99.82 | ||
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 99.82 | |
| KOG0201|consensus | 467 | 99.81 | ||
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.81 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.81 | |
| KOG0200|consensus | 609 | 99.81 | ||
| KOG0694|consensus | 694 | 99.81 | ||
| KOG0667|consensus | 586 | 99.8 | ||
| KOG0604|consensus | 400 | 99.8 | ||
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 99.8 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.8 | |
| KOG1024|consensus | 563 | 99.8 | ||
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.8 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.8 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 99.8 | |
| KOG0584|consensus | 632 | 99.8 | ||
| KOG0597|consensus | 808 | 99.8 | ||
| KOG0589|consensus | 426 | 99.8 | ||
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.8 | |
| KOG0659|consensus | 318 | 99.8 | ||
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.8 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 99.8 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.8 | |
| KOG0033|consensus | 355 | 99.8 | ||
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.8 | |
| KOG0600|consensus | 560 | 99.8 | ||
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.79 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.79 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.79 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.79 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.79 | |
| KOG0660|consensus | 359 | 99.79 | ||
| KOG0984|consensus | 282 | 99.79 | ||
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.79 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 99.79 | |
| KOG0594|consensus | 323 | 99.79 | ||
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.79 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.79 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 99.79 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.79 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.79 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 99.79 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.79 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.79 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.78 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 99.78 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.78 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.78 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.78 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.78 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 99.78 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.78 | |
| KOG0580|consensus | 281 | 99.78 | ||
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.78 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 99.78 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 99.78 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 99.78 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 99.78 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.78 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.77 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.77 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.77 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.77 | |
| KOG0611|consensus | 668 | 99.77 | ||
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 99.77 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 99.77 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 99.77 | |
| KOG4717|consensus | 864 | 99.77 | ||
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.77 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.77 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 99.77 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.77 | |
| KOG1094|consensus | 807 | 99.77 | ||
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.77 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.77 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.77 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.77 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 99.77 | |
| KOG0614|consensus | 732 | 99.77 | ||
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 99.77 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.77 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 99.76 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.76 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.76 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 99.76 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 99.76 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 99.76 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.76 | |
| KOG0608|consensus | 1034 | 99.76 | ||
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 99.76 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 99.76 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.76 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 99.76 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 99.76 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.76 | |
| KOG0607|consensus | 463 | 99.76 | ||
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 99.76 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.76 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.76 | |
| PTZ00284 | 467 | protein kinase; Provisional | 99.75 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.75 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 99.75 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.75 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 99.75 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.75 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 99.75 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.75 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 99.75 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.75 | |
| KOG4250|consensus | 732 | 99.75 | ||
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 99.75 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.75 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 99.75 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 99.75 | |
| KOG0983|consensus | 391 | 99.75 | ||
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 99.75 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 99.75 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 99.75 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.75 | |
| KOG0663|consensus | 419 | 99.75 | ||
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.74 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 99.74 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.74 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 99.74 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 99.74 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 99.74 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.74 | |
| KOG4645|consensus | 1509 | 99.74 | ||
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 99.74 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.74 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.74 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 99.74 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 99.74 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 99.74 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.74 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 99.74 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 99.74 | |
| KOG0577|consensus | 948 | 99.74 | ||
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 99.74 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 99.74 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.74 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 99.74 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 99.74 | |
| KOG0603|consensus | 612 | 99.74 | ||
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 99.73 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 99.73 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 99.73 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.73 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.73 | |
| KOG0585|consensus | 576 | 99.73 | ||
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 99.73 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 99.73 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.73 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 99.73 | |
| KOG0658|consensus | 364 | 99.73 | ||
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 99.73 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.73 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 99.73 | |
| KOG0696|consensus | 683 | 99.73 | ||
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 99.72 | |
| KOG0671|consensus | 415 | 99.72 | ||
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.72 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.72 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 99.72 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.72 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 99.72 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 99.72 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 99.72 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 99.72 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 99.72 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.72 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 99.72 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.72 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 99.72 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 99.72 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 99.72 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 99.72 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 99.72 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 99.72 | |
| KOG0690|consensus | 516 | 99.71 | ||
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 99.71 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 99.71 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 99.71 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 99.71 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 99.71 | |
| KOG0612|consensus | 1317 | 99.71 | ||
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 99.71 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.71 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 99.71 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 99.71 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.71 | |
| KOG0603|consensus | 612 | 99.71 | ||
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 99.71 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 99.71 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.71 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.71 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 99.71 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 99.71 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 99.71 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 99.71 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 99.71 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 99.7 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.7 | |
| KOG0032|consensus | 382 | 99.7 | ||
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 99.7 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 99.7 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 99.7 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 99.7 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 99.7 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 99.7 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 99.7 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 99.7 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.7 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 99.7 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 99.69 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 99.69 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 99.69 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 99.69 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.69 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 99.69 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 99.69 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 99.69 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 99.69 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 99.69 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 99.69 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 99.69 | |
| KOG0574|consensus | 502 | 99.69 | ||
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 99.69 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 99.68 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 99.68 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 99.68 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.68 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 99.68 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 99.68 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.68 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 99.68 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 99.68 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 99.68 | |
| smart00750 | 176 | KIND kinase non-catalytic C-lobe domain. It is an | 99.68 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.68 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 99.68 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.68 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 99.68 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 99.68 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 99.68 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 99.68 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 99.67 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 99.67 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 99.67 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 99.67 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 99.67 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 99.67 | |
| KOG0579|consensus | 1187 | 99.67 | ||
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 99.67 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 99.67 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 99.67 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 99.67 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.67 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 99.67 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.66 | |
| KOG0695|consensus | 593 | 99.66 | ||
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 99.66 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 99.66 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.66 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.66 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 99.66 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 99.66 | |
| KOG0665|consensus | 369 | 99.66 | ||
| KOG0586|consensus | 596 | 99.66 | ||
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 99.66 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 99.66 | |
| KOG1989|consensus | 738 | 99.66 | ||
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 99.65 | |
| KOG1006|consensus | 361 | 99.65 | ||
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 99.65 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 99.65 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 99.65 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 99.65 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 99.65 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 99.65 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 99.64 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 99.64 | |
| KOG1027|consensus | 903 | 99.64 | ||
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 99.64 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 99.64 | |
| KOG4236|consensus | 888 | 99.64 | ||
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 99.64 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 99.64 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 99.64 | |
| KOG0669|consensus | 376 | 99.64 | ||
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.64 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.64 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 99.64 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.64 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 99.64 | |
| KOG0596|consensus | 677 | 99.64 | ||
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 99.64 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 99.64 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.64 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 99.63 | |
| KOG1035|consensus | 1351 | 99.63 | ||
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 99.63 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 99.63 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 99.63 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 99.63 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.63 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 99.63 | |
| KOG2052|consensus | 513 | 99.63 | ||
| KOG2345|consensus | 302 | 99.63 | ||
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 99.63 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 99.63 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 99.62 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 99.62 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 99.62 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 99.62 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 99.62 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 99.62 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 99.62 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 99.61 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 99.61 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 99.61 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 99.61 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 99.61 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 99.61 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 99.61 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 99.61 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 99.61 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.6 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 99.6 | |
| KOG0666|consensus | 438 | 99.6 | ||
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 99.6 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 99.6 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 99.59 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 99.59 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 99.59 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 99.59 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 99.59 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 99.59 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 99.59 | |
| KOG0664|consensus | 449 | 99.59 | ||
| KOG0670|consensus | 752 | 99.59 | ||
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 99.58 | |
| KOG3653|consensus | 534 | 99.58 | ||
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 99.58 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 99.58 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 99.58 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 99.57 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 99.57 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 99.57 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 99.56 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 99.56 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 99.56 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 99.56 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.55 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 99.54 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 99.53 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.53 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 99.53 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 99.52 | |
| KOG0662|consensus | 292 | 99.51 | ||
| KOG0595|consensus | 429 | 99.5 | ||
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 99.48 | |
| KOG1151|consensus | 775 | 99.44 | ||
| KOG1345|consensus | 378 | 99.43 | ||
| KOG1290|consensus | 590 | 99.43 | ||
| KOG1152|consensus | 772 | 99.4 | ||
| KOG0192|consensus | 362 | 99.39 | ||
| KOG0587|consensus | 953 | 99.38 | ||
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 99.37 | |
| KOG1167|consensus | 418 | 99.36 | ||
| KOG0668|consensus | 338 | 99.35 | ||
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 99.35 | |
| KOG0615|consensus | 475 | 99.32 | ||
| KOG0600|consensus | 560 | 99.31 | ||
| KOG1026|consensus | 774 | 99.31 | ||
| KOG1187|consensus | 361 | 99.3 | ||
| KOG1094|consensus | 807 | 99.27 | ||
| KOG0575|consensus | 592 | 99.24 | ||
| KOG0196|consensus | 996 | 99.23 | ||
| KOG0663|consensus | 419 | 99.22 | ||
| KOG4257|consensus | 974 | 99.21 | ||
| KOG0605|consensus | 550 | 99.2 | ||
| KOG1095|consensus | 1025 | 99.2 | ||
| KOG0591|consensus | 375 | 99.17 | ||
| KOG0606|consensus | 1205 | 99.16 | ||
| KOG0581|consensus | 364 | 99.16 | ||
| KOG0580|consensus | 281 | 99.15 | ||
| KOG0593|consensus | 396 | 99.15 | ||
| KOG0597|consensus | 808 | 99.15 | ||
| KOG0598|consensus | 357 | 99.12 | ||
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.12 | |
| KOG0195|consensus | 448 | 99.09 | ||
| KOG0193|consensus | 678 | 99.08 | ||
| KOG0590|consensus | 601 | 99.07 | ||
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 99.06 | |
| KOG0659|consensus | 318 | 99.06 | ||
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.06 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.05 | |
| KOG0574|consensus | 502 | 99.04 | ||
| KOG0611|consensus | 668 | 99.04 | ||
| KOG4721|consensus | 904 | 99.04 | ||
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.04 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.04 | |
| KOG0661|consensus | 538 | 99.04 | ||
| KOG0576|consensus | 829 | 99.03 | ||
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.02 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.02 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.02 | |
| KOG0585|consensus | 576 | 99.02 | ||
| KOG0032|consensus | 382 | 99.02 | ||
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.01 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.01 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 98.99 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 98.99 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 98.99 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 98.99 | |
| KOG0616|consensus | 355 | 98.99 | ||
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 98.98 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 98.98 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 98.97 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 98.97 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 98.97 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 98.96 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 98.96 | |
| KOG1164|consensus | 322 | 98.96 | ||
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 98.96 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 98.96 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 98.95 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 98.94 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 98.94 | |
| KOG0199|consensus | 1039 | 98.94 | ||
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 98.94 | |
| KOG0582|consensus | 516 | 98.93 | ||
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 98.93 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 98.93 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 98.93 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 98.93 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 98.93 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 98.92 | |
| KOG0577|consensus | 948 | 98.92 | ||
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 98.92 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 98.91 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 98.91 | |
| KOG0586|consensus | 596 | 98.91 | ||
| KOG0198|consensus | 313 | 98.91 | ||
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 98.9 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 98.9 | |
| KOG0583|consensus | 370 | 98.9 | ||
| KOG0694|consensus | 694 | 98.9 | ||
| KOG0610|consensus | 459 | 98.89 | ||
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 98.89 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 98.89 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 98.89 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 98.89 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 98.88 | |
| KOG0201|consensus | 467 | 98.88 | ||
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 98.88 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 98.88 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 98.87 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 98.87 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 98.87 | |
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 98.87 |
| >KOG0197|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-34 Score=290.73 Aligned_cols=268 Identities=43% Similarity=0.785 Sum_probs=223.0
Q ss_pred CCCCcEEEEeccCCCCCCCCCCCCCCCE-EEEeecCCccceeeecC-CCccccccCCceeeccccccccccCCCCchhhh
Q psy17476 122 MIRPKVVVALYPFKAIEGGDLSLEKGAE-YEVMDDTQEHWWKVKDK-NGSVGYIPSNYVKEKELLGLQKYDDVNGLTLEL 199 (513)
Q Consensus 122 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~-~g~~g~~pp~~~~~~~~~~~~~~~~~~~~~~~~ 199 (513)
......++++|+|.+....+|.|.+|+. ..+.+.++..||.+++. .+..||+|.|++++..
T Consensus 8 ~~~~~~~valyd~~s~~~~dLsf~~Gd~~~~~~~~~~~~Ww~ar~~~~~~~g~ip~N~v~~~~----------------- 70 (468)
T KOG0197|consen 8 PSHETIVVALYDYASRTPEDLSFRKGDVVLILLETTNGDWWRARSLQLGQEGYIPSNYVARNR----------------- 70 (468)
T ss_pred ccccceEEEeccccCCCccccccccCceEEEeeccCChhHHHHHHhhcCCCCcCcCceeeccc-----------------
Confidence 3445789999999999999999999999 88999999999998887 7889999999987531
Q ss_pred hhhhcccccccccCccccceeeeeeeeecCCCCCCCCCcceeccccccccccCCCCCcCCCCCCHHHHHH-HHcCCCCCc
Q psy17476 200 IHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAES-ILKQEDKEG 278 (513)
Q Consensus 200 ~~~~i~~~~~~~~~Dvws~G~~l~el~t~g~~pf~~~~~~~~~~~i~~~~~~~~p~~w~~~~~~R~~aee-LL~~~~~~g 278 (513)
|..|+.... .++|+++.++|..|++ ++.+.+..|
T Consensus 71 -----------------------------~~~~~~~l~----------------~~~Wf~~~isR~~ae~~ll~p~~~~G 105 (468)
T KOG0197|consen 71 -----------------------------GSPAFIKLS----------------DEPWFFGKISREEAERQLLAPENKEG 105 (468)
T ss_pred -----------------------------cCCCccccc----------------cCCchhccccHHHHHHhhcCCCCCcc
Confidence 222222111 1359999999999995 677788899
Q ss_pred eEEEeecCC-CCceEEEEEeccCCCceeeEEEeeccccceecCCCccccChhhhhccCCcEEEEecCCCCcEEEEEEeee
Q psy17476 279 CFVVRNSST-KGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKV 357 (513)
Q Consensus 279 ~fliR~s~~-~~~~~lsl~~~~~~~~~~~~~i~~~~~g~~~~~~~~~~~~~~~~l~~~g~~LvR~s~~~~~~~lsv~~~~ 357 (513)
.|+||++++ +++|++|++......
T Consensus 106 ~flvR~se~~~g~yslsv~~~~~~~------------------------------------------------------- 130 (468)
T KOG0197|consen 106 AFLVRESESDKGDYSLSVREGDSGG------------------------------------------------------- 130 (468)
T ss_pred ceeeecccCCcCCeeEEEEeccccC-------------------------------------------------------
Confidence 999999964 999999987632111
Q ss_pred CCCccceeEEEEcCCccEE--EecCcccCChhhhhhcccccCCCCccccCcCCCCC---CCCCcccCCCCccccCCcCce
Q psy17476 358 PHPHVKHYHIKQNSRGEFF--LSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDR---PVPATAGLSHDKWEIDPAELM 432 (513)
Q Consensus 358 ~~~~v~h~~I~~~~~~~~~--i~~~~~F~sl~eLi~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~ 432 (513)
....+.||+|.+..++.++ +.+...|.++++++.||+.++.+++.++.. ++.. ..|+...+..+.|+++++.++
T Consensus 131 ~~~~v~hyri~~~~~~~~~~~~~~~~~F~~l~~lv~~~~~~~~gl~~~l~~-p~~~~~~~~p~~~~~~~d~wei~r~~l~ 209 (468)
T KOG0197|consen 131 LGAKVKHYRIRQLDGGGLYPYIDERELFSSLQQLVNYYSKNADGLCTRLRD-PCSKQGHTKPQTPDLARDPWEIPREELK 209 (468)
T ss_pred CccceeeeeeeEcCCCCeecCCCHHHhhhhHHHHHhhhhccCcchhhcccC-chhccCCCCCCCCccccCCeeecHHHHH
Confidence 1346788888887777666 888899999999999999999999988753 4433 556666677899999999999
Q ss_pred eEeEecccccceEEEEEEeCceeeE--EeecCCCCHHHHHHHHHHHhcCCCCceeceeeEEEeCCeeEEEEccCCCC
Q psy17476 433 LLEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFR 507 (513)
Q Consensus 433 ~~~~lG~G~fG~V~~g~~~~~~~v~--~~k~~~~~~~~f~~E~~il~~l~HpNIV~l~g~~~~~~~~~lV~E~~~~G 507 (513)
+.+.||+|.||+|+.|.|++...|+ .+|......++|.+||+||++|+|+|||+|+|+|+.++++|||||||+.|
T Consensus 210 l~~~LG~G~FG~V~~g~~~~~~~vavk~ik~~~m~~~~f~~Ea~iMk~L~H~~lV~l~gV~~~~~piyIVtE~m~~G 286 (468)
T KOG0197|consen 210 LIRELGSGQFGEVWLGKWNGSTKVAVKTIKEGSMSPEAFLREAQIMKKLRHEKLVKLYGVCTKQEPIYIVTEYMPKG 286 (468)
T ss_pred HHHHhcCCccceEEEEEEcCCCcccceEEeccccChhHHHHHHHHHHhCcccCeEEEEEEEecCCceEEEEEecccC
Confidence 9999999999999999999875554 56666777899999999999999999999999999999999999999998
|
|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >KOG0599|consensus | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >KOG0578|consensus | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0588|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >KOG0661|consensus | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >KOG1187|consensus | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG4279|consensus | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >KOG0667|consensus | Back alignment and domain information |
|---|
| >KOG0604|consensus | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >KOG1024|consensus | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >KOG0584|consensus | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >KOG0589|consensus | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >KOG0659|consensus | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0033|consensus | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >KOG0660|consensus | Back alignment and domain information |
|---|
| >KOG0984|consensus | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0594|consensus | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0611|consensus | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >KOG4717|consensus | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >KOG1094|consensus | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG0607|consensus | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >KOG4250|consensus | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >KOG0983|consensus | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >KOG0663|consensus | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >KOG4645|consensus | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >KOG0577|consensus | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >KOG0658|consensus | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >KOG0671|consensus | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >KOG0574|consensus | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >smart00750 KIND kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0579|consensus | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0665|consensus | Back alignment and domain information |
|---|
| >KOG0586|consensus | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >KOG1989|consensus | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >KOG1006|consensus | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >KOG1027|consensus | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >KOG0669|consensus | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >KOG0596|consensus | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1035|consensus | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >KOG2052|consensus | Back alignment and domain information |
|---|
| >KOG2345|consensus | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >KOG0666|consensus | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >KOG0664|consensus | Back alignment and domain information |
|---|
| >KOG0670|consensus | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG3653|consensus | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0662|consensus | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >KOG1151|consensus | Back alignment and domain information |
|---|
| >KOG1345|consensus | Back alignment and domain information |
|---|
| >KOG1290|consensus | Back alignment and domain information |
|---|
| >KOG1152|consensus | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >KOG0587|consensus | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG1167|consensus | Back alignment and domain information |
|---|
| >KOG0668|consensus | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0615|consensus | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG1187|consensus | Back alignment and domain information |
|---|
| >KOG1094|consensus | Back alignment and domain information |
|---|
| >KOG0575|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG0663|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >KOG0581|consensus | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >KOG0593|consensus | Back alignment and domain information |
|---|
| >KOG0597|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >KOG0590|consensus | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG0659|consensus | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >KOG0574|consensus | Back alignment and domain information |
|---|
| >KOG0611|consensus | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >KOG0661|consensus | Back alignment and domain information |
|---|
| >KOG0576|consensus | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >KOG0585|consensus | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG1164|consensus | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG0582|consensus | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0577|consensus | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0586|consensus | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 513 | ||||
| 3gen_A | 283 | The 1.6 A Crystal Structure Of Human Bruton's Tyros | 2e-31 | ||
| 3k54_A | 283 | Structures Of Human Bruton's Tyrosine Kinase In Act | 2e-31 | ||
| 3pix_A | 274 | Crystal Structure Of Btk Kinase Domain Complexed Wi | 2e-30 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 1e-28 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 1e-28 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 2e-28 | ||
| 3ocs_A | 271 | Crystal Structure Of Bruton's Tyrosine Kinase In Co | 4e-28 | ||
| 3p08_A | 267 | Crystal Structure Of The Human Btk Kinase Domain Le | 4e-28 | ||
| 3oct_A | 265 | Crystal Structure Of Bruton's Tyrosine Kinase Mutan | 5e-28 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 8e-28 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 1e-27 | ||
| 1k2p_A | 263 | Crystal Structure Of Bruton's Tyrosine Kinase Domai | 2e-26 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 2e-23 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 3e-23 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 3e-23 | ||
| 3sxr_A | 268 | Crystal Structure Of Bmx Non-Receptor Tyrosine Kina | 3e-22 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 7e-22 | ||
| 1ad5_A | 438 | Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | 7e-22 | ||
| 3t9t_A | 267 | Crystal Structure Of Btk Mutant (F435t,K596r) Compl | 4e-20 | ||
| 4hct_A | 269 | Crystal Structure Of Itk In Complex With Compound 5 | 2e-19 | ||
| 3qgw_A | 286 | Crystal Structure Of Itk Kinase Bound To An Inhibit | 7e-19 | ||
| 3miy_A | 266 | X-Ray Crystal Structure Of Itk Complexed With Sunit | 5e-18 | ||
| 1sm2_A | 264 | Crystal Structure Of The Phosphorylated Interleukin | 6e-18 | ||
| 3v5j_A | 266 | Crystal Structure Of Interleukin-2 Inducible T-Cell | 6e-18 | ||
| 2dq7_X | 283 | Crystal Structure Of Fyn Kinase Domain Complexed Wi | 3e-16 | ||
| 2hwo_A | 286 | Crystal Structure Of Src Kinase Domain In Complex W | 4e-16 | ||
| 2oiq_A | 286 | Crystal Structure Of Chicken C-Src Kinase Domain In | 4e-16 | ||
| 3geq_A | 286 | Structural Basis For The Chemical Rescue Of Src Kin | 4e-16 | ||
| 1yol_A | 283 | Crystal Structure Of Src Kinase Domain In Complex W | 4e-16 | ||
| 1yoj_A | 283 | Crystal Structure Of Src Kinase Domain Length = 283 | 4e-16 | ||
| 3oez_A | 286 | Crystal Structure Of The L317i Mutant Of The Chicke | 8e-16 | ||
| 3dk6_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 1e-15 | ||
| 3g6h_A | 286 | Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma | 2e-15 | ||
| 3svv_A | 286 | Crystal Structure Of T338c C-Src Covalently Bound T | 2e-15 | ||
| 3dqw_A | 286 | C-Src Kinase Domain Thr338ile Mutant In Complex Wit | 2e-15 | ||
| 2ekx_A | 110 | Solution Structure Of The Human Bmx Sh2 Domain Leng | 2e-15 | ||
| 2qq7_A | 286 | Crystal Structure Of Drug Resistant Src Kinase Doma | 2e-15 | ||
| 2hz0_A | 270 | Abl Kinase Domain In Complex With Nvp-Aeg082 Length | 3e-15 | ||
| 3dk3_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 3e-15 | ||
| 3qri_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain I | 3e-15 | ||
| 3pyy_A | 298 | Discovery And Characterization Of A Cell-Permeable, | 3e-15 | ||
| 2hyy_A | 273 | Human Abl Kinase Domain In Complex With Imatinib (S | 3e-15 | ||
| 2gqg_A | 278 | X-Ray Crystal Structure Of Dasatinib (Bms-354825) B | 3e-15 | ||
| 2hzi_A | 277 | Abl Kinase Domain In Complex With Pd180970 Length = | 3e-15 | ||
| 2g2f_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 3e-15 | ||
| 2g1t_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 3e-15 | ||
| 3oxz_A | 284 | Crystal Structure Of Abl Kinase Domain Bound With A | 3e-15 | ||
| 1fpu_A | 293 | Crystal Structure Of Abl Kinase Domain In Complex W | 3e-15 | ||
| 2f4j_A | 287 | Structure Of The Kinase Domain Of An Imatinib-Resis | 3e-15 | ||
| 2qoh_A | 288 | Crystal Structure Of Abl Kinase Bound With Ppy-a Le | 3e-15 | ||
| 2e2b_A | 293 | Crystal Structure Of The C-Abl Kinase Domain In Com | 3e-15 | ||
| 2hiw_A | 287 | Crystal Structure Of Inactive Conformation Abl Kina | 3e-15 | ||
| 2bdf_A | 279 | Src Kinase In Complex With Inhibitor Ap23451 Length | 4e-15 | ||
| 2ofv_A | 277 | Crystal Structure Of Aminoquinazoline 1 Bound To Lc | 1e-14 | ||
| 2zm1_A | 285 | Crystal Structure Of Imidazo Pyrazin 1 Bound To The | 1e-14 | ||
| 3bys_A | 277 | Co-Crystal Structure Of Lck And Aminopyrimidine Ami | 1e-14 | ||
| 2pl0_A | 289 | Lck Bound To Imatinib Length = 289 | 1e-14 | ||
| 3kxz_A | 287 | The Complex Crystal Structure Of Lck With A Probe M | 1e-14 | ||
| 2of2_A | 271 | Crystal Structure Of Furanopyrimidine 8 Bound To Lc | 1e-14 | ||
| 1qpe_A | 279 | Structural Analysis Of The Lymphocyte-Specific Kina | 1e-14 | ||
| 3qrj_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain T | 1e-14 | ||
| 2og8_A | 265 | Crystal Structure Of Aminoquinazoline 36 Bound To L | 1e-14 | ||
| 3kmm_A | 288 | Structure Of Human Lck Kinase With A Small Molecule | 1e-14 | ||
| 2ofu_A | 273 | X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam | 1e-14 | ||
| 3lck_A | 271 | The Kinase Domain Of Human Lymphocyte Kinase (Lck), | 1e-14 | ||
| 2z60_A | 288 | Crystal Structure Of The T315i Mutant Of Abl Kinase | 1e-14 | ||
| 2v7a_A | 286 | Crystal Structure Of The T315i Abl Mutant In Comple | 1e-14 | ||
| 3oy3_A | 284 | Crystal Structure Of Abl T315i Mutant Kinase Domain | 1e-14 | ||
| 3bym_A | 272 | X-Ray Co-Crystal Structure Aminobenzimidazole Triaz | 1e-14 | ||
| 2ge9_A | 125 | Solution Structures Of The Sh2 Domain Of Bruton's T | 2e-14 | ||
| 3gvu_A | 292 | The Crystal Structure Of Human Abl2 In Complex With | 2e-14 | ||
| 3d7u_B | 277 | Structural Basis For The Recognition Of C-Src By It | 2e-14 | ||
| 3dk7_A | 277 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-14 | ||
| 3a4o_X | 286 | Lyn Kinase Domain Length = 286 | 2e-14 | ||
| 2zv7_A | 279 | Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | 3e-14 | ||
| 3mpm_A | 267 | Lck Complexed With A Pyrazolopyrimidine Length = 26 | 5e-14 | ||
| 3s9k_A | 118 | Crystal Structure Of The Itk Sh2 Domain Length = 11 | 6e-14 | ||
| 3u4w_A | 275 | Src In Complex With Dna-Templated Macrocyclic Inhib | 1e-13 | ||
| 1k9a_A | 450 | Crystal Structure Analysis Of Full-Length Carboxyl- | 1e-13 | ||
| 1lui_A | 110 | Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform | 2e-13 | ||
| 2etz_A | 109 | The Nmr Minimized Average Structure Of The Itk Sh2 | 2e-13 | ||
| 1yi6_A | 276 | C-Term Tail Segment Of Human Tyrosine Kinase (258-5 | 2e-13 | ||
| 1qpd_A | 279 | Structural Analysis Of The Lymphocyte-specific Kina | 2e-13 | ||
| 2k79_B | 110 | Solution Structure Of The Binary Complex Between Th | 2e-13 | ||
| 1gl5_A | 67 | Nmr Structure Of The Sh3 Domain From The Tec Protei | 2e-13 | ||
| 2dm0_A | 125 | Solution Structure Of The Sh2 Domain Of Human Tyros | 3e-13 | ||
| 3bkb_A | 377 | Crystal Structure Of Human Feline Sarcoma Viral Onc | 1e-11 | ||
| 3cd3_A | 377 | Crystal Structure Of Phosphorylated Human Feline Sa | 1e-11 | ||
| 2hk5_A | 270 | Hck Kinase In Complex With Lck Targetted Inhibitor | 3e-11 | ||
| 3v5q_A | 297 | Discovery Of A Selective Trk Inhibitor With Efficac | 4e-11 | ||
| 3v5q_A | 297 | Discovery Of A Selective Trk Inhibitor With Efficac | 8e-05 | ||
| 1qly_A | 58 | Nmr Study Of The Sh3 Domain From Bruton's Tyrosine | 4e-11 | ||
| 1aww_A | 67 | Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 S | 6e-11 | ||
| 4aoj_A | 329 | Human Trka In Complex With The Inhibitor Az-23 Leng | 8e-11 | ||
| 4aoj_A | 329 | Human Trka In Complex With The Inhibitor Az-23 Leng | 2e-05 | ||
| 4gt5_A | 306 | Crystal Structure Of The Inactive Trka Kinase Domai | 8e-11 | ||
| 4gt5_A | 306 | Crystal Structure Of The Inactive Trka Kinase Domai | 1e-05 | ||
| 4f0i_A | 300 | Crystal Structure Of Apo Trka Length = 300 | 9e-11 | ||
| 4f0i_A | 300 | Crystal Structure Of Apo Trka Length = 300 | 2e-05 | ||
| 2yuq_A | 85 | Solution Structure Of The Sh3 Domain Of Human Tyros | 2e-10 | ||
| 4id7_A | 273 | Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- | 5e-10 | ||
| 4hzs_A | 341 | Crystal Structure Of Ack1 Kinase Domain With C-term | 5e-10 | ||
| 4ewh_B | 275 | Co-Crystal Structure Of Ack1 With Inhibitor Length | 5e-10 | ||
| 3eqp_B | 276 | Crystal Structure Of Ack1 With Compound T95 Length | 5e-10 | ||
| 4hzr_A | 277 | Crystal Structure Of Ack1 Kinase Domain Length = 27 | 5e-10 | ||
| 1u46_A | 291 | Crystal Structure Of The Unphosphorylated Kinase Do | 6e-10 | ||
| 1u54_A | 291 | Crystal Structures Of The Phosphorylated And Unphos | 6e-10 | ||
| 4asz_A | 299 | Crystal Structure Of Apo Trkb Kinase Domain Length | 1e-09 | ||
| 4fl2_A | 636 | Structural And Biophysical Characterization Of The | 2e-09 | ||
| 4fl2_A | 636 | Structural And Biophysical Characterization Of The | 1e-04 | ||
| 4fl3_A | 635 | Structural And Biophysical Characterization Of The | 2e-09 | ||
| 4fl3_A | 635 | Structural And Biophysical Characterization Of The | 2e-04 | ||
| 3emg_A | 291 | Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami | 2e-09 | ||
| 3tub_A | 293 | Crystal Structure Of Syk Kinase Domain With 1-(5-(6 | 2e-09 | ||
| 3vf8_A | 299 | Crystal Structure Of Spleen Tyrosine Kinase Syk Cat | 2e-09 | ||
| 1xba_A | 291 | Crystal Structure Of Apo Syk Tyrosine Kinase Domain | 2e-09 | ||
| 3srv_A | 277 | Crystal Structure Of Spleen Tyrosine Kinase (Syk) I | 2e-09 | ||
| 3srv_B | 277 | Crystal Structure Of Spleen Tyrosine Kinase (Syk) I | 2e-09 | ||
| 4f4p_A | 273 | Syk In Complex With Ligand Lasw836 Length = 273 | 2e-09 | ||
| 4dfl_A | 274 | Crystal Structure Of Spleen Tyrosine Kinase Complex | 2e-09 | ||
| 2lmj_A | 66 | Itk-Sh3 Length = 66 | 3e-09 | ||
| 1byg_A | 278 | Kinase Domain Of Human C-Terminal Src Kinase (Csk) | 3e-09 | ||
| 3d7u_A | 263 | Structural Basis For The Recognition Of C-Src By It | 3e-09 | ||
| 3d7t_A | 269 | Structural Basis For The Recognition Of C-Src By It | 3e-09 | ||
| 2ozo_A | 613 | Autoinhibited Intact Human Zap-70 Length = 613 | 5e-09 | ||
| 2ozo_A | 613 | Autoinhibited Intact Human Zap-70 Length = 613 | 7e-07 | ||
| 1u59_A | 287 | Crystal Structure Of The Zap-70 Kinase Domain In Co | 8e-09 | ||
| 1u59_A | 287 | Crystal Structure Of The Zap-70 Kinase Domain In Co | 1e-04 | ||
| 1awj_A | 77 | Intramolecular Itk-Proline Complex, Nmr, Minimized | 2e-08 | ||
| 1mqb_A | 333 | Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro | 3e-08 | ||
| 1mqb_A | 333 | Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro | 3e-06 | ||
| 2k79_A | 63 | Solution Structure Of The Binary Complex Between Th | 3e-08 | ||
| 2rn8_A | 64 | Nmr Structure Note: Murine Itk Sh3 Domain Length = | 3e-08 | ||
| 2oo8_X | 317 | Synthesis, Structural Analysis, And Sar Studies Of | 5e-08 | ||
| 1fvr_A | 327 | Tie2 Kinase Domain Length = 327 | 5e-08 | ||
| 2wqb_A | 324 | Structure Of The Tie2 Kinase Domain In Complex With | 5e-08 | ||
| 2rei_A | 318 | Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep | 5e-08 | ||
| 2rei_A | 318 | Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep | 2e-04 | ||
| 2j0k_A | 656 | Crystal Structure Of A Fragment Of Focal Adhesion K | 9e-08 | ||
| 2j0j_A | 656 | Crystal Structure Of A Fragment Of Focal Adhesion K | 9e-08 | ||
| 4fob_A | 353 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 1e-07 | ||
| 1luf_A | 343 | Crystal Structure Of The Musk Tyrosine Kinase: Insi | 1e-07 | ||
| 3l9p_A | 367 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 1e-07 | ||
| 2y6m_A | 291 | Crystal Structure Of Epha4 Kinase Domain Length = 2 | 1e-07 | ||
| 2y6m_A | 291 | Crystal Structure Of Epha4 Kinase Domain Length = 2 | 5e-05 | ||
| 4fnw_A | 327 | Crystal Structure Of The Apo F1174l Anaplastic Lymp | 1e-07 | ||
| 4fnw_A | 327 | Crystal Structure Of The Apo F1174l Anaplastic Lymp | 6e-04 | ||
| 2hel_A | 306 | Crystal Structure Of A Mutant Epha4 Kinase Domain ( | 1e-07 | ||
| 2hel_A | 306 | Crystal Structure Of A Mutant Epha4 Kinase Domain ( | 5e-05 | ||
| 4dce_A | 333 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 1e-07 | ||
| 3aox_A | 344 | X-Ray Crystal Structure Of Human Anaplastic Lymphom | 1e-07 | ||
| 4fnx_A | 327 | Crystal Structure Of The Apo R1275q Anaplastic Lymp | 1e-07 | ||
| 4fnz_A | 327 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 1e-07 | ||
| 2yjs_A | 342 | Structure Of C1156y Mutant Anaplastic Lymphoma Kina | 1e-07 | ||
| 2xyu_A | 285 | Crystal Structure Of Epha4 Kinase Domain In Complex | 1e-07 | ||
| 2xyu_A | 285 | Crystal Structure Of Epha4 Kinase Domain In Complex | 5e-05 | ||
| 3lct_A | 344 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 1e-07 | ||
| 2yhv_A | 342 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 1e-07 | ||
| 2yjr_A | 342 | Structure Of F1174l Mutant Anaplastic Lymphoma Kina | 1e-07 | ||
| 2yjr_A | 342 | Structure Of F1174l Mutant Anaplastic Lymphoma Kina | 6e-04 | ||
| 2r2p_A | 295 | Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep | 1e-07 | ||
| 2r2p_A | 295 | Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep | 1e-04 | ||
| 2etm_A | 281 | Crystal Structure Of Focal Adhesion Kinase Domain C | 1e-07 | ||
| 2yfx_A | 327 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 1e-07 | ||
| 2xp2_A | 327 | Structure Of The Human Anaplastic Lymphoma Kinase I | 1e-07 | ||
| 2xb7_A | 315 | Structure Of Human Anaplastic Lymphoma Kinase In Co | 1e-07 | ||
| 2j0l_A | 276 | Crystal Structure Of A The Active Conformation Of T | 1e-07 | ||
| 3bz3_A | 276 | Crystal Structure Analysis Of Focal Adhesion Kinase | 1e-07 | ||
| 1mp8_A | 281 | Crystal Structure Of Focal Adhesion Kinase (Fak) Le | 1e-07 | ||
| 4ebw_A | 304 | Structure Of Focal Adhesion Kinase Catalytic Domain | 1e-07 | ||
| 3pxk_A | 282 | Focal Adhesion Kinase Catalytic Domain In Complex W | 1e-07 | ||
| 2jkk_A | 276 | Focal Adhesion Kinase Catalytic Domain In Complex W | 1e-07 | ||
| 2jkm_A | 276 | Focal Adhesion Kinase Catalytic Domain In Complex W | 1e-07 | ||
| 2j0m_B | 276 | Crystal Structure A Two-Chain Complex Between The F | 1e-07 | ||
| 3lmg_A | 344 | Crystal Structure Of The Erbb3 Kinase Domain In Com | 1e-07 | ||
| 1jpa_A | 312 | Crystal Structure Of Unphosphorylated Ephb2 Recepto | 1e-07 | ||
| 1jpa_A | 312 | Crystal Structure Of Unphosphorylated Ephb2 Recepto | 1e-04 | ||
| 3kex_A | 325 | Crystal Structure Of The Catalytically Inactive Kin | 2e-07 | ||
| 2hen_A | 286 | Crystal Structure Of The Ephb2 Receptor Kinase Doma | 2e-07 | ||
| 2hen_A | 286 | Crystal Structure Of The Ephb2 Receptor Kinase Doma | 1e-04 | ||
| 3kul_A | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 2e-07 | ||
| 3kul_A | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 3e-04 | ||
| 3kul_B | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 2e-07 | ||
| 3kul_B | 325 | Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep | 3e-04 | ||
| 3fxx_A | 371 | Human Epha3 Kinase And Juxtamembrane Region Bound T | 2e-07 | ||
| 3fxx_A | 371 | Human Epha3 Kinase And Juxtamembrane Region Bound T | 7e-06 | ||
| 2qo7_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Dephos | 2e-07 | ||
| 2qo7_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Dephos | 7e-06 | ||
| 2gsf_A | 373 | The Human Epha3 Receptor Tyrosine Kinase And Juxtam | 2e-07 | ||
| 2gsf_A | 373 | The Human Epha3 Receptor Tyrosine Kinase And Juxtam | 7e-06 | ||
| 2qon_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 2e-07 | ||
| 2qon_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 8e-06 | ||
| 2qof_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f | 2e-07 | ||
| 2qof_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f | 8e-06 | ||
| 2qod_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y602f | 2e-07 | ||
| 2qod_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y602f | 8e-06 | ||
| 2qok_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 2e-07 | ||
| 2qok_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 8e-06 | ||
| 3cc6_A | 281 | Crystal Structure Of Kinase Domain Of Protein Tyros | 2e-07 | ||
| 2qoi_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 2e-07 | ||
| 2qoi_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 8e-06 | ||
| 3fzo_A | 277 | Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin | 2e-07 | ||
| 2qol_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596:y | 2e-07 | ||
| 2qol_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596:y | 8e-06 | ||
| 4h1j_A | 293 | Crystal Structure Of Pyk2 With The Pyrazole 13a Len | 2e-07 | ||
| 2qoo_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 2e-07 | ||
| 2qoo_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 8e-06 | ||
| 2qoc_A | 344 | Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp | 2e-07 | ||
| 2qoc_A | 344 | Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp | 8e-06 | ||
| 2qob_A | 344 | Human Epha3 Kinase Domain, Base Structure Length = | 2e-07 | ||
| 2qob_A | 344 | Human Epha3 Kinase Domain, Base Structure Length = | 8e-06 | ||
| 3dzq_A | 361 | Human Epha3 Kinase Domain In Complex With Inhibitor | 2e-07 | ||
| 3dzq_A | 361 | Human Epha3 Kinase Domain In Complex With Inhibitor | 8e-06 | ||
| 3h0h_A | 73 | Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Le | 2e-07 | ||
| 1efn_A | 59 | Hiv-1 Nef Protein In Complex With R96i Mutant Fyn S | 3e-07 | ||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 5e-07 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 5e-07 | ||
| 2hda_A | 64 | Yes Sh3 Domain Length = 64 | 6e-07 | ||
| 2yt6_A | 109 | Solution Structure Of The Sh3_1 Domain Of Yamaguchi | 7e-07 | ||
| 3bbt_B | 328 | Crystal Structure Of The Erbb4 Kinase In Complex Wi | 7e-07 | ||
| 3bbt_B | 328 | Crystal Structure Of The Erbb4 Kinase In Complex Wi | 4e-04 | ||
| 2eva_A | 307 | Structural Basis For The Interaction Of Tak1 Kinase | 8e-07 | ||
| 2r4b_A | 321 | Erbb4 Kinase Domain Complexed With A Thienopyrimidi | 8e-07 | ||
| 2r4b_A | 321 | Erbb4 Kinase Domain Complexed With A Thienopyrimidi | 4e-04 | ||
| 4gs6_A | 315 | Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz | 9e-07 | ||
| 4gt4_A | 308 | Structure Of Unliganded, Inactive Ror2 Kinase Domai | 9e-07 | ||
| 4gt4_A | 308 | Structure Of Unliganded, Inactive Ror2 Kinase Domai | 2e-04 | ||
| 3zzw_A | 289 | Crystal Structure Of The Kinase Domain Of Ror2 Leng | 1e-06 | ||
| 3zzw_A | 289 | Crystal Structure Of The Kinase Domain Of Ror2 Leng | 2e-04 | ||
| 2vwu_A | 302 | Ephb4 Kinase Domain Inhibitor Complex Length = 302 | 1e-06 | ||
| 2vwu_A | 302 | Ephb4 Kinase Domain Inhibitor Complex Length = 302 | 2e-05 | ||
| 1wlp_B | 138 | Solution Structure Of The P22phox-P47phox Complex L | 1e-06 | ||
| 4aw5_A | 291 | Complex Of The Ephb4 Kinase Domain With An Oxindole | 1e-06 | ||
| 4aw5_A | 291 | Complex Of The Ephb4 Kinase Domain With An Oxindole | 2e-05 | ||
| 3omv_A | 307 | Crystal Structure Of C-Raf (Raf-1) Length = 307 | 1e-06 | ||
| 3h0f_A | 73 | Crystal Structure Of The Human Fyn Sh3 R96w Mutant | 2e-06 | ||
| 4ag2_C | 84 | Human Chymase - Fynomer Complex Length = 84 | 2e-06 | ||
| 3ua6_A | 64 | Crystal Structure Of The Human Fyn Sh3 Domain Lengt | 2e-06 | ||
| 1fyn_A | 62 | Phosphotransferase Length = 62 | 2e-06 | ||
| 1m27_C | 61 | Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX | 2e-06 | ||
| 1a0n_B | 69 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 2e-06 | ||
| 1azg_B | 67 | Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene | 3e-06 | ||
| 3nhn_A | 193 | Crystal Structure Of The Src-Family Kinase Hck Sh3- | 3e-06 | ||
| 1shf_A | 59 | Crystal Structure Of The Sh3 Domain In Human Fyn; C | 3e-06 | ||
| 2ivs_A | 314 | Crystal Structure Of Non-Phosphorylated Ret Tyrosin | 3e-06 | ||
| 4d8d_A | 58 | Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant | 3e-06 | ||
| 1avz_C | 57 | V-1 Nef Protein In Complex With Wild Type Fyn Sh3 D | 3e-06 | ||
| 2ivt_A | 314 | Crystal Structure Of Phosphorylated Ret Tyrosine Ki | 3e-06 | ||
| 3lvp_A | 336 | Crystal Structure Of Bisphosphorylated Igf1-R Kinas | 3e-06 | ||
| 3lvp_A | 336 | Crystal Structure Of Bisphosphorylated Igf1-R Kinas | 2e-04 | ||
| 1p4o_A | 322 | Structure Of Apo Unactivated Igf-1r Kinase Domain A | 3e-06 | ||
| 1p4o_A | 322 | Structure Of Apo Unactivated Igf-1r Kinase Domain A | 3e-04 | ||
| 3lw0_A | 304 | Igf-1rk In Complex With Ligand Msc1609119a-1 Length | 3e-06 | ||
| 3lw0_A | 304 | Igf-1rk In Complex With Ligand Msc1609119a-1 Length | 2e-04 | ||
| 2ivv_A | 314 | Crystal Structure Of Phosphorylated Ret Tyrosine Ki | 3e-06 | ||
| 1m7n_A | 322 | Crystal Structure Of Unactivated Apo Insulin-Like G | 3e-06 | ||
| 1m7n_A | 322 | Crystal Structure Of Unactivated Apo Insulin-Like G | 3e-04 | ||
| 3i81_A | 315 | Crystal Structure Of Insulin-Like Growth Factor 1 R | 3e-06 | ||
| 3i81_A | 315 | Crystal Structure Of Insulin-Like Growth Factor 1 R | 3e-04 | ||
| 1jqh_A | 308 | Igf-1 Receptor Kinase Domain Length = 308 | 3e-06 | ||
| 1jqh_A | 308 | Igf-1 Receptor Kinase Domain Length = 308 | 3e-04 | ||
| 3o23_A | 305 | Human Unphosphorylated Igf1-R Kinase Domain In Comp | 3e-06 | ||
| 3o23_A | 305 | Human Unphosphorylated Igf1-R Kinase Domain In Comp | 3e-04 | ||
| 3d94_A | 301 | Crystal Structure Of The Insulin-Like Growth Factor | 3e-06 | ||
| 3d94_A | 301 | Crystal Structure Of The Insulin-Like Growth Factor | 3e-04 | ||
| 1k3a_A | 299 | Structure Of The Insulin-Like Growth Factor 1 Recep | 3e-06 | ||
| 1k3a_A | 299 | Structure Of The Insulin-Like Growth Factor 1 Recep | 3e-04 | ||
| 2zm3_A | 308 | Complex Structure Of Insulin-Like Growth Factor Rec | 3e-06 | ||
| 2zm3_A | 308 | Complex Structure Of Insulin-Like Growth Factor Rec | 3e-04 | ||
| 3qqu_A | 301 | Cocrystal Structure Of Unphosphorylated Igf With Py | 3e-06 | ||
| 3qqu_A | 301 | Cocrystal Structure Of Unphosphorylated Igf With Py | 3e-04 | ||
| 2oj9_A | 307 | Structure Of Igf-1r Kinase Domain Complexed With A | 3e-06 | ||
| 2oj9_A | 307 | Structure Of Igf-1r Kinase Domain Complexed With A | 3e-04 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 3e-06 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 4e-05 | ||
| 1u5s_A | 71 | Nmr Structure Of The Complex Between Nck-2 Sh3 Doma | 4e-06 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 4e-06 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 2e-05 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 5e-05 | ||
| 2pzp_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 4e-06 | ||
| 2fry_A | 61 | Solution Structure Of The Third Sh3 Domain Of Human | 4e-06 | ||
| 1wx6_A | 91 | Solution Structure Of The Sh3 Domain Of The Human C | 4e-06 | ||
| 2p0c_A | 313 | Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro | 5e-06 | ||
| 3q96_A | 282 | B-Raf Kinase Domain In Complex With A Tetrahydronap | 6e-06 | ||
| 4dbn_A | 284 | Crystal Structure Of The Kinase Domain Of Human B-R | 6e-06 | ||
| 2fb8_A | 281 | Structure Of The B-Raf Kinase Domain Bound To Sb-59 | 7e-06 | ||
| 3idp_A | 300 | B-Raf V600e Kinase Domain In Complex With An Aminoi | 7e-06 | ||
| 3c4c_A | 280 | B-Raf Kinase In Complex With Plx4720 Length = 280 | 7e-06 | ||
| 4fk3_A | 292 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 7e-06 | ||
| 4g9r_A | 307 | B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr | 7e-06 | ||
| 3d4q_A | 307 | Pyrazole-Based Inhibitors Of B-Raf Kinase Length = | 7e-06 | ||
| 3ii5_A | 306 | The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi | 8e-06 | ||
| 3hng_A | 360 | Crystal Structure Of Vegfr1 In Complex With N-(4-ch | 8e-06 | ||
| 1uec_A | 193 | Crystal Structure Of Autoinhibited Form Of Tandem S | 9e-06 | ||
| 1ng2_A | 193 | Structure Of Autoinhibited P47phox Length = 193 | 9e-06 | ||
| 1aot_F | 106 | Nmr Structure Of The Fyn Sh2 Domain Complexed With | 1e-05 | ||
| 3pp0_A | 338 | Crystal Structure Of The Kinase Domain Of Human Her | 1e-05 | ||
| 3qwy_A | 308 | Ced-2 Length = 308 | 1e-05 | ||
| 2pvy_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-05 | ||
| 2pzr_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-05 | ||
| 3cly_A | 334 | Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase | 1e-05 | ||
| 2pvf_A | 334 | Crystal Structure Of Tyrosine Phosphorylated Activa | 1e-05 | ||
| 2pwl_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-05 | ||
| 3qwx_X | 174 | Ced-2 1-174 Length = 174 | 1e-05 | ||
| 2pz5_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 1e-05 | ||
| 1a1a_A | 107 | C-Src (Sh2 Domain With C188a Mutation) Complexed Wi | 1e-05 | ||
| 1a1a_A | 107 | C-Src (Sh2 Domain With C188a Mutation) Complexed Wi | 4e-05 | ||
| 4h58_A | 275 | Braf In Complex With Compound 3 Length = 275 | 2e-05 | ||
| 1uwj_A | 276 | The Complex Of Mutant V599e B-raf And Bay439006 Len | 2e-05 | ||
| 2dly_A | 121 | Solution Structure Of The Sh2 Domain Of Murine Fyn- | 2e-05 | ||
| 2psq_A | 370 | Crystal Structure Of Unphosphorylated Unactivated W | 2e-05 | ||
| 3qup_A | 323 | Inhibitor Bound Structure Of The Kinase Domain Of T | 2e-05 | ||
| 3pls_A | 298 | Ron In Complex With Ligand Amp-Pnp Length = 298 | 2e-05 | ||
| 3b2t_A | 311 | Structure Of Phosphotransferase Length = 311 | 2e-05 | ||
| 1p14_A | 306 | Crystal Structure Of A Catalytic-Loop Mutant Of The | 2e-05 | ||
| 3ri1_A | 313 | Crystal Structure Of The Catalytic Domain Of Fgfr2 | 2e-05 | ||
| 1gjo_A | 316 | The Fgfr2 Tyrosine Kinase Domain Length = 316 | 2e-05 | ||
| 4afz_C | 84 | Human Chymase - Fynomer Complex Length = 84 | 2e-05 | ||
| 3ekk_A | 307 | Insulin Receptor Kinase Complexed With An Inhibitor | 2e-05 | ||
| 1i44_A | 306 | Crystallographic Studies Of An Activation Loop Muta | 2e-05 | ||
| 2q0b_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-05 | ||
| 2q0b_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 3e-05 | ||
| 2py3_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-05 | ||
| 2py3_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 2e-05 | ||
| 1rqq_A | 306 | Crystal Structure Of The Insulin Receptor Kinase In | 2e-05 | ||
| 1irk_A | 306 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-05 | ||
| 1ir3_A | 306 | Phosphorylated Insulin Receptor Tyrosine Kinase In | 2e-05 | ||
| 1x2q_A | 88 | Solution Structure Of The Sh3 Domain Of The Signal | 2e-05 | ||
| 1prl_C | 64 | Two Binding Orientations For Peptides To Src Sh3 Do | 3e-05 | ||
| 2z8c_A | 303 | Phosphorylated Insulin Receptor Tyrosine Kinase In | 3e-05 | ||
| 1bkl_A | 113 | Self-Associated Apo Src Sh2 Domain Length = 113 | 3e-05 | ||
| 1bkl_A | 113 | Self-Associated Apo Src Sh2 Domain Length = 113 | 5e-04 | ||
| 1rjb_A | 344 | Crystal Structure Of Flt3 Length = 344 | 3e-05 | ||
| 4hck_A | 72 | Human Hck Sh3 Domain, Nmr, 25 Structures Length = 7 | 3e-05 | ||
| 1bu1_A | 57 | Src Family Kinase Hck Sh3 Domain Length = 57 | 3e-05 | ||
| 1ov3_A | 138 | Structure Of The P22phox-P47phox Complex Length = 1 | 3e-05 | ||
| 1o4c_A | 108 | Crystal Structure Of Sh2 In Complex With Phosphate. | 3e-05 | ||
| 1o4c_A | 108 | Crystal Structure Of Sh2 In Complex With Phosphate. | 6e-05 | ||
| 1shd_A | 107 | Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In | 3e-05 | ||
| 1shd_A | 107 | Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In | 8e-05 | ||
| 4hxj_A | 60 | Crystal Structure Of Sh3:rgt Complex Length = 60 | 3e-05 | ||
| 2oi3_A | 86 | Nmr Structure Analysis Of The Hematopoetic Cell Kin | 4e-05 | ||
| 1o41_A | 108 | Crystal Structure Of Sh2 In Complex With Ru78300. L | 4e-05 | ||
| 1o41_A | 108 | Crystal Structure Of Sh2 In Complex With Ru78300. L | 7e-05 | ||
| 3dtc_A | 271 | Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp | 4e-05 | ||
| 3hck_A | 107 | Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domai | 4e-05 | ||
| 1wa7_A | 65 | Sh3 Domain Of Human Lyn Tyrosine Kinase Length = 65 | 4e-05 | ||
| 4afq_C | 85 | Human Chymase - Fynomer Complex Length = 85 | 4e-05 | ||
| 1qwe_A | 64 | C-Src Sh3 Domain Complexed With Ligand App12 Length | 4e-05 | ||
| 4f59_A | 112 | Triple Mutant Src Sh2 Domain Length = 112 | 4e-05 | ||
| 4f59_A | 112 | Triple Mutant Src Sh2 Domain Length = 112 | 1e-04 | ||
| 2j5e_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 5e-05 | ||
| 2j5e_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 3e-04 | ||
| 1xkk_A | 352 | Egfr Kinase Domain Complexed With A Quinazoline Inh | 5e-05 | ||
| 1xkk_A | 352 | Egfr Kinase Domain Complexed With A Quinazoline Inh | 3e-04 | ||
| 2jiv_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 5e-05 | ||
| 2jiv_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 3e-04 | ||
| 2itn_A | 327 | Crystal Structure Of Egfr Kinase Domain G719s Mutat | 5e-05 | ||
| 2itn_A | 327 | Crystal Structure Of Egfr Kinase Domain G719s Mutat | 3e-04 | ||
| 3tt0_A | 382 | Co-Structure Of Fibroblast Growth Factor Receptor 1 | 5e-05 | ||
| 1fgk_A | 310 | Crystal Structure Of The Tyrosine Kinase Domain Of | 5e-05 | ||
| 3ika_A | 331 | Crystal Structure Of Egfr 696-1022 T790m Mutant Cov | 5e-05 | ||
| 3ika_A | 331 | Crystal Structure Of Egfr 696-1022 T790m Mutant Cov | 3e-04 | ||
| 2itt_A | 327 | Crystal Structure Of Egfr Kinase Domain L858r Mutat | 5e-05 | ||
| 2itt_A | 327 | Crystal Structure Of Egfr Kinase Domain L858r Mutat | 3e-04 | ||
| 1bkm_A | 113 | Cocrystal Structure Of D-Amino Acid Substituted Pho | 5e-05 | ||
| 1bkm_A | 113 | Cocrystal Structure Of D-Amino Acid Substituted Pho | 5e-04 | ||
| 4hjo_A | 337 | Crystal Structure Of The Inactive Egfr Tyrosine Kin | 5e-05 | ||
| 4hjo_A | 337 | Crystal Structure Of The Inactive Egfr Tyrosine Kin | 3e-04 | ||
| 3rhx_B | 306 | Crystal Structure Of The Catalytic Domain Of Fgfr1 | 5e-05 | ||
| 3fj5_A | 57 | Crystal Structure Of The C-Src-Sh3 Domain Length = | 5e-05 | ||
| 3bel_A | 315 | X-Ray Structure Of Egfr In Complex With Oxime Inhib | 5e-05 | ||
| 3bel_A | 315 | X-Ray Structure Of Egfr In Complex With Oxime Inhib | 4e-04 | ||
| 3c4f_A | 302 | Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M | 5e-05 | ||
| 3gql_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 5e-05 | ||
| 2jiu_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 5e-05 | ||
| 2jiu_A | 328 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 3e-04 | ||
| 4i23_A | 329 | Crystal Structure Of The Wild-type Egfr Kinase Doma | 5e-05 | ||
| 4i23_A | 329 | Crystal Structure Of The Wild-type Egfr Kinase Doma | 3e-04 | ||
| 4i20_A | 329 | Crystal Structure Of Monomeric (v948r) Primary Onco | 5e-05 | ||
| 4i20_A | 329 | Crystal Structure Of Monomeric (v948r) Primary Onco | 3e-04 | ||
| 2jit_A | 327 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 5e-05 | ||
| 2jit_A | 327 | Crystal Structure Of Egfr Kinase Domain T790m Mutat | 3e-04 | ||
| 4i24_A | 329 | Structure Of T790m Egfr Kinase Domain Co-crystalliz | 5e-05 | ||
| 4i24_A | 329 | Structure Of T790m Egfr Kinase Domain Co-crystalliz | 4e-04 | ||
| 4i21_A | 329 | Crystal Structure Of L858r + T790m Egfr Kinase Doma | 5e-05 | ||
| 4i21_A | 329 | Crystal Structure Of L858r + T790m Egfr Kinase Doma | 3e-04 | ||
| 2eb2_A | 334 | Crystal Structure Of Mutated Egfr Kinase Domain (G7 | 5e-05 | ||
| 2eb2_A | 334 | Crystal Structure Of Mutated Egfr Kinase Domain (G7 | 3e-04 | ||
| 2gs2_A | 330 | Crystal Structure Of The Active Egfr Kinase Domain | 5e-05 | ||
| 2gs2_A | 330 | Crystal Structure Of The Active Egfr Kinase Domain | 3e-04 | ||
| 1m14_A | 333 | Tyrosine Kinase Domain From Epidermal Growth Factor | 5e-05 | ||
| 1m14_A | 333 | Tyrosine Kinase Domain From Epidermal Growth Factor | 3e-04 | ||
| 2j5f_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 5e-05 | ||
| 2j5f_A | 327 | Crystal Structure Of Egfr Kinase Domain In Complex | 3e-04 | ||
| 4g5j_A | 330 | Crystal Structure Of Egfr Kinase In Complex With Bi | 5e-05 | ||
| 4g5j_A | 330 | Crystal Structure Of Egfr Kinase In Complex With Bi | 3e-04 | ||
| 4f63_A | 309 | Crystal Structure Of Human Fibroblast Growth Factor | 5e-05 | ||
| 4i1z_A | 329 | Crystal Structure Of The Monomeric (v948r) Form Of | 5e-05 | ||
| 4i1z_A | 329 | Crystal Structure Of The Monomeric (v948r) Form Of | 3e-04 | ||
| 1uwh_A | 276 | The Complex Of Wild Type B-Raf And Bay439006 Length | 5e-05 | ||
| 3js2_A | 317 | Crystal Structure Of Minimal Kinase Domain Of Fibro | 5e-05 | ||
| 4g5p_A | 330 | Crystal Structure Of Egfr Kinase T790m In Complex W | 5e-05 | ||
| 4g5p_A | 330 | Crystal Structure Of Egfr Kinase T790m In Complex W | 4e-04 | ||
| 3vjo_A | 334 | Crystal Structure Of The Wild-Type Egfr Kinase Doma | 5e-05 | ||
| 3vjo_A | 334 | Crystal Structure Of The Wild-Type Egfr Kinase Doma | 4e-04 | ||
| 3w2o_A | 331 | Egfr Kinase Domain T790m/l858r Mutant With Tak-285 | 6e-05 | ||
| 3w2o_A | 331 | Egfr Kinase Domain T790m/l858r Mutant With Tak-285 | 4e-04 | ||
| 3ug1_A | 334 | Crystal Structure Of The Mutated Egfr Kinase Domain | 6e-05 | ||
| 3ug1_A | 334 | Crystal Structure Of The Mutated Egfr Kinase Domain | 4e-04 | ||
| 2l2p_A | 66 | Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FR | 6e-05 | ||
| 3lzb_A | 327 | Egfr Kinase Domain Complexed With An Imidazo[2,1-B] | 6e-05 | ||
| 3lzb_A | 327 | Egfr Kinase Domain Complexed With An Imidazo[2,1-B] | 4e-04 | ||
| 3kxx_A | 317 | Structure Of The Mutant Fibroblast Growth Factor Re | 6e-05 | ||
| 3gop_A | 361 | Crystal Structure Of The Egf Receptor Juxtamembrane | 6e-05 | ||
| 3gop_A | 361 | Crystal Structure Of The Egf Receptor Juxtamembrane | 4e-04 | ||
| 2eb3_A | 334 | Crystal Structure Of Mutated Egfr Kinase Domain (L8 | 6e-05 | ||
| 2eb3_A | 334 | Crystal Structure Of Mutated Egfr Kinase Domain (L8 | 3e-04 | ||
| 2gs7_A | 330 | Crystal Structure Of The Inactive Egfr Kinase Domai | 6e-05 | ||
| 2gs7_A | 330 | Crystal Structure Of The Inactive Egfr Kinase Domai | 3e-04 | ||
| 3gqi_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 6e-05 | ||
| 3gqi_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 6e-05 | ||
| 1lck_A | 175 | Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K | 6e-05 | ||
| 3og7_A | 289 | B-Raf Kinase V600e Oncogenic Mutant In Complex With | 6e-05 | ||
| 4d8k_A | 175 | Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc | 6e-05 | ||
| 1uj0_A | 62 | Crystal Structure Of Stam2 Sh3 Domain In Complex Wi | 7e-05 | ||
| 2i0v_A | 335 | C-Fms Tyrosine Kinase In Complex With A Quinolone I | 7e-05 | ||
| 2i1m_A | 333 | Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An | 7e-05 | ||
| 3bea_A | 333 | Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P | 7e-05 | ||
| 3eta_A | 317 | Kinase Domain Of Insulin Receptor Complexed With A | 7e-05 | ||
| 3c1x_A | 373 | Crystal Structure Of The Tyrosine Kinase Domain Of | 8e-05 | ||
| 3a4p_A | 319 | Human C-Met Kinase Domain Complexed With 6-Benzylox | 8e-05 | ||
| 3lco_A | 324 | Inhibitor Bound To A Dfg-Out Structure Of The Kinas | 8e-05 | ||
| 2ogv_A | 317 | Crystal Structure Of The Autoinhibited Human C-Fms | 8e-05 | ||
| 3dkg_A | 317 | Sgx Clone 5698a109kfg1h1 Length = 317 | 9e-05 | ||
| 3dkc_A | 317 | Sgx Clone 5698a65kfg1h1 Length = 317 | 9e-05 | ||
| 2d8j_A | 77 | Solution Structure Of The Sh3 Domain Of Fyn-Related | 9e-05 | ||
| 3q6w_A | 307 | Structure Of Dually-phosphorylated Met Receptor Kin | 9e-05 | ||
| 3f66_A | 298 | Human C-Met Kinase In Complex With Quinoxaline Inhi | 9e-05 | ||
| 4gg5_A | 319 | Crystal Structure Of Cmet In Complex With Novel Inh | 9e-05 | ||
| 3lcd_A | 329 | Inhibitor Bound To A Dfg-In Structure Of The Kinase | 9e-05 | ||
| 3i5n_A | 309 | Crystal Structure Of C-Met With Triazolopyridazine | 9e-05 | ||
| 2g15_A | 318 | Structural Characterization Of Autoinhibited C-Met | 9e-05 | ||
| 2wgj_A | 306 | X-Ray Structure Of Pf-02341066 Bound To The Kinase | 9e-05 | ||
| 3q6u_A | 308 | Structure Of The Apo Met Receptor Kinase In The Dua | 9e-05 | ||
| 1r0p_A | 312 | Crystal Structure Of The Tyrosine Kinase Domain Of | 9e-05 | ||
| 3lq8_A | 302 | Structure Of The Kinase Domain Of C-Met Bound To Xl | 9e-05 | ||
| 3cth_A | 314 | Crystal Structure Of The Tyrosine Kinase Domain Of | 9e-05 | ||
| 2rfn_A | 310 | X-ray Structure Of C-met With Inhibitor. Length = 3 | 9e-05 | ||
| 3qti_A | 314 | C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 | 9e-05 | ||
| 2wd1_A | 292 | Human C-Met Kinase In Complex With Azaindole Inhibi | 1e-04 | ||
| 1skj_A | 113 | Cocrystal Structure Of Urea-Substituted Phosphopept | 1e-04 | ||
| 1skj_A | 113 | Cocrystal Structure Of Urea-Substituted Phosphopept | 5e-04 | ||
| 1sha_A | 104 | Crystal Structure Of The Phosphotyrosine Recognitio | 1e-04 | ||
| 1sha_A | 104 | Crystal Structure Of The Phosphotyrosine Recognitio | 6e-04 | ||
| 1p13_A | 102 | Crystal Structure Of The Src Sh2 Domain Complexed W | 1e-04 | ||
| 1p13_A | 102 | Crystal Structure Of The Src Sh2 Domain Complexed W | 6e-04 | ||
| 1wxb_A | 68 | Solution Structure Of The Sh3 Domain From Human Epi | 1e-04 | ||
| 1is0_A | 106 | Crystal Structure Of A Complex Of The Src Sh2 Domai | 1e-04 | ||
| 1is0_A | 106 | Crystal Structure Of A Complex Of The Src Sh2 Domai | 6e-04 | ||
| 1nzl_A | 103 | Crystal Structure Of Src Sh2 Domain Bound To Doubly | 1e-04 | ||
| 1nzl_A | 103 | Crystal Structure Of Src Sh2 Domain Bound To Doubly | 7e-04 | ||
| 1kc2_A | 103 | Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c | 1e-04 | ||
| 1kc2_A | 103 | Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c | 8e-04 | ||
| 2l0a_A | 72 | Solution Nmr Structure Of Signal Transducing Adapte | 1e-04 | ||
| 3vhk_A | 368 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 1e-04 | ||
| 3vnt_A | 318 | Crystal Structure Of The Kinase Domain Of Human Veg | 1e-04 | ||
| 1y6a_A | 366 | Crystal Structure Of Vegfr2 In Complex With A 2-Ani | 1e-04 | ||
| 2k2m_A | 68 | Structural Basis Of Pxxdy Motif Recognition In Sh3 | 1e-04 | ||
| 3c7q_A | 316 | Structure Of Vegfr2 Kinase Domain In Complex With B | 1e-04 | ||
| 2oh4_A | 316 | Crystal Structure Of Vegfr2 With A Benzimidazole-Ur | 1e-04 | ||
| 3cjf_A | 309 | Crystal Structure Of Vegfr2 In Complex With A 3,4,5 | 1e-04 | ||
| 3ewh_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 1e-04 | ||
| 3vid_A | 356 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 2e-04 | ||
| 3vhe_A | 359 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 2e-04 | ||
| 3cjg_A | 309 | Crystal Structure Of Vegfr2 In Complex With A 3,4,5 | 2e-04 | ||
| 1ywn_A | 316 | Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p | 2e-04 | ||
| 3u6j_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 2xir_A | 316 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 1vr2_A | 316 | Human Vascular Endothelial Growth Factor Receptor 2 | 2e-04 | ||
| 4agc_A | 353 | Crystal Structure Of Vegfr2 (Juxtamembrane And Kina | 2e-04 | ||
| 2p2i_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 2p2h_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 2e-04 | ||
| 2rfd_A | 324 | Crystal Structure Of The Complex Between The Egfr K | 2e-04 | ||
| 2rfd_A | 324 | Crystal Structure Of The Complex Between The Egfr K | 4e-04 | ||
| 2jxb_A | 86 | Structure Of Cd3epsilon-Nck2 First Sh3 Domain Compl | 2e-04 | ||
| 2lqn_A | 303 | Solution Structure Of Crkl Length = 303 | 2e-04 | ||
| 2lqw_A | 303 | Solution Structure Of Phosphorylated Crkl Length = | 2e-04 | ||
| 2jw4_A | 72 | Nmr Solution Structure Of The N-Terminal Sh3 Domain | 2e-04 | ||
| 2b86_A | 67 | Solution Structure Of The First Src Homology 3 Doma | 2e-04 | ||
| 3cqt_A | 79 | N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 | 2e-04 | ||
| 1f1w_A | 104 | Src Sh2 Thref1trp Mutant Complexed With The Phospho | 3e-04 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 3e-04 | ||
| 2js2_A | 63 | Solution Structure Of First Sh3 Domain Of Adaptor N | 3e-04 | ||
| 1x27_A | 167 | Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S | 4e-04 | ||
| 3reb_B | 90 | Hiv-1 Nef Protein In Complex With Engineered Hck-Sh | 4e-04 | ||
| 1bmb_A | 123 | Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 | 5e-04 | ||
| 3n84_A | 112 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 5e-04 | ||
| 1fhs_A | 112 | The Three-Dimensional Solution Structure Of The Src | 5e-04 | ||
| 3rbb_B | 61 | Hiv-1 Nef Protein In Complex With Engineered Hck Sh | 5e-04 | ||
| 2vwf_A | 58 | Grb2 Sh3c (2) Length = 58 | 5e-04 | ||
| 3ove_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 5e-04 | ||
| 3imd_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 5e-04 | ||
| 1uhf_A | 69 | Solution Structure Of The Third Sh3 Domain Of Human | 5e-04 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 5e-04 | ||
| 2aoa_A | 99 | Crystal Structures Of A High-affinity Macrocyclic P | 6e-04 | ||
| 2d8h_A | 80 | Solution Structure Of The Sh3 Domain Of Hypothetica | 6e-04 | ||
| 1zfp_E | 98 | Growth Factor Receptor Binding Protein Sh2 Domain C | 6e-04 | ||
| 1tze_E | 98 | Signal Transduction Adaptor Growth Factor, Grb2 Sh2 | 6e-04 | ||
| 3mxc_A | 101 | Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp | 6e-04 | ||
| 2h46_E | 116 | Native Domain-Swapped Dimer Crystal Structure Of Th | 6e-04 | ||
| 2dl4_A | 68 | Solution Structure Of The First Sh3 Domain Of Stac | 6e-04 | ||
| 1bm2_A | 117 | Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet | 6e-04 | ||
| 1fyr_A | 114 | Dimer Formation Through Domain Swapping In The Crys | 6e-04 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 6e-04 | ||
| 1h92_A | 63 | Sh3 Domain Of Human Lck Tyrosine Kinase Length = 63 | 6e-04 | ||
| 2a08_A | 60 | Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | 7e-04 | ||
| 2iim_A | 62 | Sh3 Domain Of Human Lck Length = 62 | 7e-04 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 7e-04 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 7e-04 | ||
| 2y4i_B | 319 | Ksr2-Mek1 Heterodimer Length = 319 | 7e-04 | ||
| 2l3s_A | 163 | Structure Of The Autoinhibited Crk Length = 163 | 8e-04 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 8e-04 | ||
| 2rol_A | 64 | Structural Basis Of Pxxdy Motif Recognition In Sh3 | 9e-04 | ||
| 1kik_A | 57 | Sh3 Domain Of Lymphocyte Specific Kinase (Lck) Leng | 9e-04 |
| >pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 | Back alignment and structure |
|
| >pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 | Back alignment and structure |
| >pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 | Back alignment and structure |
| >pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 | Back alignment and structure |
| >pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | Back alignment and structure |
| >pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 | Back alignment and structure |
| >pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 | Back alignment and structure |
| >pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 | Back alignment and structure |
| >pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 | Back alignment and structure |
| >pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 | Back alignment and structure |
| >pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 | Back alignment and structure |
| >pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 | Back alignment and structure |
| >pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 | Back alignment and structure |
| >pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 | Back alignment and structure |
| >pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 | Back alignment and structure |
| >pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 | Back alignment and structure |
| >pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 | Back alignment and structure |
| >pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 | Back alignment and structure |
| >pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 | Back alignment and structure |
| >pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 | Back alignment and structure |
| >pdb|2EKX|A Chain A, Solution Structure Of The Human Bmx Sh2 Domain Length = 110 | Back alignment and structure |
| >pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 | Back alignment and structure |
| >pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 | Back alignment and structure |
| >pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 | Back alignment and structure |
| >pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 | Back alignment and structure |
| >pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 | Back alignment and structure |
| >pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 | Back alignment and structure |
| >pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 | Back alignment and structure |
| >pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 | Back alignment and structure |
| >pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 | Back alignment and structure |
| >pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 | Back alignment and structure |
| >pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 | Back alignment and structure |
| >pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 | Back alignment and structure |
| >pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 | Back alignment and structure |
| >pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 | Back alignment and structure |
| >pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 | Back alignment and structure |
| >pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 | Back alignment and structure |
| >pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 | Back alignment and structure |
| >pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 | Back alignment and structure |
| >pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 | Back alignment and structure |
| >pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 | Back alignment and structure |
| >pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 | Back alignment and structure |
| >pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 | Back alignment and structure |
| >pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 | Back alignment and structure |
| >pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 | Back alignment and structure |
| >pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 | Back alignment and structure |
| >pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 | Back alignment and structure |
| >pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 | Back alignment and structure |
| >pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 | Back alignment and structure |
| >pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 | Back alignment and structure |
| >pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 | Back alignment and structure |
| >pdb|2GE9|A Chain A, Solution Structures Of The Sh2 Domain Of Bruton's Tyrosine Kinase Length = 125 | Back alignment and structure |
| >pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 | Back alignment and structure |
| >pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 | Back alignment and structure |
| >pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 | Back alignment and structure |
| >pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 | Back alignment and structure |
| >pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | Back alignment and structure |
| >pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 | Back alignment and structure |
| >pdb|3S9K|A Chain A, Crystal Structure Of The Itk Sh2 Domain Length = 118 | Back alignment and structure |
| >pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 | Back alignment and structure |
| >pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 | Back alignment and structure |
| >pdb|1LUI|A Chain A, Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform, Ensemble Of 20 Low Energy Structures Length = 110 | Back alignment and structure |
| >pdb|2ETZ|A Chain A, The Nmr Minimized Average Structure Of The Itk Sh2 Domain Bound To A Phosphopeptide Length = 109 | Back alignment and structure |
| >pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 | Back alignment and structure |
| >pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 | Back alignment and structure |
| >pdb|2K79|B Chain B, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 110 | Back alignment and structure |
| >pdb|1GL5|A Chain A, Nmr Structure Of The Sh3 Domain From The Tec Protein Tyrosine Kinase Length = 67 | Back alignment and structure |
| >pdb|2DM0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Tyrosine- Protein Kinase Txk Length = 125 | Back alignment and structure |
| >pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 | Back alignment and structure |
| >pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 | Back alignment and structure |
| >pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 | Back alignment and structure |
| >pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 | Back alignment and structure |
| >pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 | Back alignment and structure |
| >pdb|1QLY|A Chain A, Nmr Study Of The Sh3 Domain From Bruton's Tyrosine Kinase, 20 Structures Length = 58 | Back alignment and structure |
| >pdb|1AWW|A Chain A, Sh3 Domain From Bruton's Tyrosine Kinase, Nmr, 42 Structures Length = 67 | Back alignment and structure |
| >pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 | Back alignment and structure |
| >pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 | Back alignment and structure |
| >pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 | Back alignment and structure |
| >pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 | Back alignment and structure |
| >pdb|2YUQ|A Chain A, Solution Structure Of The Sh3 Domain Of Human Tyrosine- Protein Kinase ItkTSK Length = 85 | Back alignment and structure |
| >pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 | Back alignment and structure |
| >pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 | Back alignment and structure |
| >pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 | Back alignment and structure |
| >pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 | Back alignment and structure |
| >pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 | Back alignment and structure |
| >pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 | Back alignment and structure |
| >pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 | Back alignment and structure |
| >pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 | Back alignment and structure |
| >pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 | Back alignment and structure |
| >pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 | Back alignment and structure |
| >pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 | Back alignment and structure |
| >pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 | Back alignment and structure |
| >pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 | Back alignment and structure |
| >pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 | Back alignment and structure |
| >pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 | Back alignment and structure |
| >pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 | Back alignment and structure |
| >pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 | Back alignment and structure |
| >pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 | Back alignment and structure |
| >pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 | Back alignment and structure |
| >pdb|2LMJ|A Chain A, Itk-Sh3 Length = 66 | Back alignment and structure |
| >pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 | Back alignment and structure |
| >pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 | Back alignment and structure |
| >pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 | Back alignment and structure |
| >pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 | Back alignment and structure |
| >pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 | Back alignment and structure |
| >pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 | Back alignment and structure |
| >pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 | Back alignment and structure |
| >pdb|1AWJ|A Chain A, Intramolecular Itk-Proline Complex, Nmr, Minimized Average Structure Length = 77 | Back alignment and structure |
| >pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 | Back alignment and structure |
| >pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 | Back alignment and structure |
| >pdb|2K79|A Chain A, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 63 | Back alignment and structure |
| >pdb|2RN8|A Chain A, Nmr Structure Note: Murine Itk Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 | Back alignment and structure |
| >pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 | Back alignment and structure |
| >pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 | Back alignment and structure |
| >pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 | Back alignment and structure |
| >pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 | Back alignment and structure |
| >pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 | Back alignment and structure |
| >pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 | Back alignment and structure |
| >pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 | Back alignment and structure |
| >pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 | Back alignment and structure |
| >pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 | Back alignment and structure |
| >pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 | Back alignment and structure |
| >pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 | Back alignment and structure |
| >pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 | Back alignment and structure |
| >pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 | Back alignment and structure |
| >pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 | Back alignment and structure |
| >pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 | Back alignment and structure |
| >pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 | Back alignment and structure |
| >pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 | Back alignment and structure |
| >pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 | Back alignment and structure |
| >pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 | Back alignment and structure |
| >pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 | Back alignment and structure |
| >pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 | Back alignment and structure |
| >pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 | Back alignment and structure |
| >pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 | Back alignment and structure |
| >pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 | Back alignment and structure |
| >pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 | Back alignment and structure |
| >pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 | Back alignment and structure |
| >pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 | Back alignment and structure |
| >pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 | Back alignment and structure |
| >pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 | Back alignment and structure |
| >pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 | Back alignment and structure |
| >pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 | Back alignment and structure |
| >pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 | Back alignment and structure |
| >pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 | Back alignment and structure |
| >pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 | Back alignment and structure |
| >pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 | Back alignment and structure |
| >pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 | Back alignment and structure |
| >pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 | Back alignment and structure |
| >pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 | Back alignment and structure |
| >pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 | Back alignment and structure |
| >pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 | Back alignment and structure |
| >pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 | Back alignment and structure |
| >pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 | Back alignment and structure |
| >pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 | Back alignment and structure |
| >pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 | Back alignment and structure |
| >pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 | Back alignment and structure |
| >pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 | Back alignment and structure |
| >pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 | Back alignment and structure |
| >pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 | Back alignment and structure |
| >pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 | Back alignment and structure |
| >pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 | Back alignment and structure |
| >pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 | Back alignment and structure |
| >pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 | Back alignment and structure |
| >pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 | Back alignment and structure |
| >pdb|3H0H|A Chain A, Human Fyn Sh3 Domain R96i Mutant, Crystal Form I Length = 73 | Back alignment and structure |
| >pdb|1EFN|A Chain A, Hiv-1 Nef Protein In Complex With R96i Mutant Fyn Sh3 Domain Length = 59 | Back alignment and structure |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|2HDA|A Chain A, Yes Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|2YT6|A Chain A, Solution Structure Of The Sh3_1 Domain Of Yamaguchi Sarcoma Viral (V-Yes) Oncogene Homolog 1 Length = 109 | Back alignment and structure |
| >pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 | Back alignment and structure |
| >pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 | Back alignment and structure |
| >pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 | Back alignment and structure |
| >pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 | Back alignment and structure |
| >pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 | Back alignment and structure |
| >pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 | Back alignment and structure |
| >pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 | Back alignment and structure |
| >pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 | Back alignment and structure |
| >pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 | Back alignment and structure |
| >pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 | Back alignment and structure |
| >pdb|1WLP|B Chain B, Solution Structure Of The P22phox-P47phox Complex Length = 138 | Back alignment and structure |
| >pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 | Back alignment and structure |
| >pdb|3H0F|A Chain A, Crystal Structure Of The Human Fyn Sh3 R96w Mutant Length = 73 | Back alignment and structure |
| >pdb|4AG2|C Chain C, Human Chymase - Fynomer Complex Length = 84 | Back alignment and structure |
| >pdb|3UA6|A Chain A, Crystal Structure Of The Human Fyn Sh3 Domain Length = 64 | Back alignment and structure |
| >pdb|1FYN|A Chain A, Phosphotransferase Length = 62 | Back alignment and structure |
| >pdb|1M27|C Chain C, Crystal Structure Of SapFYNSH3SLAM TERNARY COMPLEX Length = 61 | Back alignment and structure |
| >pdb|1A0N|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3- Kinase, Family Of 25 Structures Length = 69 | Back alignment and structure |
| >pdb|1AZG|B Chain B, Nmr Study Of The Sh3 Domain From Fyn Proto-Oncogene Tyrosine Kinase Kinase Complexed With The Synthetic Peptide P2l Corresponding To Residues 91-104 Of The P85 Subunit Of Pi3-Kinase, Minimized Average (Probmap) Structure Length = 67 | Back alignment and structure |
| >pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 | Back alignment and structure |
| >pdb|1SHF|A Chain A, Crystal Structure Of The Sh3 Domain In Human Fyn; Comparison Of The Three-Dimensional Structures Of Sh3 Domains In Tyrosine Kinases And Spectrin Length = 59 | Back alignment and structure |
| >pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 | Back alignment and structure |
| >pdb|4D8D|A Chain A, Crystal Structure Of Hiv-1 Nef Fyn-sh3 R96w Variant Length = 58 | Back alignment and structure |
| >pdb|1AVZ|C Chain C, V-1 Nef Protein In Complex With Wild Type Fyn Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 | Back alignment and structure |
| >pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 | Back alignment and structure |
| >pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 | Back alignment and structure |
| >pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 | Back alignment and structure |
| >pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 | Back alignment and structure |
| >pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 | Back alignment and structure |
| >pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 | Back alignment and structure |
| >pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 | Back alignment and structure |
| >pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 | Back alignment and structure |
| >pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 | Back alignment and structure |
| >pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 | Back alignment and structure |
| >pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 | Back alignment and structure |
| >pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 | Back alignment and structure |
| >pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 | Back alignment and structure |
| >pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 | Back alignment and structure |
| >pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 | Back alignment and structure |
| >pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 | Back alignment and structure |
| >pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 | Back alignment and structure |
| >pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 | Back alignment and structure |
| >pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 | Back alignment and structure |
| >pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 | Back alignment and structure |
| >pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 | Back alignment and structure |
| >pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 | Back alignment and structure |
| >pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|1U5S|A Chain A, Nmr Structure Of The Complex Between Nck-2 Sh3 Domain And Pinch-1 Lim4 Domain Length = 71 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 | Back alignment and structure |
| >pdb|2FRY|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Nck2 Adaptor Protein Length = 61 | Back alignment and structure |
| >pdb|1WX6|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Cytoplasmic Protein Nck2 Length = 91 | Back alignment and structure |
| >pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 | Back alignment and structure |
| >pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 | Back alignment and structure |
| >pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 | Back alignment and structure |
| >pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 | Back alignment and structure |
| >pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 | Back alignment and structure |
| >pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 | Back alignment and structure |
| >pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 | Back alignment and structure |
| >pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 | Back alignment and structure |
| >pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 | Back alignment and structure |
| >pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 | Back alignment and structure |
| >pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 | Back alignment and structure |
| >pdb|1UEC|A Chain A, Crystal Structure Of Autoinhibited Form Of Tandem Sh3 Domain Of P47phox Length = 193 | Back alignment and structure |
| >pdb|1NG2|A Chain A, Structure Of Autoinhibited P47phox Length = 193 | Back alignment and structure |
| >pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 | Back alignment and structure |
| >pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 | Back alignment and structure |
| >pdb|3QWY|A Chain A, Ced-2 Length = 308 | Back alignment and structure |
| >pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 | Back alignment and structure |
| >pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 | Back alignment and structure |
| >pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 | Back alignment and structure |
| >pdb|3QWX|X Chain X, Ced-2 1-174 Length = 174 | Back alignment and structure |
| >pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 | Back alignment and structure |
| >pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 | Back alignment and structure |
| >pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 | Back alignment and structure |
| >pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 | Back alignment and structure |
| >pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 | Back alignment and structure |
| >pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 | Back alignment and structure |
| >pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 | Back alignment and structure |
| >pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 | Back alignment and structure |
| >pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 | Back alignment and structure |
| >pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 | Back alignment and structure |
| >pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|4AFZ|C Chain C, Human Chymase - Fynomer Complex Length = 84 | Back alignment and structure |
| >pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 | Back alignment and structure |
| >pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 | Back alignment and structure |
| >pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 | Back alignment and structure |
| >pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 | Back alignment and structure |
| >pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 | Back alignment and structure |
| >pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 | Back alignment and structure |
| >pdb|1PRL|C Chain C, Two Binding Orientations For Peptides To Src Sh3 Domain: Development Of A General Model For Sh3-Ligand Interactions Length = 64 | Back alignment and structure |
| >pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 | Back alignment and structure |
| >pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 | Back alignment and structure |
| >pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 | Back alignment and structure |
| >pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 | Back alignment and structure |
| >pdb|4HCK|A Chain A, Human Hck Sh3 Domain, Nmr, 25 Structures Length = 72 | Back alignment and structure |
| >pdb|1BU1|A Chain A, Src Family Kinase Hck Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|1OV3|A Chain A, Structure Of The P22phox-P47phox Complex Length = 138 | Back alignment and structure |
| >pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 | Back alignment and structure |
| >pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 | Back alignment and structure |
| >pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 | Back alignment and structure |
| >pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 | Back alignment and structure |
| >pdb|4HXJ|A Chain A, Crystal Structure Of Sh3:rgt Complex Length = 60 | Back alignment and structure |
| >pdb|2OI3|A Chain A, Nmr Structure Analysis Of The Hematopoetic Cell Kinase Sh3 Domain Complexed With An Artificial High Affinity Ligand (Pd1) Length = 86 | Back alignment and structure |
| >pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 | Back alignment and structure |
| >pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 | Back alignment and structure |
| >pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 | Back alignment and structure |
| >pdb|3HCK|A Chain A, Nmr Ensemble Of The Uncomplexed Human Hck Sh2 Domain, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|4AFQ|C Chain C, Human Chymase - Fynomer Complex Length = 85 | Back alignment and structure |
| >pdb|1QWE|A Chain A, C-Src Sh3 Domain Complexed With Ligand App12 Length = 64 | Back alignment and structure |
| >pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 | Back alignment and structure |
| >pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 | Back alignment and structure |
| >pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 | Back alignment and structure |
| >pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 | Back alignment and structure |
| >pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 | Back alignment and structure |
| >pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 | Back alignment and structure |
| >pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 | Back alignment and structure |
| >pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 | Back alignment and structure |
| >pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 | Back alignment and structure |
| >pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 | Back alignment and structure |
| >pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 | Back alignment and structure |
| >pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 | Back alignment and structure |
| >pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 | Back alignment and structure |
| >pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 | Back alignment and structure |
| >pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 | Back alignment and structure |
| >pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 | Back alignment and structure |
| >pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 | Back alignment and structure |
| >pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 | Back alignment and structure |
| >pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 | Back alignment and structure |
| >pdb|3FJ5|A Chain A, Crystal Structure Of The C-Src-Sh3 Domain Length = 57 | Back alignment and structure |
| >pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 | Back alignment and structure |
| >pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 | Back alignment and structure |
| >pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 | Back alignment and structure |
| >pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 | Back alignment and structure |
| >pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 | Back alignment and structure |
| >pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 | Back alignment and structure |
| >pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 | Back alignment and structure |
| >pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 | Back alignment and structure |
| >pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 | Back alignment and structure |
| >pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 | Back alignment and structure |
| >pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 | Back alignment and structure |
| >pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 | Back alignment and structure |
| >pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 | Back alignment and structure |
| >pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 | Back alignment and structure |
| >pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 | Back alignment and structure |
| >pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 | Back alignment and structure |
| >pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 | Back alignment and structure |
| >pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 | Back alignment and structure |
| >pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 | Back alignment and structure |
| >pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 | Back alignment and structure |
| >pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 | Back alignment and structure |
| >pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 | Back alignment and structure |
| >pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 | Back alignment and structure |
| >pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 | Back alignment and structure |
| >pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 | Back alignment and structure |
| >pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 | Back alignment and structure |
| >pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 | Back alignment and structure |
| >pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 | Back alignment and structure |
| >pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 | Back alignment and structure |
| >pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 | Back alignment and structure |
| >pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 | Back alignment and structure |
| >pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 | Back alignment and structure |
| >pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 | Back alignment and structure |
| >pdb|2L2P|A Chain A, Folding Intermediate Of The Fyn Sh3 A39vN53PV55L FROM NMR RELAXATION Dispersion Experiments Length = 66 | Back alignment and structure |
| >pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 | Back alignment and structure |
| >pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 | Back alignment and structure |
| >pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 | Back alignment and structure |
| >pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 | Back alignment and structure |
| >pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 | Back alignment and structure |
| >pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 | Back alignment and structure |
| >pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 | Back alignment and structure |
| >pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 | Back alignment and structure |
| >pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 | Back alignment and structure |
| >pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 | Back alignment and structure |
| >pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 | Back alignment and structure |
| >pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 | Back alignment and structure |
| >pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 | Back alignment and structure |
| >pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 | Back alignment and structure |
| >pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 | Back alignment and structure |
| >pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 | Back alignment and structure |
| >pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 | Back alignment and structure |
| >pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 | Back alignment and structure |
| >pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 | Back alignment and structure |
| >pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 | Back alignment and structure |
| >pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 | Back alignment and structure |
| >pdb|2D8J|A Chain A, Solution Structure Of The Sh3 Domain Of Fyn-Related Kinase Length = 77 | Back alignment and structure |
| >pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 | Back alignment and structure |
| >pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 | Back alignment and structure |
| >pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 | Back alignment and structure |
| >pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 | Back alignment and structure |
| >pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 | Back alignment and structure |
| >pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 | Back alignment and structure |
| >pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 | Back alignment and structure |
| >pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 | Back alignment and structure |
| >pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 | Back alignment and structure |
| >pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 | Back alignment and structure |
| >pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 | Back alignment and structure |
| >pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 | Back alignment and structure |
| >pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 | Back alignment and structure |
| >pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 | Back alignment and structure |
| >pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 | Back alignment and structure |
| >pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 | Back alignment and structure |
| >pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 | Back alignment and structure |
| >pdb|1WXB|A Chain A, Solution Structure Of The Sh3 Domain From Human Epidermal Growth Factor Receptor Pathway Substrate 8-Like Protein Length = 68 | Back alignment and structure |
| >pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 | Back alignment and structure |
| >pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 | Back alignment and structure |
| >pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 | Back alignment and structure |
| >pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 | Back alignment and structure |
| >pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 | Back alignment and structure |
| >pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 | Back alignment and structure |
| >pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 | Back alignment and structure |
| >pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 | Back alignment and structure |
| >pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 | Back alignment and structure |
| >pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 | Back alignment and structure |
| >pdb|2K2M|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 68 | Back alignment and structure |
| >pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 | Back alignment and structure |
| >pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 | Back alignment and structure |
| >pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 | Back alignment and structure |
| >pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 | Back alignment and structure |
| >pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 | Back alignment and structure |
| >pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 | Back alignment and structure |
| >pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 | Back alignment and structure |
| >pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 | Back alignment and structure |
| >pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 | Back alignment and structure |
| >pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 | Back alignment and structure |
| >pdb|2JXB|A Chain A, Structure Of Cd3epsilon-Nck2 First Sh3 Domain Complex Length = 86 | Back alignment and structure |
| >pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 | Back alignment and structure |
| >pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 | Back alignment and structure |
| >pdb|2JW4|A Chain A, Nmr Solution Structure Of The N-Terminal Sh3 Domain Of Human Nckalpha Length = 72 | Back alignment and structure |
| >pdb|2B86|A Chain A, Solution Structure Of The First Src Homology 3 Domain Of Nck2 Length = 67 | Back alignment and structure |
| >pdb|3CQT|A Chain A, N53i V55l Mutant Of Fyn Sh3 Domain Length = 79 | Back alignment and structure |
| >pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|2JS2|A Chain A, Solution Structure Of First Sh3 Domain Of Adaptor Nck Length = 63 | Back alignment and structure |
| >pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 | Back alignment and structure |
| >pdb|3REB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck-Sh3 Domain Length = 90 | Back alignment and structure |
| >pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 | Back alignment and structure |
| >pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 | Back alignment and structure |
| >pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 | Back alignment and structure |
| >pdb|3RBB|B Chain B, Hiv-1 Nef Protein In Complex With Engineered Hck Sh3 Domain Length = 61 | Back alignment and structure |
| >pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 | Back alignment and structure |
| >pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 | Back alignment and structure |
| >pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 | Back alignment and structure |
| >pdb|1UHF|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Intersectin 2(Kiaa1256) Length = 69 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 | Back alignment and structure |
| >pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 | Back alignment and structure |
| >pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 | Back alignment and structure |
| >pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 | Back alignment and structure |
| >pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 | Back alignment and structure |
| >pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 | Back alignment and structure |
| >pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 | Back alignment and structure |
| >pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 | Back alignment and structure |
| >pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|1H92|A Chain A, Sh3 Domain Of Human Lck Tyrosine Kinase Length = 63 | Back alignment and structure |
| >pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|2IIM|A Chain A, Sh3 Domain Of Human Lck Length = 62 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 | Back alignment and structure |
| >pdb|2L3S|A Chain A, Structure Of The Autoinhibited Crk Length = 163 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|2ROL|A Chain A, Structural Basis Of Pxxdy Motif Recognition In Sh3 Binding Length = 64 | Back alignment and structure |
| >pdb|1KIK|A Chain A, Sh3 Domain Of Lymphocyte Specific Kinase (Lck) Length = 57 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 513 | |||
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 5e-65 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-17 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 4e-14 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 7e-14 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 2e-63 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 3e-17 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 1e-13 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 1e-62 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 6e-18 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 2e-17 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 1e-13 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 1e-09 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 4e-60 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 3e-19 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 1e-14 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-13 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 5e-60 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 4e-20 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-14 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 3e-57 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 6e-19 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 3e-16 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 2e-13 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 5e-49 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 2e-18 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 8e-18 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 3e-17 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 2e-13 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 3e-44 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 4e-21 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 1e-15 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 7e-40 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 3e-17 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 2e-10 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 9e-39 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 3e-20 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 3e-15 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 5e-38 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 4e-21 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 2e-15 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 6e-38 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 3e-21 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 9e-16 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 1e-37 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 8e-21 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 3e-14 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 3e-37 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 4e-20 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 2e-15 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 2e-36 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 1e-20 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 4e-14 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 2e-35 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 1e-20 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 3e-14 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 3e-34 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 3e-19 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 7e-15 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 2e-32 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 3e-19 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 3e-11 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 2e-32 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 2e-20 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 8e-16 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 2e-32 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 1e-15 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 2e-15 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 7e-32 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 9e-20 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 4e-15 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 1e-31 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 7e-19 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 2e-16 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 2e-31 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 4e-20 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 6e-12 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 2e-30 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 4e-12 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 2e-09 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 2e-30 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 4e-19 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 1e-15 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 2e-30 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 5e-18 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 1e-12 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 8e-30 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 9e-21 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 2e-14 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 1e-29 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 4e-16 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 8e-16 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 4e-29 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 5e-19 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 1e-09 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 1e-28 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 5e-15 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 5e-14 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 2e-28 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 6e-17 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 3e-10 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 3e-28 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 5e-20 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 9e-15 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 3e-28 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 2e-19 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 5e-16 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 8e-28 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 3e-19 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 2e-11 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 2e-27 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 1e-18 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 3e-13 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 3e-27 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 1e-15 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 2e-15 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 4e-27 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 4e-27 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 9e-12 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 2e-09 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 5e-27 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 2e-11 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 9e-09 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 8e-27 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 7e-18 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 8e-10 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 1e-26 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 6e-18 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 8e-14 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 2e-26 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 1e-18 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 4e-11 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 2e-26 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 3e-20 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 2e-16 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 2e-26 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 3e-25 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 3e-26 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 2e-14 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 6e-26 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 2e-17 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 4e-11 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 9e-26 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 3e-17 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 8e-12 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 2e-25 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 1e-17 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 7e-12 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 2e-25 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 2e-18 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 2e-12 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 2e-25 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 6e-19 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 7e-11 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 2e-25 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 2e-10 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 3e-08 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 2e-25 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 1e-16 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 5e-10 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 3e-25 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 1e-15 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 2e-15 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 3e-25 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 5e-25 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 4e-17 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 3e-10 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 5e-25 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 6e-25 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 2e-24 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 1e-13 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 2e-24 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 1e-23 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 3e-24 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 1e-07 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 2e-06 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 3e-24 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 6e-19 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 2e-15 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 5e-24 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 8e-17 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 8e-11 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 6e-24 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 1e-09 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 6e-08 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 7e-24 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 1e-14 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 7e-24 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 5e-14 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 2e-23 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 2e-21 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 2e-23 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 4e-23 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 7e-21 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 5e-23 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 1e-16 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 2e-09 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 5e-23 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 5e-18 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 9e-12 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 3e-22 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 9e-21 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 3e-22 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 6e-20 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 3e-22 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 9e-13 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 3e-22 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 4e-22 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 1e-13 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 4e-22 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 5e-20 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 5e-22 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 4e-20 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 5e-22 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 3e-20 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 6e-22 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 2e-20 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 6e-22 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 3e-20 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 1e-21 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 1e-12 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 1e-20 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 2e-20 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 2e-18 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 2e-14 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 2e-20 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 3e-07 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 6e-05 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-20 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 7e-20 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 1e-17 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 7e-16 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 2e-20 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 3e-20 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 6e-12 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 3e-20 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 7e-12 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 3e-20 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 4e-20 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 4e-20 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 5e-20 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 1e-07 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 9e-06 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 5e-20 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 3e-12 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 5e-20 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 7e-20 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 1e-11 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 8e-20 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 4e-18 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 9e-18 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 8e-17 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 8e-20 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 1e-19 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 2e-19 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 4e-19 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 3e-19 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 1e-17 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 4e-13 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 4e-19 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 4e-17 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 8e-13 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 5e-19 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 6e-19 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 7e-19 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 3e-11 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 8e-19 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 1e-10 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 9e-19 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 3e-06 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 7e-06 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 1e-18 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 1e-18 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 1e-18 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 2e-18 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 3e-18 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 1e-14 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 1e-09 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 5e-08 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 4e-18 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 3e-14 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 6e-18 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 4e-10 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 6e-18 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 6e-18 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 4e-16 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 2e-17 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 2e-17 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 2e-17 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 3e-17 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 2e-13 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 3e-17 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 3e-17 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 1e-16 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 3e-11 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 5e-10 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 9e-07 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 1e-16 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 2e-16 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 2e-13 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 2e-16 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 3e-15 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 2e-16 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 4e-16 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 2e-16 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 3e-16 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 5e-15 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 7e-16 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 7e-16 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 9e-16 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 2e-15 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 6e-15 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 3e-09 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-15 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 3e-15 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 7e-08 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 3e-15 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 2e-07 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 4e-15 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 2e-12 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 4e-15 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 1e-09 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 4e-15 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 1e-07 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 5e-15 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 5e-15 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 1e-07 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 5e-15 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 8e-08 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 6e-15 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 5e-07 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 6e-15 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 1e-07 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 6e-15 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 7e-15 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 8e-15 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 4e-07 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 1e-14 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 5e-07 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 1e-14 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 6e-13 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 1e-14 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 1e-14 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 1e-14 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 5e-13 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-14 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-13 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 2e-14 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 2e-14 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 1e-12 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 3e-14 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 1e-06 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 3e-14 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 5e-14 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 5e-14 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 2e-12 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 6e-14 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-11 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-11 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 2e-10 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-08 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 5e-04 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 7e-14 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 7e-04 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 7e-14 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 5e-11 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 9e-14 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 3e-05 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 1e-13 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 1e-13 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 2e-11 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 1e-13 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 6e-08 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-13 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-06 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 3e-13 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 3e-07 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 5e-13 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 9e-12 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 7e-13 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 2e-05 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 7e-13 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 4e-06 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 8e-13 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 7e-06 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 1e-12 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 3e-06 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 1e-12 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 2e-06 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 1e-12 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 7e-06 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 2e-12 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 2e-05 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 2e-12 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 1e-05 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-12 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 2e-12 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 2e-12 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 2e-10 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 2e-12 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 4e-06 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 3e-12 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 5e-06 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 3e-12 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 4e-06 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 3e-12 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 3e-12 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 4e-07 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 3e-12 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 1e-05 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 3e-12 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 3e-06 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 4e-12 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 2e-06 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 4e-12 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 4e-05 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 4e-12 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 7e-07 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 5e-12 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 3e-05 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 6e-12 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 3e-05 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 7e-12 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 1e-06 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 8e-12 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 8e-06 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 9e-12 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 2e-06 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 9e-12 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 1e-10 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 9e-12 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 3e-07 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 1e-11 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 3e-06 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 1e-11 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 1e-06 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 1e-11 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 1e-06 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 1e-11 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 3e-06 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 1e-11 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 1e-11 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 7e-04 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 1e-11 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 2e-11 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 1e-07 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 2e-11 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 2e-11 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 1e-05 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 2e-11 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 1e-06 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 2e-11 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 3e-10 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 2e-11 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 2e-05 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 2e-11 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 7e-06 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 2e-11 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 3e-11 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 5e-07 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 3e-11 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 3e-11 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 4e-09 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 2e-06 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 3e-11 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 3e-11 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 3e-11 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 4e-11 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 6e-05 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 4e-11 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 3e-04 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 4e-11 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 4e-05 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 4e-11 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 1e-04 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 5e-11 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 5e-11 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 5e-05 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 5e-11 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 5e-11 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 2e-04 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 6e-11 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 4e-05 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 7e-11 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 7e-11 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 7e-11 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 3e-05 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 8e-11 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 8e-04 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 8e-11 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 1e-04 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 9e-11 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 2e-04 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 9e-11 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 1e-04 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 9e-11 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 9e-11 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 2e-04 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 1e-10 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-10 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 2e-04 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 1e-10 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 1e-10 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 6e-06 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 1e-10 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 8e-05 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 1e-10 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 1e-05 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 1e-10 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 2e-05 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 1e-10 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 3e-04 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 1e-10 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 2e-04 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-10 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 9e-05 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 2e-10 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 3e-04 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 2e-10 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 3e-10 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 3e-10 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 3e-04 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 4e-10 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 2e-04 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 4e-10 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 4e-10 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 4e-10 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 1e-05 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 4e-10 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 2e-04 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 4e-10 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 1e-04 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 4e-10 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 5e-10 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 7e-04 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 5e-10 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 1e-07 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 1e-06 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 9e-04 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 5e-10 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 5e-10 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 3e-05 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 5e-10 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 6e-10 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 7e-04 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 6e-10 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 1e-04 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 7e-10 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 7e-05 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 7e-10 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 2e-05 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 7e-10 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 8e-10 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 7e-05 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 8e-10 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 8e-10 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 9e-10 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-09 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 1e-09 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 5e-04 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-09 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 1e-09 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 3e-04 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 1e-09 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 1e-09 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 8e-05 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 1e-09 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 2e-09 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 1e-04 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 2e-09 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 1e-04 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 2e-09 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 2e-09 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 2e-09 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 2e-09 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 2e-09 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 2e-09 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 3e-04 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 2e-09 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 3e-04 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 2e-09 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 2e-09 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 4e-04 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 3e-09 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 3e-09 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 3e-09 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 3e-09 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 4e-04 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 3e-09 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 3e-09 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 4e-09 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 5e-04 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 4e-09 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 6e-09 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 6e-09 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 1e-04 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 6e-09 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 7e-09 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 8e-09 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 1e-08 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 1e-08 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 2e-08 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 2e-08 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 2e-08 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 2e-08 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 6e-04 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 2e-08 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 3e-08 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 3e-08 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 1e-05 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 3e-08 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 1e-04 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 4e-08 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 5e-08 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 6e-08 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 9e-08 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 1e-07 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 3e-07 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 4e-07 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 5e-07 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 5e-07 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 5e-07 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 5e-07 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 8e-07 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 8e-07 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 1e-06 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 4e-04 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 2e-06 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 2e-06 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 4e-06 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 4e-06 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 5e-06 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 5e-06 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 3e-04 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 6e-06 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 7e-06 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 8e-06 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 8e-06 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 9e-06 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 9e-06 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 9e-06 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 1e-05 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 1e-05 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 1e-05 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 2e-05 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 2e-05 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 2e-05 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 3e-05 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 3e-05 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 3e-05 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 3e-05 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 3e-05 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 3e-05 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 3e-05 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 4e-05 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 4e-05 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 4e-05 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 4e-05 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 5e-05 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 5e-05 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 6e-05 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 7e-05 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 8e-05 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 1e-04 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 1e-04 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 1e-04 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 1e-04 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 2e-04 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 2e-04 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 2e-04 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 2e-04 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 2e-04 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 2e-04 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 2e-04 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 2e-04 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 2e-04 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 3e-04 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 3e-04 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 3e-04 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 3e-04 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 3e-04 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 3e-04 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 3e-04 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 3e-04 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 4e-04 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 4e-04 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 5e-04 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 5e-04 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 5e-04 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 6e-04 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 6e-04 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 6e-04 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 6e-04 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 7e-04 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 7e-04 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 8e-04 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 8e-04 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 8e-04 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 9e-04 |
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
Score = 218 bits (558), Expect = 5e-65
Identities = 85/250 (34%), Positives = 134/250 (53%), Gaps = 17/250 (6%)
Query: 260 GDMSRQRAE--SILKQEDKEGCFVVRNSSTKGLYTLSLY-TKVPHPHVKHYHIKQNSRGE 316
D+S ++ E I+ + + S+ + Y S Y + ++ + +R E
Sbjct: 100 TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRE 159
Query: 317 FFLSEKHCCHSIPEVKDKEGCFVVRNS-STKGLYTLSL--YTKVPHPHVKHYHIKQNSRG 373
SE+ ++ ++ G F+VR S +TKG Y LS+ + +VKHY I++ G
Sbjct: 160 ---SERLLLNA----ENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSG 212
Query: 374 EFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELML 433
F+++ + +S+ ++V Y+ ++ GL RL T+ C P T GL+ D WEI L L
Sbjct: 213 GFYITSRTQFNSLQQLVAYYSKHADGLCHRL-TTVCPTSKPQTQGLAKDAWEIPRESLRL 271
Query: 434 LEELGSGQFGVVRRGKWRGSIDVA--MMKEGTMSEDDFIEEAKVMTRLQHQNLVQLYGVC 491
+LG G FG V G W G+ VA +K GTMS + F++EA+VM +L+H+ LVQLY V
Sbjct: 272 EVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVV 331
Query: 492 SKHRPIYIVT 501
S+ PIYIVT
Sbjct: 332 SE-EPIYIVT 340
|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Length = 283 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Length = 450 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Length = 96 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 513 | |||
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.98 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.97 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.97 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.97 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.97 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.95 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.95 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.95 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.95 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.95 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.94 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.94 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.94 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.94 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.94 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.94 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.93 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.93 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.93 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.92 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.92 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.89 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.89 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.89 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.89 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.87 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.87 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.84 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.84 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.84 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.84 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.84 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.84 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 99.84 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.84 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.84 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.84 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 99.84 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.83 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.83 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.83 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.83 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.83 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.83 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.83 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 99.83 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.83 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.83 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.82 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.82 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.82 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.82 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.82 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 99.82 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.82 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.82 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.82 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.82 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.82 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.82 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 99.82 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.81 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.81 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.81 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.81 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.81 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.81 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.81 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.81 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.81 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.81 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.81 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.81 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.81 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.81 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.81 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.81 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.81 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.81 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.81 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.81 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.81 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.8 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.8 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.8 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 99.8 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 99.8 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 99.8 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.8 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.8 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.8 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.8 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.8 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.8 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.8 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 99.8 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.8 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 99.8 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 99.8 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.8 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.8 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.79 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.79 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 99.79 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 99.79 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.79 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.79 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 99.79 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.79 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 99.79 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.79 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.79 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.79 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.79 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.79 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.79 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.79 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.79 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.79 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.79 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.79 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.79 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.79 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 99.79 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.79 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.79 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.79 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.78 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.78 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 99.78 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.78 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.78 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.78 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.78 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 99.78 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.78 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.78 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.78 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.78 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.78 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.78 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.78 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.78 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.78 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.78 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.78 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.78 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.78 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.78 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.78 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 99.78 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.78 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.78 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.77 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.77 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.77 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.77 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.77 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 99.77 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.77 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.77 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.77 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.77 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.77 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.77 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.77 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 99.77 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.77 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.77 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.77 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.77 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 99.77 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.77 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.76 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.76 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.76 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.76 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 99.76 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.76 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.76 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.76 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.76 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.76 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 99.76 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.76 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 99.76 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.76 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 99.76 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.76 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.76 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.76 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 99.76 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 99.76 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.76 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 99.76 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.76 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.76 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.76 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.76 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.76 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.76 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 99.76 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.76 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.76 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 99.75 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.75 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.75 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.75 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.75 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.75 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.75 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 99.75 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.75 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 99.75 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.75 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.75 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 99.75 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.74 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.74 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.74 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.74 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 99.74 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.74 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.74 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.74 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.74 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.74 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 99.74 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 99.74 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.73 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.73 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.73 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 99.73 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.73 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.73 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.73 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.73 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 99.73 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.72 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.72 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 99.72 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.72 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.72 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.72 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.72 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.72 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.71 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 99.71 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.7 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 99.7 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.7 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 99.7 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 99.69 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 99.69 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.69 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.68 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.65 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.63 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.61 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.6 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.6 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.6 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.59 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.59 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.57 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.57 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 99.54 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.52 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.52 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.52 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.51 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.5 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.46 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.46 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.45 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.44 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.43 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.43 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.41 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.38 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.38 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.37 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.34 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.31 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.3 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.29 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.27 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.25 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.25 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.24 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.24 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.23 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.23 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.23 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.21 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.21 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.19 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.19 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.19 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.19 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.18 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.18 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.17 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.17 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.16 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.16 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.15 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.15 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.14 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.14 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.14 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.14 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.14 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.14 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.14 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.14 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.13 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.13 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.13 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.13 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.13 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.12 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.12 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.12 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.12 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.11 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.11 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.11 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.11 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.11 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.11 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.11 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.1 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.1 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.1 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.1 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.1 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.1 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.09 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.09 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.09 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.08 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.08 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.08 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.08 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.08 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.08 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.08 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.08 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 99.08 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.08 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.07 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.07 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.07 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.07 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.07 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.06 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.06 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.06 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.06 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.06 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.06 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.05 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.05 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.05 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.05 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.05 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.04 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.04 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.04 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.04 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.04 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.04 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.04 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.04 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.04 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.04 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.04 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.04 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.03 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.03 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.03 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.03 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.03 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.03 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.03 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.03 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.03 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.03 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.02 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.02 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.02 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.02 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.02 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.02 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.02 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.02 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.02 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.01 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.01 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.01 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.01 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.01 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.01 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.01 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.01 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.01 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.0 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.0 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.0 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.0 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.0 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.0 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 98.99 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 98.99 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 98.99 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 98.99 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 98.99 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.99 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 98.98 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 98.98 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.98 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 98.98 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 98.98 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 98.98 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 98.98 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 98.98 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 98.98 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 98.98 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 98.98 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 98.97 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 98.97 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 98.97 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 98.97 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 98.97 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 98.97 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 98.97 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 98.97 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 98.97 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 98.97 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 98.97 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 98.97 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 98.96 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 98.96 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 98.96 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 98.96 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 98.96 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 98.96 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 98.96 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 98.95 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 98.95 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 98.95 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 98.94 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 98.94 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 98.94 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 98.94 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 98.94 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 98.94 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 98.94 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 98.94 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 98.94 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 98.94 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 98.93 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 98.93 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 98.93 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 98.93 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 98.93 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 98.93 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 98.93 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 98.93 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 98.93 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 98.92 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 98.92 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 98.92 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 98.92 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 98.92 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 98.92 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 98.91 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 98.91 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 98.91 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 98.91 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 98.91 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 98.9 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 98.9 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 98.9 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 98.9 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 98.9 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 98.9 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 98.9 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 98.9 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 98.89 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 98.89 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 98.89 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 98.89 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 98.89 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 98.88 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 98.88 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 98.87 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 98.87 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 98.86 |
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
Probab=99.98 E-value=4.7e-31 Score=277.44 Aligned_cols=256 Identities=39% Similarity=0.724 Sum_probs=209.3
Q ss_pred cEEEEeccCCCCCCCCCCCCCCCEEEEeecCCccceeeecC-CCccccccCCceeeccccccccccCCCCchhhhhhhhc
Q psy17476 126 KVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDK-NGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVL 204 (513)
Q Consensus 126 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-~g~~g~~pp~~~~~~~~~~~~~~~~~~~~~~~~~~~~i 204 (513)
..++++|||.+...++|+|++||.+.|++..++.||.++.. .|..|++|.+|+++.+.+
T Consensus 3 ~~~~al~~~~~~~~~el~~~~gd~~~v~~~~~~~ww~~~~~~~g~~G~~P~~yv~~~~~l-------------------- 62 (452)
T 1fmk_A 3 TTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSI-------------------- 62 (452)
T ss_dssp EEEEESSCBCCCSSSBCCBCTTCEEEESCCCSSSEEEEEETTTCCEEEEEGGGEEETTSG--------------------
T ss_pred eEEEECCccCCCCCCCCCccCCCEEEEeccCCCCceEEEEcCCCcccccCcccccccccc--------------------
Confidence 46899999999999999999999999999989999999886 689999999998753311
Q ss_pred ccccccccCccccceeeeeeeeecCCCCCCCCCcceeccccccccccCCCCCcCCCCCCHHHHHHHHcCC-CCCceEEEe
Q psy17476 205 NYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTEVVDRVQRGIILEKPKAWYVGDMSRQRAESILKQE-DKEGCFVVR 283 (513)
Q Consensus 205 ~~~~~~~~~Dvws~G~~l~el~t~g~~pf~~~~~~~~~~~i~~~~~~~~p~~w~~~~~~R~~aeeLL~~~-~~~g~fliR 283 (513)
...+|+++.++|..|+++|... ..+|.||||
T Consensus 63 ------------------------------------------------e~~~w~~g~~~r~~ae~~L~~~~~~~G~FLvR 94 (452)
T 1fmk_A 63 ------------------------------------------------QAEEWYFGKITRRESERLLLNAENPRGTFLVR 94 (452)
T ss_dssp ------------------------------------------------GGSTTEEETCCHHHHHHHHTCTTSCTTEEEEE
T ss_pred ------------------------------------------------cccccccCCccHHHHHHHhccCCCCCceEEEE
Confidence 0124999999999999999764 467999999
Q ss_pred ecCC-CCceEEEEEeccCCCceeeEEEeeccccceecCCCccccChhhhhccCCcEEEEecCCCCcEEEEEEeeeCCCcc
Q psy17476 284 NSST-KGLYTLSLYTKVPHPHVKHYHIKQNSRGEFFLSEKHCCHSIPEVKDKEGCFVVRNSSTKGLYTLSLYTKVPHPHV 362 (513)
Q Consensus 284 ~s~~-~~~~~lsl~~~~~~~~~~~~~i~~~~~g~~~~~~~~~~~~~~~~l~~~g~~LvR~s~~~~~~~lsv~~~~~~~~v 362 (513)
+|++ ++.|++|++..... ....+
T Consensus 95 ~s~~~~g~y~lsv~~~~~~--------------------------------------------------------~~~~v 118 (452)
T 1fmk_A 95 ESETTKGAYCLSVSDFDNA--------------------------------------------------------KGLNV 118 (452)
T ss_dssp ECSSSTTCEEEEEEEEETT--------------------------------------------------------TEEEE
T ss_pred eCCCCCCceEEEEEeeccC--------------------------------------------------------CCCcE
Confidence 9965 78899987642100 02357
Q ss_pred ceeEEEEcCCccEEEecCcccCChhhhhhcccccCCCCccccCcCCCCCCCCCcccCCCCccccCCcCceeEeEeccccc
Q psy17476 363 KHYHIKQNSRGEFFLSEKHCCHSIPEVVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEIDPAELMLLEELGSGQF 442 (513)
Q Consensus 363 ~h~~I~~~~~~~~~i~~~~~F~sl~eLi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lG~G~f 442 (513)
+|+.|....++.|++.+...|.++.+++.+|....++++.++. .+|+...+....+..+.|+++.++|++.+.||+|+|
T Consensus 119 ~h~~I~~~~~g~~~~~~~~~F~Sl~~Li~~y~~~~~~l~~~l~-~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~lG~G~f 197 (452)
T 1fmk_A 119 KHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLT-TVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCF 197 (452)
T ss_dssp EEEEEEECTTSCEESSTTSEESSHHHHHHHHTTCCTTSSSCCC-EECCCCCCCCSSSSTTCSBCCGGGEEEEEEEEECSS
T ss_pred EEEEEEEcCCCCEEEecCcccCCHHHHHHHhhhccccchhhcc-ccccccccccCCCCccccccChhHceeeeeecCCCC
Confidence 7888887777788888888899999999999998888776654 345544555556667899999999999999999999
Q ss_pred ceEEEEEEeCceeeEEeec--CCCCHHHHHHHHHHHhcCCCCceeceeeEEEeCCeeEEEEccCCCC
Q psy17476 443 GVVRRGKWRGSIDVAMMKE--GTMSEDDFIEEAKVMTRLQHQNLVQLYGVCSKHRPIYIVTDTSSFR 507 (513)
Q Consensus 443 G~V~~g~~~~~~~v~~~k~--~~~~~~~f~~E~~il~~l~HpNIV~l~g~~~~~~~~~lV~E~~~~G 507 (513)
|.||+|.+.++..++++.. .....++|.+|+++|++++|||||++++++.+ +.+|||||||++|
T Consensus 198 g~Vy~~~~~~~~~vavK~~~~~~~~~~~~~~E~~~l~~l~hp~iv~~~~~~~~-~~~~iv~e~~~~g 263 (452)
T 1fmk_A 198 GEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSE-EPIYIVTEYMSKG 263 (452)
T ss_dssp CEEEEEEETTTEEEEEEECCTTSSCHHHHHHHHHHHHHCCCTTBCCEEEEECS-SSCEEEECCCTTC
T ss_pred eEEEEEEECCCceEEEEEeccCCCCHHHHHHHHHHHHhCCCCCEeeEEEEEcC-CceEEEehhhcCC
Confidence 9999999987666554443 23346789999999999999999999999976 6789999999985
|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 513 | ||||
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 1e-23 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 1e-07 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 4e-21 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 2e-08 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 1e-20 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 2e-07 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 2e-20 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 5e-10 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 1e-19 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 4e-08 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 3e-18 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 3e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 9e-18 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 4e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 5e-05 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 3e-17 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 1e-09 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 3e-16 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 4e-09 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 0.001 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 5e-16 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 1e-08 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 1e-15 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 3e-08 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 2e-15 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 3e-08 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 2e-15 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 5e-08 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 3e-15 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 3e-08 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 3e-15 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 7e-15 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 7e-15 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 3e-13 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 1e-14 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 6e-08 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 1e-14 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 0.004 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 2e-14 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 4e-14 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 2e-14 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 2e-14 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 8e-08 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 2e-14 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 1e-13 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 3e-14 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 7e-14 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 3e-14 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 4e-07 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 4e-14 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 5e-07 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 4e-14 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 4e-14 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 4e-14 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 6e-14 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 6e-05 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 8e-14 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 7e-07 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 8e-14 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 3e-04 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 9e-14 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 4e-07 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 1e-13 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 1e-13 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 1e-13 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 9e-07 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 2e-13 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 8e-11 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 2e-13 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 3e-10 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 2e-13 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 7e-13 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 2e-13 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 2e-06 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 2e-13 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 1e-06 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 3e-13 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 2e-06 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 4e-13 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 8e-09 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 4e-13 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 0.001 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 6e-13 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 9e-13 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 8e-13 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 7e-06 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 9e-13 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 9e-13 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 1e-05 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 9e-13 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 1e-06 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 1e-12 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 5e-07 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-12 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-05 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 2e-12 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 2e-12 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 5e-12 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 2e-12 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 3e-08 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 2e-12 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 2e-12 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 5e-06 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 2e-12 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 4e-12 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 2e-12 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 2e-07 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 3e-12 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 3e-11 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 3e-12 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 3e-09 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 5e-12 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 5e-12 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 2e-06 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 6e-12 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 4e-11 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 6e-12 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 4e-06 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-11 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 1e-11 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 1e-11 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 0.002 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 1e-11 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 1e-11 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 3e-05 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 1e-11 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 0.001 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 0.002 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-11 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-05 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 2e-11 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 4e-09 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 2e-11 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 4e-04 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 2e-11 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 0.001 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 2e-11 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 0.001 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 3e-11 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 8e-08 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 6e-04 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 3e-11 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 4e-11 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 4e-11 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 4e-11 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 1e-07 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 4e-11 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 2e-10 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 4e-11 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 5e-11 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 0.004 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 7e-11 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 8e-07 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 7e-11 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 3e-09 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 7e-11 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 0.002 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 8e-11 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 1e-04 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 1e-10 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 1e-10 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 2e-10 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 8e-10 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-10 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 2e-07 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 3e-10 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 4e-10 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 1e-06 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 5e-10 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 1e-05 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 5e-10 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 5e-10 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 6e-10 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 2e-04 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 7e-10 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 8e-10 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 1e-09 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 5e-08 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 1e-09 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 0.002 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 1e-09 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 6e-05 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 2e-09 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 2e-09 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 5e-07 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 2e-09 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 2e-09 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 2e-09 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 0.002 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 2e-09 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 3e-09 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 3e-09 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 2e-08 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 4e-09 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 5e-09 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 5e-09 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 4e-04 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 5e-09 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 2e-08 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 6e-09 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 8e-09 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 6e-09 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 5e-08 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 6e-09 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 7e-09 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 0.001 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 2e-08 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 2e-08 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 2e-08 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 7e-07 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 2e-08 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 3e-08 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 4e-08 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 6e-08 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 7e-08 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 1e-07 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 1e-07 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 2e-07 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 5e-07 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 6e-07 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 1e-06 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 1e-06 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 2e-06 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 3e-06 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 3e-06 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 3e-06 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 4e-06 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 5e-06 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 0.003 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 5e-06 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 2e-05 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 2e-05 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 3e-05 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 4e-05 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 7e-05 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 0.004 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 7e-04 |
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: c-src tyrosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 98.6 bits (245), Expect = 1e-23
Identities = 46/91 (50%), Positives = 59/91 (64%), Gaps = 3/91 (3%)
Query: 414 PATAGLSHDKWEIDPAELMLLEELGSGQFGVVRRGKWRGSIDVAM--MKEGTMSEDDFIE 471
P T GL+ D WEI L L +LG G FG V G W G+ VA+ +K GTMS + F++
Sbjct: 2 PQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQ 61
Query: 472 EAKVMTRLQHQNLVQLYGVCSKHRPIYIVTD 502
EA+VM +L+H+ LVQLY V S PIYIVT+
Sbjct: 62 EAQVMKKLRHEKLVQLYAVVS-EEPIYIVTE 91
|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 513 | |||
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.93 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.93 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.93 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.93 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.93 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.92 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.92 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.92 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.92 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.92 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.92 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.92 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.91 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.91 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.91 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.91 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.91 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.91 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.91 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.91 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.91 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.9 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.9 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.9 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.9 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.9 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.9 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.9 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.9 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.9 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.9 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.9 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.89 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.89 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.89 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.89 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.89 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.88 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.88 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.88 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.87 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.87 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.86 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.86 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.85 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.85 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 99.85 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.84 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.84 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 99.83 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.83 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.82 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.82 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.8 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.8 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.78 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.77 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.76 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.67 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.64 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.62 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.6 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.54 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.54 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.5 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.49 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.49 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.48 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.48 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.48 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.48 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.47 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.47 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.46 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.45 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.45 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.45 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.45 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.44 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.44 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.44 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.43 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.42 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.41 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.4 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.4 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.38 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.38 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.38 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.38 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.37 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.37 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.36 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.33 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.33 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.32 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.31 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.31 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.28 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.28 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.27 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.26 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.25 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.25 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.25 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.25 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.25 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.24 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.24 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.23 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.23 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.22 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.21 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.2 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.2 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.2 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.2 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.2 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.19 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.19 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.19 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.19 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.18 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.15 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.15 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.14 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.13 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.11 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.11 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.09 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.07 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.04 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.04 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.03 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.0 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.0 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 98.98 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 98.98 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 98.92 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 98.88 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 98.87 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 98.85 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 98.84 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 98.82 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 98.78 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 98.77 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 98.76 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 98.71 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 98.71 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 98.58 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 98.53 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 98.49 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 98.49 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 98.48 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 98.47 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.45 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 98.45 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 98.42 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.4 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 98.39 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.38 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.37 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 98.37 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 98.36 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 98.34 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 98.33 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 98.33 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 98.31 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 98.3 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 98.29 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 98.29 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.27 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.26 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 98.24 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 98.22 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.21 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.21 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.2 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 98.2 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 98.19 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.18 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 98.17 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 98.16 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 98.15 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 98.13 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 98.03 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 98.01 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 97.99 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 97.97 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 97.92 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.9 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 97.78 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 97.78 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.77 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 97.65 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 97.63 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 97.52 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 97.52 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 97.2 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 97.13 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 97.02 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 96.76 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 96.74 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 96.7 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 96.63 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 96.58 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 96.31 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 96.25 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 96.15 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 96.13 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 95.98 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 95.96 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 95.83 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 95.77 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 95.75 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 95.74 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 95.65 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 95.57 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 95.57 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 95.54 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 95.53 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 95.48 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 95.38 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 95.22 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 95.13 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 95.09 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 94.85 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 94.8 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 94.76 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 94.71 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 94.66 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 94.53 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 94.37 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 94.31 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 94.04 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 93.54 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 93.42 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 93.15 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 93.03 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 92.93 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 92.81 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 92.78 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.72 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.78 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 90.46 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 90.18 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 89.41 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 89.31 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 89.3 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 89.25 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 89.02 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 88.26 | |
| d1nd4a_ | 255 | Aminoglycoside 3'-phosphotransferase IIa (Kanamyci | 88.09 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 87.56 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 86.5 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 84.84 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 84.5 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 83.2 |
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: ephb2 receptor tyrosine kinase species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93 E-value=9.9e-28 Score=235.80 Aligned_cols=166 Identities=28% Similarity=0.488 Sum_probs=123.4
Q ss_pred CCCCcHHHHHHhcCCCCCCchhHHHHHHHHHHHHHHHHHhcceeccccCcccccccCccccccccCCccCCCceEEEecc
Q psy17476 1 MRHGSLLNYLRRHENTLGGNVGLLLDMCIQVCKGMAYLERHNYIHRETKKSLYPSSLNEISFILWPDQMIRPKVVVALYP 80 (513)
Q Consensus 1 ~~~g~L~~~l~~~~~~~~~~~~~~~~~~~qi~~gl~ylH~~~iiHrdikp~N~~~~~~~~~~~~l~~~~~~~~~~~~~~~ 80 (513)
|++|+|.+++.++... +++..+..++.|||.||+|||+++||||||||+|||++. +..+||
T Consensus 109 ~~~g~L~~~~~~~~~~--l~~~~~~~i~~qia~gl~yLH~~~iiHrDlKp~NILl~~-----------~~~~Kl------ 169 (299)
T d1jpaa_ 109 MENGSLDSFLRQNDGQ--FTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNS-----------NLVCKV------ 169 (299)
T ss_dssp CTTEEHHHHHHTTTTC--SCHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEECT-----------TCCEEE------
T ss_pred cCCCcceeeeccccCC--CCHHHHHHHHHHHHHHHHHHhhCCCccCccccceEEECC-----------CCcEEE------
Confidence 5799999999886543 688999999999999999999999999999999955444 445567
Q ss_pred ccccCCCCcccccCCeEEeeecCccceeeeeccCCCCCCCCCCCCcEEEEeccCCCCCCCCCCCCCCCEEEEeecCCccc
Q psy17476 81 FKAIEGGDLSLEKGAEYEVMDDTQEHWWKVKDKNGIRKPDQMIRPKVVVALYPFKAIEGGDLSLEKGAEYEVMDDTQEHW 160 (513)
Q Consensus 81 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ 160 (513)
+|||+++-. ..... .
T Consensus 170 ------~DFGla~~~----------------------------------------------------------~~~~~-~ 184 (299)
T d1jpaa_ 170 ------SDFGLSRFL----------------------------------------------------------EDDTS-D 184 (299)
T ss_dssp ------CCC-----------------------------------------------------------------------
T ss_pred ------CCcccceEc----------------------------------------------------------cCCCC-c
Confidence 899998610 00000 0
Q ss_pred eeeecCCCccccccCCceeeccccccccccCCCCchhhhhhhhcccccccccCccccceeeeeeeeecCCCCCCCCCcce
Q psy17476 161 WKVKDKNGSVGYIPSNYVKEKELLGLQKYDDVNGLTLELIHQVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNTE 240 (513)
Q Consensus 161 ~~~~~~~g~~g~~pp~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~Dvws~G~~l~el~t~g~~pf~~~~~~~ 240 (513)
....+..+ ..+++.+||||++....|+.++|||||||++|||+|+|+.||...+..+
T Consensus 185 ---~~~~~~~~--------------------~~~t~~y~aPE~~~~~~~~~~sDvwS~Gvvl~el~t~g~~Pf~~~~~~~ 241 (299)
T d1jpaa_ 185 ---PTYTSALG--------------------GKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQD 241 (299)
T ss_dssp ----------------------------------CGGGSCHHHHHSCCCCHHHHHHHHHHHHHHHHTTSCCTTTTCCHHH
T ss_pred ---ceeeeccc--------------------ccCCccccCHHHHhcCCCCcccccccchHHHHHHHhCCCCCCCCCCHHH
Confidence 00000000 0134556778888888999999999999999999988999999999989
Q ss_pred eccccccccccCCC------------CCcCCCCCCHHHHHHHHcC
Q psy17476 241 VVDRVQRGIILEKP------------KAWYVGDMSRQRAESILKQ 273 (513)
Q Consensus 241 ~~~~i~~~~~~~~p------------~~w~~~~~~R~~aeeLL~~ 273 (513)
+...+.++.+++.| .||..++..||++.+++..
T Consensus 242 ~~~~i~~~~~~~~~~~~~~~l~~li~~cl~~~P~~RPs~~ei~~~ 286 (299)
T d1jpaa_ 242 VINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNT 286 (299)
T ss_dssp HHHHHHTTCCCCCCTTCCHHHHHHHHHHTCSSTTTSCCHHHHHHH
T ss_pred HHHHHHcCCCCCCCccchHHHHHHHHHHcCCCHhHCcCHHHHHHH
Confidence 99999888877766 5899999999999888754
|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|