Psyllid ID: psy17777

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370-----

MIGLDGLKGELGPPGYPGSIGFPGVKGDKGERGPASPVINVKGDKGEPGKPGLEGRNGPPGERGPPGIPGFPGEKGDLGAPGPRGFPGSVGPGGPAGDIGPPGVPGLPGITIKGEKGLPGLHGKNGRDGAPGLAGEKGDYGPPGLIGKPGPPGKAGLPGVEGERGPPGDPGIQGPQGKDGIPGIPGKDGLPGYPGPKGDQGLSITGPPGERGPDGLPAGEKGFRGSPGLPGTPGLKGEQGDKGSEAQLERRDSEEETKDQKDERENQDSQDIEVPRETKESRHPYLLQERKDLLDHQGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGQDGAKGDSGGRCIGCLPGARGEKGDRGKDGLPGIPGPPGAPGMRGRDGDAGRDGPPGKDAVWTSDNLIKGERGPPGLKGDIGRDGPMGPPGPKGVIGLTGDRGFNGESGEKVWKHILSSRHGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGERGSTGSKGEPGPPGRNGPRGVPGFMGSKGEPGPRGPQGNPGPVGRRGDTGPMGEKGEPGPMGFTGDKGREGPRGLPGYPSPKGDKGEPGISLPGPPGPPGYPGEKGEKGLIGPFGKQGAPGEPGLNGLPGDIGEQGIPGLPGLQGLPGQKGDPGPLGPPGPRGFDGTPGRDGEKGNAGLPGQPGQPGLPGFPGQRGEMGLPGIEGEKGNPGLPGKIGAPGIPAIGMPGEKGDKGDLGPFGYPGPPGLPGPMGPPGLDGLPGEIGFPGLAGPVGPPGLQGLKGDKGLPGPYASEVLQGPKENRDPRDGMDPGVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQLFLGYPGLAGPAGEKGFRGSPGLPGTPGLKGEQGDKGSEGREGKPGQPGYRGPPGPQGLPGLAGIPGARGDKGDWGPQGLDGPVGPPGLRGEPGPPGRPGLDGLQGNTGPPGENGLPGAPCESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKRN

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEEEEEEEEccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccccEEEccEEccccc

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcEccccccccccccccEEEEEEcccccccccEEHHHHHHHEcEEEEEEEcccEEEEEccccccccccccEEEEEEEEEEEEEEcHHHcEEEcccccHHHEEcccccccEEEEEcccEEEccccccEEEEEEcccHHHcccccccEEEEcccHHHHEcEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEccEEEEcccccHHHEEccEccccEEEEccccEEEEcccccEEEEEEcccccccccEEHHHHHHHEcEEEEEEEcccEEEEEccccccccccccEEEEEEEEEEEEEEcHHHcEEEcccccHHHEEcccccccEEEEEcccEEEccccccEEEEEEcccHHHcccccccEEEcccccHHHEcEEEEEEEcc

migldglkgelgppgypgsigfpgvkgdkgergpaspvinvkgdkgepgkpglegrngppgergppgipgfpgekgdlgapgprgfpgsvgpggpagdigppgvpglpgitikgekglpglhgkngrdgapglagekgdygppgligkpgppgkaglpgvegergppgdpgiqgpqgkdgipgipgkdglpgypgpkgdqglsitgppgergpdglpagekgfrgspglpgtpglkgeqgdkgseaqlerrdseeetkdqkderenqdsqdievpretkesrhpyLLQERKDLLdhqgdkgwpgidgtpgqdgipglkgekghgikgepgingthgvkgekgqpggigykgepgqdgakgdsggrcigclpgargekgdrgkdglpgipgppgapgmrgrdgdagrdgppgkdavwtsdnlikgergppglkgdigrdgpmgppgpkgvigltgdrgfngesGEKVWKHILssrhgdkgwpgidgtpgqdgipglkgekghgikgepgingthgvkgekgqpggigykgepgergstgskgepgppgrngprgvpgfmgskgepgprgpqgnpgpvgrrgdtgpmgekgepgpmgftgdkgregprglpgypspkgdkgepgislpgppgppgypgekgekgligpfgkqgapgepglnglpgdigeqgipglpglqglpgqkgdpgplgppgprgfdgtpgrdgekgnaglpgqpgqpglpgfpgqrgemglpgiegekgnpglpgkigapgipaigmpgekgdkgdlgpfgypgppglpgpmgppgldglpgeigfpglagpvgppglqglkgdkglpgpyasevlqgpkenrdprdgmdpgvypdlwdprfcrilrpeVLHNAVLILRndrsywlsteepmpmmpvesTQIQKFISRCVvcevpanviavhsqsvvipecpvgwnslWIGYSFVmhtaaggdgggqslaspgscleefratpfiecngehgschyFANKLSFWLAtidpqdqwsrpqqqtlksgnlrQRISRCQLflgypglagpagekgfrgspglpgtpglkgeqgdkgsegregkpgqpgyrgppgpqglpglagipgargdkgdwgpqgldgpvgppglrgepgppgrpgldglqgntgppgenglpgapcestpdymTGILMVkhsqtaevpsctddktntqfTKLWEGYSLLYVEgneqahnqdlgfagscvrkfstmpflfcdpnnvcnyasrndrsywlsteepmpmmpvesTQIQKFISRCVvcevpanviavhsqsvvipecpvgwnslWIGYSFVmhtaaggdgggqslaspgscleefratpfiecngehgschyFANKLSFWLAtidpqdqwsrpqqqtlksgnlrQRISRCQVCIKRN

migldglkgelgppgypGSIGFPGVKGDKGergpaspvinvkgdkgepgkpglEGRNGPPGERGPPGIPGFPGEKGDLGAPGPRGFPGSVGPGGPAGDIGPPGVPGLPGITIKGEKGLPGLHGKNGRDGAPGLAGEKGDYGPPGLIGKPGPPGKAGLPGVEGERGPPGDPGIQGPQGKDGIPGIPGKDGLPGYPGPKGDQGLSITGPPGERGPDGLPAGEKGFRGSPGLpgtpglkgeqgdkgseaqlerrdseeetkdqkderenqdsqdievpretkesrhpyLLQERKDLLDHQGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGQDGAKGDSGGRCIGCLPgargekgdrgkdglpgipgppgapgMRGRDGDAGRDGppgkdavwtsdnlikgergppglkgdigrdgpmgpPGPKGVIGLTGDRGFNGESGEKVWKHILSSRHGDKGWPGIDGTPGQDGIPGLKGEKGHGIKgepgingthgvkgekgqpggIGYKGEPGERgstgskgepgppgrnGPRGVPGFMGSkgepgprgpqgnpgpVGRRGDTGPMGEKGEPGPMGFTGDKGREGPRGLPGYPSPKGDKGEPGISLPGPPGPPGYPGEKGEKGLIGPFGKQGAPGEPGLNGLPGDIGEQGIPGLPGLQGLPGQKGDPGPLGPPGPRGFDGTPGRDGEKGNAGLPGQPGQPGLPGFPGQRGEMGLPGIEGEKGNPGLPGKIGAPGIPAIGMPGEKGDKGDLGPFGYPGPPGLPGPMGPPGLDGLPGEIGFPGLAGPVGPPGLQGLKGDKGLPGPYASEvlqgpkenrdprdgMDPGVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQLFLGYPGLAGPAGEKGFRGSPGLPGTPGLKGEQGDKGSEGREGKPGQPGYRGPPGPQGLPGLAGIPGARGDKGDWGPQGLDGPVGPPGLRGEPGPPGRPGLDGLQGNTGPPGENGLPGAPCESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQqqtlksgnlrqrisrcqvcikrn

MIGLDGLKGELGPPGYPGSIGFPGVKGDKGERGPASPVINVKGDKGEPGKpglegrngppgergppgipgfpgekgDLGApgprgfpgsvgpggpagdigppgvpglpgITIKGEKGLPGLHGKNGRDGAPGLAGEKGDYgppgligkpgppgkaglpgVEGERgppgdpgiqgpqgkdgipgipgkdglpgYPGPKGDQGLSITGPPGERGPDGLPAGEKGFRGSPGLPGTPGLKGEQGDKGSEAQLERRDSEEETKDQKDERENQDSQDIEVPRETKESRHPYLLQERKDLLDHQGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGQDGAKGDSGGRCIGCLPGARGEKGDRgkdglpgipgppgapgmrgrdgdagrdgppgkdaVWTSDNLIKGERGPPGLKGDIGRDGPMGPPGPKGVIGLTGDRGFNGESGEKVWKHILSSRHGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGERGSTGSKGEpgppgrngprgvpgFMGSKgepgprgpqgnpgpvgrrgDTgpmgekgepgpmgFTGDKGREGPRGLPGYPSPKGDKgepgislpgppgppgypgekgekgLIGPFGKQGAPGEPGLNGLPGDIgeqgipglpglqglpgqkgdpgplgppgprgFDGTPGRDGEKGNAglpgqpgqpglpgfpgqrgEMGLPGIEGEKGNpglpgkigapgipaigmpgEKGDKgdlgpfgypgppglpgpmgppgldglpgEIgfpglagpvgppglqglkgDKGLPGPYASEVLQGPKENRDPRDGMDPGVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQLFLGYPGLAGPAGEKGFRGSPGLPGTPGLKGEQGDKGSEGREgkpgqpgyrgppgpqglpglagipgargDKGDWGPQGLDgpvgppglrgepgppgrpgldglqgNTGPPGENGLPGAPCESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKRN

******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************I*************************************************************************************************KVWKHIL************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************GVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTE*****MPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDG*******PGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDP*****************RQRISRCQLFLGYPGLA*********************************************************************************************************************YMTGILMVKH*******SCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLST********VESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDG*******PGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDP***********************CQVC****

MIGLDGLKGEL************************************************************P**********************************************************************PGLIG****************RGPPGDPGIQ******************************************************************************************************************************************************************************GYKGEP*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PGEIGFPGLAGPVG*P****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************FLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHS****IPECPVGWNSLWIGYSFVMHTAAGGD********PGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLA************************ISRCQVCIKR*

MIGLDGLKGELGPPGYPGSIGFPGVKGDKGERGPASPVINVKGDKGEPGKPGLEGRNGPPGERGPPGIPGFPGEKGDLGAPGPRGFPGSVGPGGPAGDIGPPGVPGLPGITIKGEKGLPGLHGKNGRDGAPGLAGEKGDYGPPGLIGKPGPPGKAGLPGVEGERGPPGDPGIQGPQGKDGIPGIPGKDGLPGYPGPKGDQGLSITGPPGERGPDGLPAGEKGFRGSPGLPGTPG***************************************VPRETKESRHPYLLQERKDLLDHQGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGQDGAKGDSGGRCIGCLPGARGEKGDRGKDGLPGIPGPPGAP***************GKDAVWTSDNLIKGERGPPGLKGDIGRDGPMGPPGPKGVIGLTGDRGFNGESGEKVWKHILSSRHGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPG***************RNGPRGVPGFMGSKG***********GPVGRRGDTGPMGEKGEPGPMGFTGDKGREGPRGLPGYPSPKGDKGEPGISLPGPPGPPGYPGEKGEKGLIGPFGKQGAPGEPGLNGLPGDIGEQGIPGLPGLQGLPGQKGDPGPLGPPGPRGFDGTPGRDGEKGNAGLPGQPGQPGLPGFPGQRGEMGLPGIEGEKGNPGLPGKIGAPGIPAIGMPGEKGDKGDLGPFGYPGPPGLPGPMGPPGLDGLPGEIGFPGLAGPVGPPGLQGLKGDKGLPGPYASEVLQGPKENRDPRDGMDPGVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQLFLGYPGLAGPAGEKGFRGSPGLPGTPG********************GYRGPPGPQGLPGLAGIPGARGDKGDWGPQGLDGPVGPPGLRGEPGPPGRPGLDGLQGNTGPPGENGLPGAPCESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKRN

*****GLKGELGP*GY*GSIGF**************************GKPGL*G**************************GP*G*********************L**********************************************************************************************LSITGPPGERGPDGLPAG*****GSPGL****************AQ*ER*DS*EETKDQKD*RENQD*QD***************************************************************************************************************************************************************************************************************************G*******KGHG*K**********************************************************************************************************************IS*P***********************************************************************************************************************************************************GPMGPPGLDGLPGEIGFPGL*GPVGPPGLQGLKGDKGLPGPYASEVLQGPKENRDPRDGMDPGVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQLFLGYPGLAGPAGEKGFRGSPGLPG***********************************************************************GRPGL****************GA*CESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKRN

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIGLDGLKGELGPPGYPGSIGFPGVKGDKGERGPASPVINVKGDKGEPGKPGLEGRNGPPGERGPPGIPGFPGEKGDLGAPGPRGFPGSVGPGGPAGDIGPPGVPGLPGITIKGEKGLPGLHGKNGRDGAPGLAGEKGDYGPPGLIGKPGPPGKAGLPGVEGERGPPGDPGIQGPQGKDGIPGIPGKDGLPGYPGPKGDQGLSITGPPGERGPDGLPAGEKGFRGSPGLPGTPGLKGEQGDKGSEAQLExxxxxxxxxxxxxxxxxxxxxDIEVPRETKESRHPYLLQERKDLLDHQGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGQDGAKGDSGGRCIGCLPGARGEKGDRGKDGLPGIPGPPGAPGMRGRDGDAGRDGPPGKDAVWTSDNLIKGERGPPGLKGDIGRDGPMGPPGPKGVIGLTGDRGFNGESGEKVWKHILSSRHGDKGWPGIDGTPGQDGIPGLKGEKGHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGERGSTGSKGEPGPPGRNGPRGVPGFMGSKGEPGPRGPQGNPGPVGRRGDTGPMGEKGEPGPMGFTGDKGREGPRGLPGYPSPKGDKGEPGISLPGPPGPPGYPGEKGEKGLIGPFGKQGAPGEPGLNGLPGDIGEQGIPGLPGLQGLPGQKGDPGPLGPPGPRGFDGTPGRDGEKGNAGLPGQPGQPGLPGFPGQRGEMGLPGIEGEKGNPGLPGKIGAPGIPAIGMPGEKGDKGDLGPFGYPGPPGLPGPMGPPGLDGLPGEIGFPGLAGPVGPPGLQGLKGDKGLPGPYASEVLQGPKENRDPRDGMDPGVYPDLWDPRFCRILRPEVLHNAVLILRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQLFLGYPGLAGPAGEKGFRGSPGLPGTPGLKGEQGDKGSEGREGKPGQPGYRGPPGPQGLPGLAGIPGARGDKGDWGPQGLDGPVGPPGLRGEPGPPGRPGLDGLQGNTGPPGENGLPGAPCESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKRN

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1375	2.2.26 [Sep-21-2011]
P08120		1779	Collagen alpha-1(IV) chai	yes	N/A	0.708	0.547	0.397	1e-144
P27393		1763	Collagen alpha-2(IV) chai	N/A	N/A	0.709	0.553	0.428	1e-139
Q14031		1691	Collagen alpha-6(IV) chai	yes	N/A	0.706	0.574	0.387	1e-129
P17140		1758	Collagen alpha-2(IV) chai	no	N/A	0.72	0.563	0.384	1e-126
P17139		1759	Collagen alpha-1(IV) chai	no	N/A	0.699	0.546	0.407	1e-125
P08572		1712	Collagen alpha-2(IV) chai	no	N/A	0.669	0.537	0.410	1e-122
P08122		1707	Collagen alpha-2(IV) chai	no	N/A	0.621	0.500	0.403	1e-116
P29400		1685	Collagen alpha-5(IV) chai	no	N/A	0.247	0.201	0.504	1e-101
P02462		1669	Collagen alpha-1(IV) chai	no	N/A	0.247	0.203	0.507	2e-98
P02463		1669	Collagen alpha-1(IV) chai	no	N/A	0.250	0.206	0.5	1e-96

>sp\|P08120\|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3	Back alignment and function desciption

 Score =  513 bits (1320), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 481/1211 (39%), Positives = 587/1211 (48%), Gaps = 237/1211 (19%)

Query: 3    GLDGLKGELGPPGYPGSIGFPGVKGDKGERG-PA----SPVINVKGDKGEPGKPGLEGRN 57
            G DG+ G+ GPPG  G  G  G+ G  GE G PA    S +  +KGDKG PG PG +G  
Sbjct: 609  GHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQ 668

Query: 58   GPPGERGPPGIPGFPGEKGDLGAPGPRGFPGSVGPGGPAGDIGPPGVPGLPGITIKGEKG 117
            G    +G  G+PG PG KG+ G  G +G  G+ G  G  G  G  G PG+PG +IKGE G
Sbjct: 669  G---FKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPG 725

Query: 118  LPGLHGKNGRDGAPGLAGEKG----------------DYGPPGLIGKPGPPGKAGLPG-- 159
              G  G  G  G+ G +GEKG                + G PG  G PGPPG+ G PG  
Sbjct: 726  FHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGER 785

Query: 160  ----VEGERGPPGDPGIQGP------------QGKDGIPGIPGKDGLPGYPG------PK 197
                ++G  GP G PG++GP            QG  G+PG PGKDGL G PG      P+
Sbjct: 786  GYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPR 845

Query: 198  GDQGLSITGPPGERGPDGLPAGEKGFRGSPGLPGTPGLKGEQGDKGSEAQLERRDSEEET 257
            G+ G+S  GP G  G +GL  GEKG RG  G  G PG  G  G  G              
Sbjct: 846  GEPGISRPGPMGPPGLNGL-QGEKGDRGPTGPIGFPGADGSVGYPG-------------- 890

Query: 258  KDQKDERENQDSQDIEVPRETKESRHPYLLQERKDL-----LDHQGDKGWPGIDGTPGQD 312
                      D  D  +P     S  P ++ E+ D+         G  G PGIDG  G+D
Sbjct: 891  ----------DRGDAGLP---GVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRD 937

Query: 313  GI------PGLKGEKGH-GIKGEPGINGTHGVKGEKGQPGGIGYKGEPGQDGAKGDSGGR 365
            G       PGL G  G+ G +G PG +G  G  G  G PG  G  G PG  GAKGD G  
Sbjct: 938  GAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGAT 997

Query: 366  CI------------GCLPGARGEKGDRGKDGLPGIPGPPGAPGMRGRDGDAGRDGPPGKD 413
             +               PG  G KGD+G  G PG  G  G PG +G  G  G DGPPG  
Sbjct: 998  GLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLP 1057

Query: 414  AVWTSDNLIKGERGPPGLKGDIG--------------------RDGPMGPPGPKGVIGLT 453
                S+   KGE GP GL+GD G                    R GP G  G +G  G+ 
Sbjct: 1058 GD-ASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGID 1116

Query: 454  GDRGFNGESGEKVWKHILSS--RHGDKGWPGIDGTPGQD--------------------- 490
            G  G NGE GE+  + +       G  G PGI G PG D                     
Sbjct: 1117 GRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDK 1176

Query: 491  ------GIPGLKGEKG----HGIKGEPGINGTHGVKGEKGQPGGI----GYKGEPGERGS 536
                  G+PGLKGE G     G  G PG  G  G++G+ G P  +    G KG  GERG 
Sbjct: 1177 GEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGY 1236

Query: 537  TGSKGEPGPPGRNGPRGVPGFMGSKGEPGPRGPQGNPGPVGRRGDTGPMGEKGEPGPM-- 594
            TG KGE G  G  GP GV G  G +G  GP G  G  G  G +GD GP GE G PG    
Sbjct: 1237 TGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIK 1296

Query: 595  ---GFTGDKGREGPRGLPGYPSPKGDKGEPGIS----LPGPPGPPGYPGEKGEKGLIGPF 647
               G  G  GR G +GL G P   G++G PG++    L G PGP G  G KGE+GL G  
Sbjct: 1297 GEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSP 1356

Query: 648  GKQGAPGEPGLNGLPGDIGEQGIPGLPGLQGLPGQKGDPGPLGPPGPRGFDGTPGRDGEK 707
            G+ G  G PG  GL GD G QG  G  GL G  GQKGD G  G  GP G    PG  G+K
Sbjct: 1357 GQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGL---PGLVGQK 1413

Query: 708  GNAGLPGQPGQPGLPGFPGQRGEMGLPGIEGEKGNPGLPGKIGAPGIPA----------- 756
            G+ G PG  G  G  G PG+RG  G  G +G  G PGLPG+ G PG+             
Sbjct: 1414 GDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQP 1473

Query: 757  -----------------IGMPGEKGDKGDLGPFGYPGPPGLPGPMGPPGLDGLPGEIGFP 799
                             IG+ GE+G+KG+ G  G  G  G PGP G     G PGE G+ 
Sbjct: 1474 GRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGD---RGEPGERGYE 1530

Query: 800  GLAGPVGPPGLQGLKGDKGLPGPYASEVLQGPKENRDPRDGMDPGV---YPDLWD----- 851
            G  G      L G KG+ G P P A + L G    R  +    P     + +LW      
Sbjct: 1531 GAIG------LIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLL 1584

Query: 852  --------------------PRFCRILRPEVLHNAV--LILRNDRSYWLSTEEPMPMMPV 889
                                PRF  +       N V     RND+++WL+T   +PMMPV
Sbjct: 1585 YVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMMPV 1644

Query: 890  ESTQIQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQ 949
            E+ +I+++ISRCVVCE PANVIAVHSQ++ +P+CP GW  LWIGYSF+MHTA G  GGGQ
Sbjct: 1645 ENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQ 1704

Query: 950  SLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNL 1009
            +L SPGSCLE+FRATPFIECNG  G+CH++    SFW+  ++    + RPQQQT+K+G  
Sbjct: 1705 ALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAGER 1764

Query: 1010 RQRISRCQLFL 1020
            +  +SRCQ+ +
Sbjct: 1765 QSHVSRCQVCM 1775

Collagen type IV is specific for basement membranes.
Drosophila melanogaster (taxid: 7227)

>sp\|P27393\|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1	Back alignment and function description

>sp\|Q14031\|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=2 SV=3	Back alignment and function description

>sp\|P17140\|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2	Back alignment and function description

>sp\|P17139\|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=4	Back alignment and function description

>sp\|P08572\|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4	Back alignment and function description

>sp\|P08122\|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=2 SV=4	Back alignment and function description

>sp\|P29400\|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2	Back alignment and function description

>sp\|P02462\|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3	Back alignment and function description

>sp\|P02463\|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=2 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1375
344253578		1614	Collagen alpha-1(IV) chain [Cricetulus g	0.925	0.788	0.365	1e-148
405978684		1630	Collagen alpha-1(IV) chain [Crassostrea	0.696	0.587	0.422	1e-148
328723513		1778	PREDICTED: collagen alpha-1(IV) chain-li	0.712	0.550	0.416	1e-145
194761530		1780	GF15711 [Drosophila ananassae] gi\|190616	0.685	0.529	0.413	1e-142
157030		1775	alpha-1 type IV collagen [Drosophila mel	0.714	0.553	0.401	1e-142
24581820		1779	collagen type IV, isoform A [Drosophila	0.708	0.547	0.397	1e-142
218506039		1779	RE33133p [Drosophila melanogaster]	0.72	0.556	0.394	1e-141
194856466		1776	GG25042 [Drosophila erecta] gi\|190660622	0.710	0.550	0.400	1e-141
148682815		1238	procollagen, type IV, alpha 6, isoform C	0.72	0.799	0.397	1e-138
324500170		1763	Collagen alpha-2(IV) chain [Ascaris suum	0.709	0.553	0.429	1e-138

>gi\|344253578\|gb\|EGW09682.1\| Collagen alpha-1(IV) chain [Cricetulus griseus]	Back alignment and taxonomy information

 Score =  533 bits (1373), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 568/1555 (36%), Positives = 721/1555 (46%), Gaps = 283/1555 (18%)

Query: 8    KGELGPPGYPGSIGFPGVKGDKGERGPASPVINVKGDKGEPGKPGLEGRNGPPGERGPPG 67
            +G  GPPG PG       +    E+G  +P     G+KG PG     G  G PG++GP G
Sbjct: 156  QGVSGPPGVPG-------QAQVKEKGDFAPT----GEKGAPGY----GEKGEPGKQGPRG 200

Query: 68   IPGFPGEKGDLGAPGPRGFPGSVGPGGPAGDIGPPGVPGLPGITIKGEKGLPGLHGKNGR 127
             PG  GEKG+ G+PG   FPG         D G PG+PG PG   +GEKG  GL G  G 
Sbjct: 201  KPGKDGEKGEKGSPG---FPG---------DSGYPGLPGRPGP--QGEKGEAGLPGPPGS 246

Query: 128  DGAPGLAGEKGDYGPPGLIGKPGPPGKAGLPGVEGERGPPGDPGIQGPQGKDGIPGIPGK 187
                   GEKG+ G PG  G  G PG  G PG++G+ GPPG P          +P   G 
Sbjct: 247  VIGTMPLGEKGERGYPGTPGLRGEPGPKGYPGIQGQPGPPGFP----------VPSQAGA 296

Query: 188  DGLPGYPGPKGDQGLSITGPPGERGPDGLPAGEKGFRGSPGLPGTPGLKGEQGDKGSEAQ 247
             G PG  G KGDQG      PG  G DG P              T G+   Q     +  
Sbjct: 297  PGFPGERGVKGDQGPPGVSLPGPSGRDGAPGPPGPPGPPGQPGHTNGIVECQPGPPGDQG 356

Query: 248  LERRDSEEETKDQKDERENQDSQDIEVPRETKESRHPYLLQERKDLLDHQ----GDKGWP 303
                  +     +  E+  +    +    E             +     Q    GD+G P
Sbjct: 357  PPGTPGQPGLTGEVGEKGQKGEGCLACDTEGLRGPPGPQGPPGEIGFPGQPGAKGDRGLP 416

Query: 304  G---IDGTPGQDGIPGL-------------------KGEKGH-GIKGEPGINGTHGVKGE 340
            G   I+G PG  G+PGL                   KG+KG  G  G+PG+ G  G  G 
Sbjct: 417  GRDGIEGLPGPQGVPGLMGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGR 476

Query: 341  KGQPGGIGYKGEPGQDGAKGDSGGRCIGCLPGARGEKGD-----------RGKDGLPGIP 389
             G PG  G KG PG  G KG+ G       PG+RG+ G             G+ G  G P
Sbjct: 477  DGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDIGPPGPPGIGSIGPTGEKGQAGFP 536

Query: 390  GPPGAPGMRGRDGDAGRDGPPGKDAVWTSDNLIKGERGPPGLKGDIGRDGPMGPPGPKGV 449
            G PG+PG+ G  G+AG+  P                 GPPG  G  G  G  GP G +G 
Sbjct: 537  GSPGSPGLPGPKGEAGKVVP---------------LPGPPGAAGLPGSPGFPGPQGDRGF 581

Query: 450  IGLTGDRGFNGESGEKVWKHILSSRH----------GDKGWPGIDGTPGQDGIPGLKGEK 499
             G  G  G  GE G      I               GD G PG  G PG +G+PG  G +
Sbjct: 582  PGTPGRPGIPGEKGAVGQPGIGFPGPPGPKGVDGLPGDTGLPGSPGRPGFNGLPGNPGPQ 641

Query: 500  GHGIKGEPGINGTHGVKGEKGQPGGIGYKGEPGERGSTGSKGEPGPPGRNGPRGVPGFMG 559
            G   KGEPGI    G+ G KGQPG  G  G PGE+G+ G    PG PG +G  G PG  G
Sbjct: 642  GQ--KGEPGI----GLPGLKGQPGLPGIPGTPGEKGNIGG---PGFPGEHGIVGPPGLQG 692

Query: 560  SKGEPGPRGPQGNPGPVGRRGDTGP--------------------MGEKGEPGPMGFT-- 597
             +G+PGP G QG  GP G  G   P                     GEKG PG  G    
Sbjct: 693  IRGDPGPPGVQGPAGPPGVPGVGPPGAMGPPGGQGPPGSSGPPGVKGEKGFPGFPGLDMP 752

Query: 598  GDKGREGPRGLPGYPSPKGDKGEPGISLPGPPGPPGYPGEKGEKGLIGPFGKQGAPGEPG 657
            G KG +G +GLPG     G  G PG    G PG PG PG KGE G++G  G+ G+PG  G
Sbjct: 753  GPKGDKGSQGLPGLTGQSGLPGLPGQQ--GTPGFPGLPGVKGEMGVMGTPGQPGSPGPAG 810

Query: 658  LNGLPGDIGEQGIPGLPGLQGLPGQKGDPGPLGPPG-PRGFDGTP--GRDGEKGNAGLPG 714
              GLPG+ G+ G+PG  G +G PG KGD G +G PG P   D        G+KG+ G  G
Sbjct: 811  TPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMDHVDMGSMKGQKGDQGEKG 870

Query: 715  QPGQPGLPGFPGQRGEMGLPGIEGEKGNPGLPGKIGAPGIPAIGMPGEKGDKGDLGPFGY 774
             PGQ G+PG PGQ+G   +PG+ GEKG  G   + G  G+P IG+PG  GDKGD G  G+
Sbjct: 871  LPGQKGVPGIPGQQG---VPGLRGEKGAKG---EKGQSGLPGIGIPGRPGDKGDQGLTGF 924

Query: 775  PGPPGLPG---PMGPPGLDGLPGEIGFPGLAGPVGPPGLQGLKGDKGLPGPYASEVLQGP 831
            PG PG  G     G PG+ G PG  G PG+ G  G PGL G KGDKGLPG      ++G 
Sbjct: 925  PGSPGEKGEKGSAGTPGMPGSPGPKGSPGIIGHPGSPGLPGEKGDKGLPGLDGIPGVKGE 984

Query: 832  KENRDPRDGMDPGVYP---------------------------------------DLWDP 852
              +R  R  M   V+                                          +  
Sbjct: 985  VGDRVLRGSMSDCVFSPQGLPGTPGPIGPAGQKGEPGSDGIPGSAGEKGEPGGSCSCFPL 1044

Query: 853  RFC-----RILRPEVLHNAVLILRNDRSYW--LSTEEPMPMMPVESTQIQKFISRCVVCE 905
            R C        RP +    +L        W  L  +E +     + + + + +       
Sbjct: 1045 RACTPDRASTERPLLCSLTLLNHSCGHKGWDRLGVQEFLEPKASKDSWVLRALKVNPAYL 1104

Query: 906  VPANVI---AVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFR 962
             P  ++      ++ + +     G   LW G    + +       G+ +       +E  
Sbjct: 1105 APLVILWRGLKETEDLRVNLAFQGIRDLW-GLQGSLEST------GRKVTREIQVGQELL 1157

Query: 963  ATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRC---QLF 1019
                +    +  +C      + F    +  ++ + R       +  L Q I +C    LF
Sbjct: 1158 GLQVLRETQDSKACRKLLQLIVFL--NLLYRNHYKR-------NAILLQSILQCPIYDLF 1208

Query: 1020 LG----YPGLAGPAGEKGFRGSPGLPGTPGLKGEQGDKGSEGREGKPGQPGYRGPPGPQG 1075
                  + GL   A  +       L    G+ G  G  GS+G  G PG PG++   G +G
Sbjct: 1209 TNSVHIFSGLVKNASVQPCICLLELAVGQGIGGSPGITGSKGDMGPPGVPGFQ---GQKG 1265

Query: 1076 LPGLAGIPGARGDKG----------------------DWGPQGLDGPVGPPGLRGEPGPP 1113
            LPGL G+ G +GD+G                      D G  G +GP G  GL+G PGP 
Sbjct: 1266 LPGLQGVKGDQGDQGLPGPKGLQGPPGPPGPYDVIKGDPGLPGPEGPPGLKGLQGPPGPK 1325

Query: 1114 GRPGLDGLQGNTGPPGENGLPGAPCES-------------------------------TP 1142
            G+ G+ G  G  GPPG  G  GAP +                                TP
Sbjct: 1326 GQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTP 1385

Query: 1143 DYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVR 1202
                G L+ +HSQT + P C           L+ GYSLLYV+GNE+AH QDLG AGSC+R
Sbjct: 1386 SVDHGFLVTRHSQTTDDPLCPPGT-----KILYHGYSLLYVQGNERAHGQDLGTAGSCLR 1440

Query: 1203 KFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMP--MMPVESTQIQKFISRCVVCEVPA 1260
            KFSTMPFLFC+ NNVCN+ASRND SYWLST EPMP  M P+    I+ FISRC VCE PA
Sbjct: 1441 KFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPTSMAPISGDNIRPFISRCAVCEAPA 1500

Query: 1261 NVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIE 1320
             V+AVHSQ++ IP+CP GW+SLWIGYSFVMHT+AG +G GQ+LASPGSCLEEFR+ PFIE
Sbjct: 1501 MVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIE 1560

Query: 1321 CNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKRN 1375
            C+G  G+C+Y+AN  SFWLATI+  + + +P   TLK+G LR  +SRCQVC++R 
Sbjct: 1561 CHG-RGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT 1614

Source: Cricetulus griseus

Species: Cricetulus griseus

Genus: Cricetulus

Family: Cricetidae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi\|405978684\|gb\|EKC43054.1\| Collagen alpha-1(IV) chain [Crassostrea gigas]	Back alignment and taxonomy information

>gi\|328723513\|ref\|XP_001947747.2\| PREDICTED: collagen alpha-1(IV) chain-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|194761530\|ref\|XP_001962982.1\| GF15711 [Drosophila ananassae] gi\|190616679\|gb\|EDV32203.1\| GF15711 [Drosophila ananassae]	Back alignment and taxonomy information

>gi\|157030\|gb\|AAA28404.1\| alpha-1 type IV collagen [Drosophila melanogaster] gi\|157078\|gb\|AAB59184.1\| type IV collagen [Drosophila melanogaster] gi\|157082\|gb\|AAA28423.1\| type IV pro-collagen [Drosophila melanogaster]	Back alignment and taxonomy information

>gi|24581820|ref|NP_723044.1| collagen type IV, isoform A [Drosophila melanogaster] gi|24581822|ref|NP_723045.1| collagen type IV, isoform B [Drosophila melanogaster] gi|24581824|ref|NP_723046.1| collagen type IV, isoform C [Drosophila melanogaster] gi|161788954|sp|P08120.3|CO4A1_DROME RecName: Full=Collagen alpha-1(IV) chain; Flags: Precursor gi|7296931|gb|AAF52204.1| collagen type IV, isoform A [Drosophila melanogaster] gi|22945625|gb|AAN10519.1| collagen type IV, isoform B [Drosophila melanogaster] gi|22945626|gb|AAN10520.1| collagen type IV, isoform C [Drosophila melanogaster]

Back alignment and taxonomy information

>gi\|218506039\|gb\|ACK77661.1\| RE33133p [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|194856466\|ref\|XP_001968755.1\| GG25042 [Drosophila erecta] gi\|190660622\|gb\|EDV57814.1\| GG25042 [Drosophila erecta]	Back alignment and taxonomy information

>gi\|148682815\|gb\|EDL14762.1\| procollagen, type IV, alpha 6, isoform CRA_c [Mus musculus]	Back alignment and taxonomy information

>gi\|324500170\|gb\|ADY40089.1\| Collagen alpha-2(IV) chain [Ascaris suum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1375
WB\|WBGene00002280		1758	let-2 [Caenorhabditis elegans	0.176	0.138	0.689	2.9e-176
UNIPROTKB\|P17140		1758	let-2 "Collagen alpha-2(IV) ch	0.176	0.138	0.689	2.9e-176
UNIPROTKB\|F1NDF5		1658	COL4A5 "Uncharacterized protei	0.176	0.146	0.619	2.3e-171
UNIPROTKB\|F1RLM1		1625	COL4A1 "Uncharacterized protei	0.176	0.148	0.624	2.6e-169
UNIPROTKB\|F1LUN5		799	Col4a5 "Protein Col4a5" [Rattu	0.176	0.304	0.623	3.5e-169
UNIPROTKB\|F1Q133		1623	COL4A1 "Uncharacterized protei	0.176	0.149	0.624	5.2e-169
UNIPROTKB\|P02462		1669	COL4A1 "Collagen alpha-1(IV) c	0.176	0.144	0.624	7e-169
RGD\|1565499		1645	Col4a5 "collagen, type IV, alp	0.176	0.147	0.623	2.9e-168
UNIPROTKB\|F1N474		1688	COL4A5 "Uncharacterized protei	0.176	0.143	0.626	4.4e-168
ZFIN\|ZDB-GENE-030131-2281		1659	col4a5 "collagen, type IV, alp	0.176	0.146	0.611	4.7e-168

WB\|WBGene00002280 let-2 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

 Score = 974 (347.9 bits), Expect = 2.9e-176, Sum P(7) = 2.9e-176
 Identities = 171/248 (68%), Positives = 200/248 (80%)

Query:  1126 GPPGENGLPGAPCESTPDYMTGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEG 1185
             G PG  GLPGAP  + P Y  G ++VKHSQT EVP C + +T     KLW+GYSLLY+EG
Sbjct:  1510 GGPGAPGLPGAPGAAGPAYRDGFVLVKHSQTTEVPRCPEGQT-----KLWDGYSLLYIEG 1564

Query:  1186 NEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQ 1245
             NE++HNQDLG AGSC+++FSTMPFLFCD NNVCNYASRN++SYWLST E +PMMPV   +
Sbjct:  1565 NEKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNEKSYWLSTSEAIPMMPVNERE 1624

Query:  1246 IQKFISRCVVCEVPANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLAS 1305
             I+ +ISRC VCE PAN IAVHSQ++ IP CP GW+SLWIGYSF MHT AG +GGGQS +S
Sbjct:  1625 IEPYISRCAVCEAPANTIAVHSQTIQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSPSS 1684

Query:  1306 PGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRI 1365
             PGSCLE+FRATPFIECNG  GSCHYFANK SFWL TID   ++  P+ QTLKSGNLR R+
Sbjct:  1685 PGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKSGNLRTRV 1744

Query:  1366 SRCQVCIK 1373
             SRCQVC+K
Sbjct:  1745 SRCQVCVK 1752

GO:0005201 "extracellular matrix structural constituent" evidence=IEA

GO:0005581 "collagen" evidence=IEA

GO:0040007 "growth" evidence=IMP

GO:0002119 "nematode larval development" evidence=IMP

GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP

GO:0000003 "reproduction" evidence=IMP

GO:0040011 "locomotion" evidence=IMP

GO:0040039 "inductive cell migration" evidence=IMP

GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP

GO:0005604 "basement membrane" evidence=IDA

GO:0005198 "structural molecule activity" evidence=IDA

UNIPROTKB\|P17140 let-2 "Collagen alpha-2(IV) chain" [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NDF5 COL4A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RLM1 COL4A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LUN5 Col4a5 "Protein Col4a5" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q133 COL4A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P02462 COL4A1 "Collagen alpha-1(IV) chain" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|1565499 Col4a5 "collagen, type IV, alpha 5" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N474 COL4A5 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-2281 col4a5 "collagen, type IV, alpha 5 (Alport syndrome)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1375
smart00111		114	smart00111, C4, C-terminal tandem repeated domain	2e-55
pfam01413		110	pfam01413, C4, C-terminal tandem repeated domain i	4e-54
pfam01413		110	pfam01413, C4, C-terminal tandem repeated domain i	1e-52
smart00111		114	smart00111, C4, C-terminal tandem repeated domain	2e-52
pfam01413		110	pfam01413, C4, C-terminal tandem repeated domain i	8e-50
smart00111		114	smart00111, C4, C-terminal tandem repeated domain	2e-46
pfam01413		110	pfam01413, C4, C-terminal tandem repeated domain i	8e-14
smart00111		114	smart00111, C4, C-terminal tandem repeated domain	3e-09
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	5e-05
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	5e-05
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	1e-04
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	1e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	1e-04
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	2e-04
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	2e-04
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	3e-04
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	6e-04
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.001
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.001
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.001
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.001
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.001
PRK14959		624	PRK14959, PRK14959, DNA polymerase III subunits ga	0.001
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.002
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.002
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.002
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.002
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.002
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.002
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	0.002
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.003
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.003
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.003
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.003
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.003
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.004
pfam01391		60	pfam01391, Collagen, Collagen triple helix repeat	0.004
PHA03169		413	PHA03169, PHA03169, hypothetical protein; Provisio	0.004
PHA03169		413	PHA03169, PHA03169, hypothetical protein; Provisio	0.004

>gnl\|CDD\|128421 smart00111, C4, C-terminal tandem repeated domain in type 4 procollagens	Back alignment and domain information

 Score =  187 bits (476), Expect = 2e-55
 Identities = 68/116 (58%), Positives = 81/116 (69%), Gaps = 3/116 (2%)

Query: 1260 ANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFI 1319
              VIAVHSQ+  +P+CP GW  LW GYSF+MHT  G  G GQ L SPGSCLE FR  PFI
Sbjct: 1    GFVIAVHSQTTNVPQCPAGWVELWTGYSFLMHTGNGE-GHGQDLGSPGSCLERFRTMPFI 59

Query: 1320 ECNGEHGSCHYFANKL-SFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIKR 1374
            ECNG  G C+Y +    SFWL+TI+P DQ++ P+  T K+G+LR  ISRCQVC K 
Sbjct: 60   ECNG-RGVCNYASRNDYSFWLSTIEPSDQFTAPRPMTPKAGDLRPYISRCQVCEKP 114

Duplicated domain in C-terminus of type 4 collagens. Mutations in alpha-5 collagen IV are associated with X-linked Alport syndrome. Length = 114

>gnl\|CDD\|144854 pfam01413, C4, C-terminal tandem repeated domain in type 4 procollagen	Back alignment and domain information

>gnl\|CDD\|144854 pfam01413, C4, C-terminal tandem repeated domain in type 4 procollagen	Back alignment and domain information

>gnl\|CDD\|128421 smart00111, C4, C-terminal tandem repeated domain in type 4 procollagens	Back alignment and domain information

>gnl\|CDD\|144854 pfam01413, C4, C-terminal tandem repeated domain in type 4 procollagen	Back alignment and domain information

>gnl\|CDD\|128421 smart00111, C4, C-terminal tandem repeated domain in type 4 procollagens	Back alignment and domain information

>gnl\|CDD\|144854 pfam01413, C4, C-terminal tandem repeated domain in type 4 procollagen	Back alignment and domain information

>gnl\|CDD\|128421 smart00111, C4, C-terminal tandem repeated domain in type 4 procollagens	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|189968 pfam01391, Collagen, Collagen triple helix repeat (20 copies)	Back alignment and domain information

>gnl\|CDD\|223003 PHA03169, PHA03169, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223003 PHA03169, PHA03169, hypothetical protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1375
KOG3546\|consensus		1167		100.0
KOG3546\|consensus		1167		100.0
PF01413		114	C4: C-terminal tandem repeated domain in type 4 pr	100.0
smart00111		114	C4 C-terminal tandem repeated domain in type 4 pro	100.0
smart00111		114	C4 C-terminal tandem repeated domain in type 4 pro	99.97
PF01413		114	C4: C-terminal tandem repeated domain in type 4 pr	99.96
PF01410		214	COLFI: Fibrillar collagen C-terminal domain; Inter	99.32
smart00038		232	COLFI Fibrillar collagens C-terminal domain. Found	99.03

>KOG3546\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.5e-38  Score=366.47  Aligned_cols=12  Identities=33%  Similarity=0.614  Sum_probs=7.7

Q ss_pred             eeeeeecccccc
Q psy17777       1172 TKLWEGYSLLYV 1183 (1375)
Q Consensus      1172 ~~l~~Gysll~~ 1183 (1375)
                      ..+|.+.|.|||
T Consensus      1101 klvwhgsSplgi 1112 (1167)
T KOG3546|consen 1101 KLVWHGSSPLGI 1112 (1167)
T ss_pred             hheecCCCccch
Confidence            356777776665

>KOG3546\|consensus	Back alignment and domain information

>PF01413 C4: C-terminal tandem repeated domain in type 4 procollagen; InterPro: IPR001442 Collagens are major components of the extracellular matrices of all metazoan life and play crucial roles in developmental processes and tissue homeostasis	Back alignment and domain information

Probab=100.00  E-value=4.6e-41  Score=326.65  Aligned_cols=112  Identities=61%  Similarity=1.197  Sum_probs=95.0

Q ss_pred             ceeEeccCCcccCCCCCCCccceeeeEEEEEcCCCCCCCCCCCCCCCchhhhcccCCceeeecCCCceeeccCCcceeee
Q psy17777       1261 NVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLA 1340 (1375)
Q Consensus      1261 ~~iavhs~~~~ip~Cp~gW~~~w~Gysf~~~t~~g~~g~gq~l~spgscl~~~r~~~~iec~~~~g~c~~~~~~~s~w~~ 1340 (1375)
                      .+||||||+..||+||.+|++||+||||+|||+ +++++||.|.||||||++||.+|||||+. +++|||++|.+||||+
T Consensus         2 ~~ia~HSQt~~iP~CP~G~~~LW~GYSfl~~tg-~~~~~gQdLgspGSCL~~F~~~Pfi~C~~-~g~C~~~~n~~S~WLs   79 (114)
T PF01413_consen    2 FVIAVHSQTDQIPDCPPGWTSLWTGYSFLMHTG-GGEGHGQDLGSPGSCLERFRTMPFIECNG-RGTCNYASNDYSYWLS   79 (114)
T ss_dssp             EEEEEE-SSSS-----TTEEEEEEEEEEEEEEE-TTEEEE--TTSGGGEESSEESS-EEEEET-TSEEEESTT-EEEEEB
T ss_pred             eEEEEecCCCCCCcCCCchhHHhhhhhhhheec-CCccccccccccchhHHHHhcCcceecCC-CCcCCccCCCcceeEE
Confidence            479999999999999999999999999999999 89999999999999999999999999999 9999999999999999


Q ss_pred             ccCCCCCcCCCccccccCC-cCCCceeeeEecccC
Q psy17777       1341 TIDPQDQWSRPQQQTLKSG-NLRQRISRCQVCIKR 1374 (1375)
Q Consensus      1341 ~~~~~~~~~~p~~~t~~~~-~~~~~~src~vc~~~ 1374 (1375)
                      |++.++||++|+++|+|++ +++++||||+|||||
T Consensus        80 t~~~~~~f~~p~~~~~~~~~~~~~~ISRC~VC~~~  114 (114)
T PF01413_consen   80 TIEPNDQFQMPMPMTPKAGEEIRSYISRCSVCEAN  114 (114)
T ss_dssp             -S-CCCTTSS-TTEEEECCGCGGGGB-EEEEEEE-
T ss_pred             ccCchhhccCCCCccccCccccccccccceEeecC
Confidence            9999999999999999999 889999999999997

Collagens are composed of three polypeptide chains (alpha chains) that fold together to form the characteristic triple helical collagenous domain. Some types of triple helical protomers contain genetically identical alpha chains forming homotrimers, whereas others contain two or three different alpha chains forming heterotrimers. The sequences required to form a collagenous domain are Gly-X-Y repeats in which the X and Y positions are frequently proline and hydroxyproline. Glycine is required every third residue as it is the only amino acid small enough to pack into the central core of the triple helix. The triple helix-forming parts are surrounded by non-collagenous (NC) domains of variable sequence, size, and shape. Even if the triple helical parts represent the most striking feature of collagens, tissue specificity as well as defined binding of non-collagens seem to be encoded in the NC domains. The terminal NC domains are excised, modified, or incorporated directly into the final suprastructure, depending on protomer type and function [, ]. Type IV collagen is one of the major constituents of basement membranes, a specialised form of extracellular matrix underlying epithelia that compartmentalises tissues and provides molecular signals for influencing cell behaviour. Each type IV chain contains a long triple-helical collagenous domain flanked by a short 7S domain of 25 residues and a globular non-collagenous NC1 domain of ~230 residues at the N and C terminus, respectively. In protomer assembly, the NC1 domains (monomers) of three chains interact, forming an NC1 trimer, to select and register chains for triple helix formation. In network assembly, the NC1 trimers of two protomers interact, forming a NC1 hexamer structure, to select and connect protomers [, , ]. The collagen IV NC1 domain contains 12 cysteines, and all of them are involved in disulphide bonds. It folds into a tertiary structure with predominantly beta-strands. The collagen IV NC1 domain is composed of two similarly folded subdomains stabilised by 3 intrachain dissulphide bonds involving the following pairs: C1-C6, C2-C5, and C3-C4. Each subdomain represents a compact disulphide-stabilised triangular structure, from which a finger-like hairpin loop projects into an incompletely formed six-stranded beta-sheet of an adjacent subdomain of the same or of an adjacent chain clamping the subdomains tightly together [, , ]. This duplicated domain is present at the C-terminal of type 4 collagen, the major structural component of glomerular basement membranes (GMB) forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Mutations in alpha-5 collagen IV are associated with X-linked Alport syndrome.; GO: 0005201 extracellular matrix structural constituent, 0005581 collagen; PDB: 1T61_F 1M3D_L 1LI1_D.

>smart00111 C4 C-terminal tandem repeated domain in type 4 procollagens	Back alignment and domain information

>smart00111 C4 C-terminal tandem repeated domain in type 4 procollagens	Back alignment and domain information

>PF01413 C4: C-terminal tandem repeated domain in type 4 procollagen; InterPro: IPR001442 Collagens are major components of the extracellular matrices of all metazoan life and play crucial roles in developmental processes and tissue homeostasis	Back alignment and domain information

Probab=99.96  E-value=2e-31  Score=259.51  Aligned_cols=106  Identities=52%  Similarity=1.042  Sum_probs=89.0

Q ss_pred             cceeecccCCCCCCccCCCCCccceeeeeeeccccccccCccccccCcCcccccccccCCCCccccCCCCccccCCCCCc
Q psy17777       1147 GILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDR 1226 (1375)
Q Consensus      1147 g~~~~rhsqs~~~p~cp~g~~~~~~~~l~~Gysll~~~g~~~a~~qdlG~~gScl~~fstmPf~~C~~~~~C~~a~~~d~ 1226 (1375)
                      +|++++|||+++||.||.+     +++||+|||||++.+++++|+|||++++|||++|++|||++|+.+++|||++ ||+
T Consensus         1 g~~ia~HSQt~~iP~CP~G-----~~~LW~GYSfl~~tg~~~~~gQdLgspGSCL~~F~~~Pfi~C~~~g~C~~~~-n~~   74 (114)
T PF01413_consen    1 GFVIAVHSQTDQIPDCPPG-----WTSLWTGYSFLMHTGGGEGHGQDLGSPGSCLERFRTMPFIECNGRGTCNYAS-NDY   74 (114)
T ss_dssp             SEEEEEE-SSSS-----TT-----EEEEEEEEEEEEEEETTEEEE--TTSGGGEESSEESS-EEEEETTSEEEEST-T-E
T ss_pred             CeEEEEecCCCCCCcCCCc-----hhHHhhhhhhhheecCCccccccccccchhHHHHhcCcceecCCCCcCCccC-CCc
Confidence            5899999999999999999     9999999999999999999999999999999999999999999999999987 999


Q ss_pred             cccccCC-------CCCCCCCCCccccceecccceeecc
Q psy17777       1227 SYWLSTE-------EPMPMMPVESTQIQKFISRCVVCEV 1258 (1375)
Q Consensus      1227 sYWld~n-------~~~p~~p~~~d~i~~~isrC~vCe~ 1258 (1375)
                      ||||++.       .+++|+++.+++|+.|||||+||++
T Consensus        75 S~WLst~~~~~~f~~p~~~~~~~~~~~~~~ISRC~VC~~  113 (114)
T PF01413_consen   75 SYWLSTIEPNDQFQMPMPMTPKAGEEIRSYISRCSVCEA  113 (114)
T ss_dssp             EEEEB-S-CCCTTSS-TTEEEECCGCGGGGB-EEEEEEE
T ss_pred             ceeEEccCchhhccCCCCccccCccccccccccceEeec
Confidence            9999999       4566789999999999999999986

>PF01410 COLFI: Fibrillar collagen C-terminal domain; InterPro: IPR000885 Collagens contain a large number of globular domains in between the regions of triple helical repeats IPR008160 from INTERPRO	Back alignment and domain information

Probab=99.32  E-value=7.4e-13  Score=146.10  Aligned_cols=117  Identities=16%  Similarity=0.366  Sum_probs=90.3

Q ss_pred             cCCCCccccCCCCccccCCCCCccccccCCCCCCCCCCCccccceecccceeeccCcceeEeccCCcccCCC------C-
Q psy17777       1204 FSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVVIPEC------P- 1276 (1375)
Q Consensus      1204 fstmPf~~C~~~~~C~~a~~~d~sYWld~n~~~p~~p~~~d~i~~~isrC~vCe~pt~~iavhs~~~~ip~C------p- 1276 (1375)
                      .+.+|+++|.++.+||. ...|++||||+|+.+     ..|+|++|      |++.+..+||+.....++.-      . 
T Consensus         7 t~~~PArtC~dL~~~~p-~~~dG~YwIDPN~G~-----~~Dai~v~------C~~~~g~TCi~p~~~~~~~~~~~~~~~~   74 (214)
T PF01410_consen    7 TKENPARTCRDLKLCHP-ELPDGEYWIDPNGGS-----PRDAIEVF------CNFTTGETCISPDQSSVPSKSWYKGSPK   74 (214)
T ss_pred             CccchhhhHHHHHhhCc-ccCCCcEeECCCCCC-----CCCcEEEE------EeeeeceEEEeccCcccccccccCCCCc
Confidence            46789999999999998 799999999999998     88999999      88877888888876555422      1 


Q ss_pred             CCCccc-ee-eeEEEEEcCCCCCCCCCCCCCCCchhhhcccCCceeeecCCCceeeccCCcceeeeccC
Q psy17777       1277 VGWNSL-WI-GYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATID 1343 (1375)
Q Consensus      1277 ~gW~~~-w~-Gysf~~~t~~g~~g~gq~l~spgscl~~~r~~~~iec~~~~g~c~~~~~~~s~w~~~~~ 1343 (1375)
                      ..|.++ .. ++.|.|....         .++.+ ..||+||+|||-+| +|+.+|+|.++..|.+...
T Consensus        75 ~~w~~~~~~g~~~f~Y~~~~---------~~~~~-~vQL~FLrLlS~~A-~Q~iTy~C~ns~~~~d~~~  132 (214)
T PF01410_consen   75 GHWFSESMNGGFQFSYSISD---------GSPVG-VVQLNFLRLLSSEA-RQNITYHCKNSVAWYDQST  132 (214)
T ss_pred             cceeeeecccccceeecCCc---------CCccc-hHHHHHHHHHhhhh-eeeEEEEcCCCcccccccc
Confidence            123322 22 4457775542         12222 78999999999999 9999999999988876543

These domains are involved in binding diverse substrates. One of these domains is found at the C terminus of fibrillar collagens. The exact function of this domain is unknown.; GO: 0005201 extracellular matrix structural constituent, 0005581 collagen

>smart00038 COLFI Fibrillar collagens C-terminal domain	Back alignment and domain information

Probab=99.03  E-value=1.5e-10  Score=129.10  Aligned_cols=129  Identities=15%  Similarity=0.294  Sum_probs=97.6

Q ss_pred             cCcCcccccccccCCCCccccCCCCccccCCCCCccccccCCCCCCCCCCCccccceecccceeeccCcceeEeccCCcc
Q psy17777       1192 QDLGFAGSCVRKFSTMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVHSQSVV 1271 (1375)
Q Consensus      1192 qdlG~~gScl~~fstmPf~~C~~~~~C~~a~~~d~sYWld~n~~~p~~p~~~d~i~~~isrC~vCe~pt~~iavhs~~~~ 1271 (1375)
                      +.+.+..+.+ .....|+++|.++..||. ..+|++||||+|+.+     ..|+|++|      |.+.+..+||+....+
T Consensus        13 ~~i~~i~~P~-Gt~~~PartC~dl~~~~p-~~~~G~YwIdPn~G~-----~~Da~~V~------C~~~~g~Tcv~p~~~~   79 (232)
T smart00038       13 NQIEQLKSPT-GTKDNPARTCKDLKLCHP-EFKDGEYWVDPNQGC-----IRDAIKVF------CNFETGETCVSPSPSS   79 (232)
T ss_pred             hHHhcccCCC-CCCCCCcchhhHHHhcCC-CCCCCCEEECCCCCC-----CCCCeEEE------EEeecCCeEEcccccc
Confidence            3344333333 345689999999999998 689999999999998     88999999      8888889999887666


Q ss_pred             cCCCC-------CCCcccee--eeEEEEEcCCCCCCCCCCCCCCCchhhhcccCCceeeecCCCceeeccCCcceeeecc
Q psy17777       1272 IPECP-------VGWNSLWI--GYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATI 1342 (1375)
Q Consensus      1272 ip~Cp-------~gW~~~w~--Gysf~~~t~~g~~g~gq~l~spgscl~~~r~~~~iec~~~~g~c~~~~~~~s~w~~~~ 1342 (1375)
                      |+.-.       ..|+++..  ++.|.|....         .++ .-..|++||+++|..| +++.+|+|.++..|++..
T Consensus        80 ~~~~~~~~~~~~~~wf~e~~~~g~~f~Y~~~~---------~~~-~~~vQltfLrllS~~A-~Q~iTy~C~ns~a~~d~~  148 (232)
T smart00038       80 IPRKTWYSGKSKHVWFGETMNGGFQFSYGDSE---------GPP-VGVVQLTFLRLLSTSA-HQNITYHCKNSVAYMDEA  148 (232)
T ss_pred             ccccccccCCCCCceeeeeccCCeEEEEecCC---------CCc-cchHHHHHHHHhcccc-eeEEEEEEEcceeEEecc
Confidence            66443       12334333  7788885432         123 2257999999999999 999999999999999876


Q ss_pred             CC
Q psy17777       1343 DP 1344 (1375)
Q Consensus      1343 ~~ 1344 (1375)
                      ..
T Consensus       149 ~~  150 (232)
T smart00038      149 TG  150 (232)
T ss_pred             cc
Confidence            53

Found at C-termini of fibrillar collagens: Ephydatia muelleri procollagen EMF1alpha, vertebrate collagens alpha(1)III, alpha(1)II, alpha(2)V etc.

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1375
1m3d_C		227	Structure Of Type Iv Collagen Nc1 Domains Length =		1e-89
1li1_C		228	The 1.9-A Crystal Structure Of The Noncollagenous (		5e-89
1m3d_A		229	Structure Of Type Iv Collagen Nc1 Domains Length =		5e-86
1li1_A		229	The 1.9-A Crystal Structure Of The Noncollagenous (		1e-85

>pdb|1M3D|C Chain C, Structure Of Type Iv Collagen Nc1 Domains Length = 227

Back alignment and structure

Iteration: 1

Score = 328 bits (840), Expect = 1e-89, Method: Composition-based stats. Identities = 151/227 (66%), Positives = 171/227 (75%), Gaps = 5/227 (2%) Query: 1147 GILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFST 1206 G L+VKHSQT + P C KLW GYSLLY EG E+AHNQDLG AGSC+ +FST Sbjct: 4 GYLLVKHSQTDQEPMCP-----VGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFST 58 Query: 1207 MPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAVH 1266 MPFL+C+P +VC YASRND+SYWLST P+PMMPV I+ +ISRC VCE PA IAVH Sbjct: 59 MPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEEDIRPYISRCSVCEAPAVAIAVH 118 Query: 1267 SQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHG 1326 SQ V IP CP GW SLWIGYSF+MHTAAG +GGGQSL SPGSCLE+FRATPFIECNG G Sbjct: 119 SQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGARG 178 Query: 1327 SCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIK 1373 +CHY+ANK SFWL TI Q P TLK+G +R ISRCQVC+K Sbjct: 179 TCHYYANKYSFWLTTIPEQSFQGTPSADTLKAGLIRTHISRCQVCMK 225

PyMOL of 1m3d

>pdb|1LI1|C Chain C, The 1.9-A Crystal Structure Of The Noncollagenous (Nc1) Domain Of Human Placenta Collagen Iv Shows Stabilization Via A Novel Type Of Covalent Met-Lys Cross-Link Length = 228

Back alignment and structure

>pdb|1M3D|A Chain A, Structure Of Type Iv Collagen Nc1 Domains Length = 229

Back alignment and structure

>pdb|1LI1|A Chain A, The 1.9-A Crystal Structure Of The Noncollagenous (Nc1) Domain Of Human Placenta Collagen Iv Shows Stabilization Via A Novel Type Of Covalent Met-Lys Cross-Link Length = 229

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1375
1t60_C		227	Type IV collagen; basement membrane, NC1 domain, s	1e-129
1t60_C		227	Type IV collagen; basement membrane, NC1 domain, s	3e-82
1t60_C		227	Type IV collagen; basement membrane, NC1 domain, s	1e-27
1t60_A		229	Type IV collagen; basement membrane, NC1 domain, s	1e-120
1t60_A		229	Type IV collagen; basement membrane, NC1 domain, s	8e-77
1t60_A		229	Type IV collagen; basement membrane, NC1 domain, s	5e-27
1t60_A		229	Type IV collagen; basement membrane, NC1 domain, s	4e-04
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-85
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-85
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-85
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-84
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-84
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-83
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-82
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-80
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-78
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-76
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-75
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-73
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-63
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-34
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-20
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-11
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	8e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	9e-10
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	1e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	2e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	3e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	4e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	6e-09
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	7e-07
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	5e-06
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-85
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-85
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-85
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-85
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-84
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-84
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-84
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-84
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-84
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-84
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-83
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-82
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-70
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-68
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-59
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-11
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	4e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	6e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	7e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	8e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	9e-10
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	1e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	5e-09
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	2e-08
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	3e-07
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	6e-11
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	3e-10
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	1e-08
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	2e-06
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	1e-05
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	1e-05
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	4e-05
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	2e-04
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	2e-04
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	3e-04
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	3e-04
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	5e-04
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	8e-04
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	2e-07
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	2e-07
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	3e-07
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	8e-07
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	1e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	1e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	1e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	2e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	3e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	4e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	6e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	8e-06
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	1e-05
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	1e-05
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	2e-05
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	3e-05
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	6e-05
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	3e-04
4dmu_A		87	Collagen III derived triple-helical peptide; dinuc	6e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	8e-07
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	8e-06
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	8e-06
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	4e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	4e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	4e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	4e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	4e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	5e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	5e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	6e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	9e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	9e-05
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	1e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	2e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	3e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	4e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	5e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	6e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	6e-04
1o91_A		178	Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, ext	6e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	7e-06
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	9e-06
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	1e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	1e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	2e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	4e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	4e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	4e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	5e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	6e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	7e-05
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	1e-04
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	2e-04
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	5e-04
2pne_A		81	6.5 kDa glycine-rich antifreeze protein; chemical	6e-04
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	7e-04
1pwb_A		177	SP-D, PSP-D, pulmonary surfactant-associated prote	8e-04

>1t60_C Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} PDB: 1m3d_C 1t61_C 1li1_C Length = 227	Back alignment and structure

 Score =  397 bits (1021), Expect = e-129
 Identities = 151/228 (66%), Positives = 171/228 (75%), Gaps = 5/228 (2%)

Query: 1146 TGILMVKHSQTAEVPSCTDDKTNTQFTKLWEGYSLLYVEGNEQAHNQDLGFAGSCVRKFS 1205
             G L+VKHSQT + P C          KLW GYSLLY EG E+AHNQDLG AGSC+ +FS
Sbjct: 3    IGYLLVKHSQTDQEPMCPVG-----MNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFS 57

Query: 1206 TMPFLFCDPNNVCNYASRNDRSYWLSTEEPMPMMPVESTQIQKFISRCVVCEVPANVIAV 1265
            TMPFL+C+P +VC YASRND+SYWLST  P+PMMPV    I+ +ISRC VCE PA  IAV
Sbjct: 58   TMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEEDIRPYISRCSVCEAPAVAIAV 117

Query: 1266 HSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEH 1325
            HSQ V IP CP GW SLWIGYSF+MHTAAG +GGGQSL SPGSCLE+FRATPFIECNG  
Sbjct: 118  HSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGAR 177

Query: 1326 GSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVCIK 1373
            G+CHY+ANK SFWL TI  Q     P   TLK+G +R  ISRCQVC+K
Sbjct: 178  GTCHYYANKYSFWLTTIPEQSFQGTPSADTLKAGLIRTHISRCQVCMK 225

PyMOL of 1t60

>1t60_C Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} PDB: 1m3d_C 1t61_C 1li1_C Length = 227	Back alignment and structure

>1t60_C Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} PDB: 1m3d_C 1t61_C 1li1_C Length = 227	Back alignment and structure

>1t60_A Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} SCOP: d.169.1.6 d.169.1.6 PDB: 1m3d_A 1t61_A 1li1_A Length = 229	Back alignment and structure

>1t60_A Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} SCOP: d.169.1.6 d.169.1.6 PDB: 1m3d_A 1t61_A 1li1_A Length = 229	Back alignment and structure

>1t60_A Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} SCOP: d.169.1.6 d.169.1.6 PDB: 1m3d_A 1t61_A 1li1_A Length = 229	Back alignment and structure

>1t60_A Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} SCOP: d.169.1.6 d.169.1.6 PDB: 1m3d_A 1t61_A 1li1_A Length = 229	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis} Length = 220	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>4dmu_A Collagen III derived triple-helical peptide; dinucleotide binding fold, collagen binding, platelet activa hemostasis, plasma, structural protein-protein binding COMP; 2.80A {Synthetic} Length = 87	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1o91_A Collagen alpha 1(VIII) chain; C1Q_LIKE_domain, extracellular matrix, adhesion, connective tissue, repeat; HET: CPS; 1.9A {Mus musculus} SCOP: b.22.1.1 Length = 178	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>2pne_A 6.5 kDa glycine-rich antifreeze protein; chemical protein synthesis, native chemical ligation; 0.98A {Synthetic} PDB: 3boi_A 3bog_A* 3bog_C* Length = 81	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1375
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	100.0
1y0f_A		1054	Collagen I alpha 1; native, in SITU, triple-helix,	100.0
3hqv_A		1056	Collagen alpha-1(I) chain; native, in SITU, molecu	100.0
1y0f_B		1026	Collagen I alpha 2; native, in SITU, triple-helix,	100.0
3hqv_B		1028	Collagen alpha-2(I) chain; native, in SITU, molecu	100.0
3hqv_A		1056	Collagen alpha-1(I) chain; native, in SITU, molecu	100.0
1t60_A		229	Type IV collagen; basement membrane, NC1 domain, s	100.0
1t60_C		227	Type IV collagen; basement membrane, NC1 domain, s	100.0
1t60_A		229	Type IV collagen; basement membrane, NC1 domain, s	100.0
1t60_C		227	Type IV collagen; basement membrane, NC1 domain, s	100.0
4ae2_A		256	Procollagen III, collagen alpha-1(III) chain; stru	99.14
1wck_A		220	BCLA protein; collagen-like protein, bacterial sur	98.15
3gxe_F		23	Collagen alpha-1(I) chain; protein-peptide complex	89.59

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 1ygv_A 3hqv_A 3hr2_A	Back alignment and structure

Probab=100.00  E-value=4.6e-84  Score=835.50  Aligned_cols=14  Identities=50%  Similarity=1.063  Sum_probs=5.2

Q ss_pred             CCCCCCCCCCCCCC
Q psy17777       1127 PPGENGLPGAPCES 1140 (1375)
Q Consensus      1127 ~~G~~G~pG~pg~~ 1140 (1375)
                      +++++++++.++++
T Consensus      1017 p~G~pGppGppGpp 1030 (1054)
T 1y0f_A         1017 PPGPPGPPGPPGPP 1030 (1054)
T ss_pred             CCCCCCCCCCCCCC
Confidence            33333333333333

PyMOL of 1y0f

>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 1ygv_A 3hqv_A 3hr2_A	Back alignment and structure

>3hqv_A Collagen alpha-1(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_A	Back alignment and structure

>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 1ygv_B 3hqv_B 3hr2_B	Back alignment and structure

>3hqv_B Collagen alpha-2(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_B	Back alignment and structure

>3hqv_A Collagen alpha-1(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_A	Back alignment and structure

>1t60_A Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} SCOP: d.169.1.6 d.169.1.6 PDB: 1m3d_A 1t61_A 1li1_A	Back alignment and structure

>1t60_C Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} PDB: 1m3d_C 1t61_C 1li1_C	Back alignment and structure

>1t60_A Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} SCOP: d.169.1.6 d.169.1.6 PDB: 1m3d_A 1t61_A 1li1_A	Back alignment and structure

>1t60_C Type IV collagen; basement membrane, NC1 domain, structural protein; 1.50A {Bos taurus} PDB: 1m3d_C 1t61_C 1li1_C	Back alignment and structure

>4ae2_A Procollagen III, collagen alpha-1(III) chain; structural protein, fibrillar collagen, extracellular matrix fibrosis; 1.68A {Homo sapiens} PDB: 4aej_A* 4ak3_A	Back alignment and structure

>1wck_A BCLA protein; collagen-like protein, bacterial surface antigen, jelly- roll topology, structural protein; 1.36A {Bacillus anthracis}	Back alignment and structure

>3gxe_F Collagen alpha-1(I) chain; protein-peptide complex, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3gxe_E*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1375
d1t61a2		111	d.169.1.6 (A:115-225) Noncollagenous (NC1) domain	1e-59
d1t61a2		111	d.169.1.6 (A:115-225) Noncollagenous (NC1) domain	3e-57
d1t61a2		111	d.169.1.6 (A:115-225) Noncollagenous (NC1) domain	2e-44
d1t61a2		111	d.169.1.6 (A:115-225) Noncollagenous (NC1) domain	5e-10
d1t61c2		111	d.169.1.6 (C:115-225) Noncollagenous (NC1) domain	3e-59
d1t61c2		111	d.169.1.6 (C:115-225) Noncollagenous (NC1) domain	5e-56
d1t61c2		111	d.169.1.6 (C:115-225) Noncollagenous (NC1) domain	3e-41
d1t61c2		111	d.169.1.6 (C:115-225) Noncollagenous (NC1) domain	3e-10
d1t61c1		109	d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of	3e-51
d1t61c1		109	d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of	6e-47
d1t61c1		109	d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of	1e-44
d1t61c1		109	d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of	5e-15
d1t61a1		109	d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of	4e-48
d1t61a1		109	d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of	6e-47
d1t61a1		109	d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of	1e-44
d1t61a1		109	d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of	2e-12

>d1t61a2 d.169.1.6 (A:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: C-type lectin-like
superfamily: C-type lectin-like
family: Noncollagenous (NC1) domain of collagen IV
domain: Noncollagenous (NC1) domain of collagen IV
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  197 bits (503), Expect = 1e-59
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 1/112 (0%)

Query: 1260 ANVIAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFI 1319
            A V+AVHSQ++ IP+CP GW+SLWIGYSFVMHT+AG +G GQ+LASPGSCLEEFR+ PFI
Sbjct: 1    AMVMAVHSQTIQIPQCPTGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFI 60

Query: 1320 ECNGEHGSCHYFANKLSFWLATIDPQDQWSRPQQQTLKSGNLRQRISRCQVC 1371
            EC+G  G+C+Y+AN  SFWLATI+  + + +P   TLK+G LR  +SRCQVC
Sbjct: 61   ECHG-RGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVC 111

PyMOL of d1t61a2

>d1t61a2 d.169.1.6 (A:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61a2 d.169.1.6 (A:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61a2 d.169.1.6 (A:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61c2 d.169.1.6 (C:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61c2 d.169.1.6 (C:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61c2 d.169.1.6 (C:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61c2 d.169.1.6 (C:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 111	Back information, alignment and structure

>d1t61c1 d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61c1 d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61c1 d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61c1 d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]} Length = 109	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1375
d1t61c2		111	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61a2		111	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61a1		109	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61c1		109	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61c1		109	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61a2		111	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61c2		111	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0
d1t61a1		109	Noncollagenous (NC1) domain of collagen IV {Cow (B	100.0

>d1t61c2 d.169.1.6 (C:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: C-type lectin-like
superfamily: C-type lectin-like
family: Noncollagenous (NC1) domain of collagen IV
domain: Noncollagenous (NC1) domain of collagen IV
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=1.6e-43  Score=336.53  Aligned_cols=111  Identities=71%  Similarity=1.317  Sum_probs=109.0

Q ss_pred             eEeccCCcccCCCCCCCccceeeeEEEEEcCCCCCCCCCCCCCCCchhhhcccCCceeeecCCCceeeccCCcceeeecc
Q psy17777       1263 IAVHSQSVVIPECPVGWNSLWIGYSFVMHTAAGGDGGGQSLASPGSCLEEFRATPFIECNGEHGSCHYFANKLSFWLATI 1342 (1375)
Q Consensus      1263 iavhs~~~~ip~Cp~gW~~~w~Gysf~~~t~~g~~g~gq~l~spgscl~~~r~~~~iec~~~~g~c~~~~~~~s~w~~~~ 1342 (1375)
                      ||||||+..||+||.+|++||+||||+|||+++++++||.|.||||||++||.+||||||+.+++|||++|.+||||+|+
T Consensus         1 iA~HSQt~~iP~CP~g~~~LW~GYSflm~t~~~~~g~GQdLgspGSCL~~F~~~Pfi~C~g~~g~C~y~~n~~SyWLst~   80 (111)
T d1t61c2           1 IAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGARGTCHYYANKYSFWLTTI   80 (111)
T ss_dssp             EEEECSSSSCCCCCTTEEEEEEEEEEEEEECSTTCEEECCTTSGGGEESSCCSSCEEEECGGGCEEECCTTCEEEEEBCC
T ss_pred             CceecCCCCCCCCCCCchhhhceeceeeeeccCCcccCcCCCCCcchHHhccCCCcEEECCCCCEecccCCCCceEeecC
Confidence            79999999999999999999999999999999999999999999999999999999999965899999999999999999


Q ss_pred             CCCCCcCCCccccccCCcCCCceeeeEeccc
Q psy17777       1343 DPQDQWSRPQQQTLKSGNLRQRISRCQVCIK 1373 (1375)
Q Consensus      1343 ~~~~~~~~p~~~t~~~~~~~~~~src~vc~~ 1373 (1375)
                      ++..||.+|+++|||+.+++++||||+||||
T Consensus        81 ~~~~~~~~P~~~t~~~~~i~~~ISRC~VC~~  111 (111)
T d1t61c2          81 PEQSFQGTPSADTLKAGLIRTHISRCQVCMK  111 (111)
T ss_dssp             SSSSEESSCCCEEEETTSSGGGBCEEEEEEE
T ss_pred             CCcccccCCccccccccccccccccceeccC
Confidence            9999999999999999999999999999998

PyMOL of d1t61c2

>d1t61a2 d.169.1.6 (A:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t61c1 d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t61c1 d.169.1.6 (C:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t61a2 d.169.1.6 (A:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t61c2 d.169.1.6 (C:115-225) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1t61a1 d.169.1.6 (A:6-114) Noncollagenous (NC1) domain of collagen IV {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure