Psyllid ID: psy18077
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 451 | ||||||
| 91079250 | 364 | PREDICTED: similar to CG17181 CG17181-PA | 0.470 | 0.582 | 0.519 | 1e-65 | |
| 332021996 | 527 | Transcriptional repressor scratch 1 [Acr | 0.410 | 0.351 | 0.621 | 3e-65 | |
| 340716290 | 527 | PREDICTED: hypothetical protein LOC10064 | 0.374 | 0.320 | 0.697 | 1e-64 | |
| 350406465 | 527 | PREDICTED: hypothetical protein LOC10074 | 0.241 | 0.206 | 0.743 | 2e-63 | |
| 321466686 | 308 | zinc finger-like protein [Daphnia pulex] | 0.356 | 0.522 | 0.698 | 2e-63 | |
| 242022105 | 253 | zinc finger protein SNAI1, putative [Ped | 0.414 | 0.739 | 0.622 | 2e-63 | |
| 328785831 | 525 | PREDICTED: zinc finger protein 615-like | 0.241 | 0.207 | 0.743 | 3e-63 | |
| 380018407 | 527 | PREDICTED: zinc finger and SCAN domain-c | 0.241 | 0.206 | 0.743 | 3e-63 | |
| 383853766 | 514 | PREDICTED: uncharacterized protein LOC10 | 0.241 | 0.212 | 0.75 | 4e-63 | |
| 157103737 | 580 | hypothetical protein AaeL_AAEL003978 [Ae | 0.199 | 0.155 | 0.810 | 4e-62 |
| >gi|91079250|ref|XP_971329.1| PREDICTED: similar to CG17181 CG17181-PA [Tribolium castaneum] gi|270004833|gb|EFA01281.1| hypothetical protein TcasGA2_TC002803 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 257 bits (656), Expect = 1e-65, Method: Compositional matrix adjust.
Identities = 132/254 (51%), Positives = 162/254 (63%), Gaps = 42/254 (16%)
Query: 70 INEDEAEMSDPVSTSSQSSSEPVASFDPAYDHLYNLTQLAEVSLA--------------- 114
+ + E + VS + + S+P D LYNLT+LAEV++A
Sbjct: 17 VEQKELNSENAVSIADEGDSQP----SECPDELYNLTKLAEVAVATGQILEQTRLSSSND 72
Query: 115 --------------------YFNQSNSFNRKSVICNTKDVDTSTANN---NNNESFQCRD 151
+ ++ +NRK V +T ++ ST + + +C D
Sbjct: 73 QPVFTYTHKLFDKSSRAPRPHLIKTEEYNRKIVSSSTVNIPHSTTQDGVLGESNDHECND 132
Query: 152 CGKHYSTSSNLARHRQIHRSPDDTKARTCPQCGKLYVSMPAYSMHLRTHNQICQCPHCSK 211
CGK YSTSSNLARHRQ HRSP D KAR CP C KLYVSMPA+SMH+RTHNQ C+C +C K
Sbjct: 133 CGKRYSTSSNLARHRQTHRSPGDKKARRCPHCDKLYVSMPAFSMHVRTHNQGCKCQYCGK 192
Query: 212 SFSRPWLLQGHIRTHTGEKPFKCKVCDKAFADKSNLRAHIQTHSKVKPFVCEKCGKAFAL 271
FSRPWLLQGHIRTHTGEKPFKC +C+KAFADKSNLRAHIQTHS KP +C +CGKAFAL
Sbjct: 193 CFSRPWLLQGHIRTHTGEKPFKCTICNKAFADKSNLRAHIQTHSNTKPHICGRCGKAFAL 252
Query: 272 KSYLYKHEDSSCLK 285
KSYLYKHE+SSC++
Sbjct: 253 KSYLYKHEESSCMR 266
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332021996|gb|EGI62322.1| Transcriptional repressor scratch 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340716290|ref|XP_003396632.1| PREDICTED: hypothetical protein LOC100643485 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350406465|ref|XP_003487779.1| PREDICTED: hypothetical protein LOC100745572 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|321466686|gb|EFX77680.1| zinc finger-like protein [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|242022105|ref|XP_002431482.1| zinc finger protein SNAI1, putative [Pediculus humanus corporis] gi|212516770|gb|EEB18744.1| zinc finger protein SNAI1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|328785831|ref|XP_003250662.1| PREDICTED: zinc finger protein 615-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380018407|ref|XP_003693120.1| PREDICTED: zinc finger and SCAN domain-containing protein 5B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383853766|ref|XP_003702393.1| PREDICTED: uncharacterized protein LOC100883915 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|157103737|ref|XP_001648105.1| hypothetical protein AaeL_AAEL003978 [Aedes aegypti] gi|108880460|gb|EAT44685.1| AAEL003978-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 451 | ||||||
| FB|FBgn0035144 | 442 | CG17181 [Drosophila melanogast | 0.292 | 0.298 | 0.795 | 1.4e-57 | |
| ZFIN|ZDB-GENE-120214-30 | 454 | si:ch1073-127d16.1 "si:ch1073- | 0.709 | 0.704 | 0.317 | 1.2e-51 | |
| ZFIN|ZDB-GENE-120214-29 | 518 | si:ch73-367f21.5 "si:ch73-367f | 0.658 | 0.573 | 0.347 | 1.5e-51 | |
| UNIPROTKB|Q15935 | 545 | ZNF77 "Zinc finger protein 77" | 0.678 | 0.561 | 0.337 | 1.5e-51 | |
| UNIPROTKB|F1N7M4 | 754 | ZNF560 "Uncharacterized protei | 0.674 | 0.403 | 0.346 | 1.9e-51 | |
| ZFIN|ZDB-GENE-110913-144 | 429 | si:dkeyp-85d8.5 "si:dkeyp-85d8 | 0.651 | 0.685 | 0.36 | 5.1e-51 | |
| ZFIN|ZDB-GENE-110913-159 | 733 | si:ch211-197f20.2 "si:ch211-19 | 0.651 | 0.401 | 0.366 | 6.5e-51 | |
| UNIPROTKB|Q8N972 | 641 | ZNF709 "Zinc finger protein 70 | 0.651 | 0.458 | 0.347 | 8.3e-51 | |
| ZFIN|ZDB-GENE-110913-145 | 656 | si:ch211-209n20.58 "si:ch211-2 | 0.685 | 0.471 | 0.357 | 8.3e-51 | |
| ZFIN|ZDB-GENE-050913-139 | 436 | zgc:113381 "zgc:113381" [Danio | 0.665 | 0.688 | 0.333 | 1.3e-50 |
| FB|FBgn0035144 CG17181 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 592 (213.5 bits), Expect = 1.4e-57, P = 1.4e-57
Identities = 105/132 (79%), Positives = 112/132 (84%)
Query: 149 CRDCGKHYSTSSNLARHRQIHRSPDDTKARTCPQCGKLYVSMPAYSMHLRTHNQICQCPH 208
C +CGK YSTSSNLARHRQ HRS D KAR CP C K+YVSMPAYSMH+RTHNQ C+C
Sbjct: 121 CPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQF 180
Query: 209 CSKSFSRPWLLQGHIRTHTGEKPFKCKVCDKAFADKSNLRAHIQTHSKVKPFVCEKCGKA 268
C K FSRPWLLQGHIRTHTGEKPFKC VC+KAFADKSNLRAHIQTHS KP C +CGKA
Sbjct: 181 CGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKA 240
Query: 269 FALKSYLYKHED 280
FALKSYLYKHE+
Sbjct: 241 FALKSYLYKHEE 252
|
|
| ZFIN|ZDB-GENE-120214-30 si:ch1073-127d16.1 "si:ch1073-127d16.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-120214-29 si:ch73-367f21.5 "si:ch73-367f21.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15935 ZNF77 "Zinc finger protein 77" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N7M4 ZNF560 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-110913-144 si:dkeyp-85d8.5 "si:dkeyp-85d8.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N972 ZNF709 "Zinc finger protein 709" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-110913-145 si:ch211-209n20.58 "si:ch211-209n20.58" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050913-139 zgc:113381 "zgc:113381" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 451 | |||
| pfam13465 | 26 | pfam13465, zf-H2C2_2, Zinc-finger double domain | 5e-05 | |
| COG0068 | 750 | COG0068, HypF, Hydrogenase maturation factor [Post | 3e-04 | |
| pfam13465 | 26 | pfam13465, zf-H2C2_2, Zinc-finger double domain | 0.001 | |
| pfam13465 | 26 | pfam13465, zf-H2C2_2, Zinc-finger double domain | 0.001 | |
| TIGR00143 | 711 | TIGR00143, hypF, [NiFe] hydrogenase maturation pro | 0.001 |
| >gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain | Back alignment and domain information |
|---|
Score = 39.7 bits (93), Expect = 5e-05
Identities = 16/24 (66%), Positives = 21/24 (87%)
Query: 219 LQGHIRTHTGEKPFKCKVCDKAFA 242
L+ H+RTHTGEKP+KC VC K+F+
Sbjct: 2 LRRHMRTHTGEKPYKCPVCGKSFS 25
|
Length = 26 |
| >gnl|CDD|223146 COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain | Back alignment and domain information |
|---|
| >gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain | Back alignment and domain information |
|---|
| >gnl|CDD|232844 TIGR00143, hypF, [NiFe] hydrogenase maturation protein HypF | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 451 | |||
| KOG1074|consensus | 958 | 99.97 | ||
| KOG2462|consensus | 279 | 99.96 | ||
| KOG1074|consensus | 958 | 99.96 | ||
| KOG3608|consensus | 467 | 99.95 | ||
| KOG3608|consensus | 467 | 99.95 | ||
| KOG2462|consensus | 279 | 99.94 | ||
| KOG3623|consensus | 1007 | 99.9 | ||
| KOG3623|consensus | 1007 | 99.89 | ||
| KOG3576|consensus | 267 | 99.65 | ||
| KOG3576|consensus | 267 | 99.65 | ||
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 99.26 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 99.25 | |
| PHA00733 | 128 | hypothetical protein | 99.23 | |
| PHA00733 | 128 | hypothetical protein | 99.09 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.96 | |
| KOG3993|consensus | 500 | 98.89 | ||
| KOG3993|consensus | 500 | 98.84 | ||
| PHA02768 | 55 | hypothetical protein; Provisional | 98.83 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 98.65 | |
| PHA00732 | 79 | hypothetical protein | 98.54 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 98.45 | |
| PHA00732 | 79 | hypothetical protein | 98.33 | |
| PHA00616 | 44 | hypothetical protein | 98.33 | |
| PHA00616 | 44 | hypothetical protein | 98.29 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 98.19 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 98.18 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.93 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 97.86 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.86 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 97.71 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 97.61 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 97.59 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 97.44 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 97.4 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 97.35 | |
| KOG2231|consensus | 669 | 97.23 | ||
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 97.19 | |
| KOG1146|consensus | 1406 | 97.16 | ||
| KOG2231|consensus | 669 | 97.14 | ||
| KOG1146|consensus | 1406 | 97.06 | ||
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 97.02 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 96.98 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 96.89 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 96.79 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 96.7 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 96.67 | |
| KOG2785|consensus | 390 | 96.63 | ||
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 96.55 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 96.54 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 96.5 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 96.21 | |
| KOG2785|consensus | 390 | 96.17 | ||
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 96.1 | |
| KOG2482|consensus | 423 | 95.95 | ||
| PRK04860 | 160 | hypothetical protein; Provisional | 95.76 | |
| KOG2482|consensus | 423 | 95.7 | ||
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 95.69 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 95.31 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 93.81 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 93.79 | |
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 93.74 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 93.28 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 92.65 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 92.56 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 92.08 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 91.83 | |
| KOG2893|consensus | 341 | 91.39 | ||
| PF12013 | 109 | DUF3505: Protein of unknown function (DUF3505); In | 89.95 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 89.94 | |
| KOG2893|consensus | 341 | 89.89 | ||
| KOG4173|consensus | 253 | 89.05 | ||
| PF12013 | 109 | DUF3505: Protein of unknown function (DUF3505); In | 87.96 | |
| KOG4173|consensus | 253 | 86.61 | ||
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 84.39 | |
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 83.87 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 82.51 | |
| COG4049 | 65 | Uncharacterized protein containing archaeal-type C | 82.32 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 82.09 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 81.95 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 80.89 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 80.57 |
| >KOG1074|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.3e-31 Score=258.28 Aligned_cols=54 Identities=31% Similarity=0.552 Sum_probs=50.7
Q ss_pred cccCccccccCChHHHHHHHHHcCCc--cccccccccCCChhhHHHHHhhhcCCCC
Q psy18077 398 RTCPQCGKLYVSMPAYSMHLRTHNQI--CQCPHCSKSFSRPWLLQGHIRTHTGGTN 451 (451)
Q Consensus 398 ~~C~~C~~~f~~~~~l~~H~~~H~~~--~~C~~C~~~f~~~~~l~~H~~~h~~~~~ 451 (451)
..|..|++.|.+...|..|+|+|+++ |.|.+|++.|..+..|+.||.+|....|
T Consensus 880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~ 935 (958)
T KOG1074|consen 880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQP 935 (958)
T ss_pred hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCC
Confidence 78999999999999999999999876 9999999999999999999999987653
|
|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2231|consensus | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG2231|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2482|consensus | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2482|consensus | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >KOG4173|consensus | Back alignment and domain information |
|---|
| >PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG4173|consensus | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 451 | ||||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 5e-32 | ||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 2e-27 | ||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 5e-19 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 4e-16 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 4e-13 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 1e-11 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 5e-09 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 2e-13 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 6e-10 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 4e-07 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 5e-13 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 7e-08 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 6e-05 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 6e-13 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 4e-08 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 4e-05 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 8e-13 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 1e-07 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 9e-05 | ||
| 1p47_A | 87 | Crystal Structure Of Tandem Zif268 Molecules Comple | 8e-13 | ||
| 1p47_A | 87 | Crystal Structure Of Tandem Zif268 Molecules Comple | 1e-07 | ||
| 1zaa_C | 87 | Zinc Finger-Dna Recognition: Crystal Structure Of A | 1e-12 | ||
| 1zaa_C | 87 | Zinc Finger-Dna Recognition: Crystal Structure Of A | 1e-07 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 2e-12 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 4e-09 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 2e-06 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 2e-12 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 4e-08 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 5e-05 | ||
| 2jp9_A | 119 | Structure Of The Wilms Tumor Suppressor Protein Zin | 3e-12 | ||
| 2jp9_A | 119 | Structure Of The Wilms Tumor Suppressor Protein Zin | 2e-11 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 5e-12 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 9e-10 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 9e-07 | ||
| 1tf6_A | 190 | Co-crystal Structure Of Xenopus Tfiiia Zinc Finger | 1e-11 | ||
| 2dlq_A | 124 | Solution Structure Of The Tandem Four Zf-C2h2 Domai | 1e-11 | ||
| 2dlq_A | 124 | Solution Structure Of The Tandem Four Zf-C2h2 Domai | 9e-04 | ||
| 1ubd_C | 124 | Co-Crystal Structure Of Human Yy1 Zinc Finger Domai | 2e-11 | ||
| 1ubd_C | 124 | Co-Crystal Structure Of Human Yy1 Zinc Finger Domai | 4e-11 | ||
| 1ubd_C | 124 | Co-Crystal Structure Of Human Yy1 Zinc Finger Domai | 2e-05 | ||
| 2ee8_A | 106 | Solution Structure Of Three Zf-C2h2 Domains From Mo | 2e-11 | ||
| 2ee8_A | 106 | Solution Structure Of Three Zf-C2h2 Domains From Mo | 1e-08 | ||
| 2ee8_A | 106 | Solution Structure Of Three Zf-C2h2 Domains From Mo | 3e-06 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 3e-11 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 6e-07 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 2e-04 | ||
| 2dmd_A | 96 | Solution Structure Of The N-Terminal C2h2 Type Zinc | 3e-11 | ||
| 2dmd_A | 96 | Solution Structure Of The N-Terminal C2h2 Type Zinc | 5e-10 | ||
| 2rpc_A | 155 | Solution Structure Of The Tandem Zf-C2h2 Domains Fr | 1e-10 | ||
| 2rpc_A | 155 | Solution Structure Of The Tandem Zf-C2h2 Domains Fr | 2e-05 | ||
| 2ebt_A | 100 | Solution Structure Of Three Tandem Repeats Of Zf-C2 | 3e-10 | ||
| 2ebt_A | 100 | Solution Structure Of Three Tandem Repeats Of Zf-C2 | 4e-06 | ||
| 2wbu_A | 90 | Crystal Structure Of The Zinc Finger Domain Of Klf4 | 1e-09 | ||
| 2wbu_A | 90 | Crystal Structure Of The Zinc Finger Domain Of Klf4 | 2e-06 | ||
| 2wbs_A | 89 | Crystal Structure Of The Zinc Finger Domain Of Klf4 | 2e-09 | ||
| 2wbs_A | 89 | Crystal Structure Of The Zinc Finger Domain Of Klf4 | 2e-06 | ||
| 3uk3_C | 57 | Crystal Structure Of Znf217 Bound To Dna Length = 5 | 3e-09 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 2e-08 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 4e-06 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 1e-04 | ||
| 1tf3_A | 92 | Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures | 3e-08 | ||
| 2gli_A | 155 | Five-Finger GliDNA COMPLEX Length = 155 | 4e-08 | ||
| 2gli_A | 155 | Five-Finger GliDNA COMPLEX Length = 155 | 2e-05 | ||
| 2csh_A | 110 | Solution Structure Of Tandem Repeat Of The Zf-C2h2 | 1e-07 | ||
| 2csh_A | 110 | Solution Structure Of Tandem Repeat Of The Zf-C2h2 | 5e-06 | ||
| 2cot_A | 77 | Solution Structure Of The First And Second Zf-C2h2 | 1e-07 | ||
| 2cot_A | 77 | Solution Structure Of The First And Second Zf-C2h2 | 3e-06 | ||
| 1x6e_A | 72 | Solution Structures Of The C2h2 Type Zinc Finger Do | 2e-07 | ||
| 1x6e_A | 72 | Solution Structures Of The C2h2 Type Zinc Finger Do | 5e-06 | ||
| 1f2i_G | 73 | Cocrystal Structure Of Selected Zinc Finger Dimer B | 2e-07 | ||
| 1llm_C | 88 | Crystal Structure Of A Zif23-Gcn4 Chimera Bound To | 8e-07 | ||
| 1llm_C | 88 | Crystal Structure Of A Zif23-Gcn4 Chimera Bound To | 8e-07 | ||
| 1x6h_A | 86 | Solution Structures Of The C2h2 Type Zinc Finger Do | 9e-07 | ||
| 2epa_A | 72 | Solution Structure Of The First And Second Zf-C2h2 | 2e-06 | ||
| 2lce_A | 74 | Chemical Shift Assignment Of Hr4436b From Homo Sapi | 6e-06 | ||
| 2lce_A | 74 | Chemical Shift Assignment Of Hr4436b From Homo Sapi | 5e-04 | ||
| 2lt7_A | 133 | Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin | 1e-05 | ||
| 2adr_A | 60 | Adr1 Dna-Binding Domain From Saccharomyces Cerevisi | 9e-05 | ||
| 2adr_A | 60 | Adr1 Dna-Binding Domain From Saccharomyces Cerevisi | 9e-05 | ||
| 2emx_A | 44 | Solution Structure Of The C2h2 Type Zinc Finger (Re | 1e-04 | ||
| 2emx_A | 44 | Solution Structure Of The C2h2 Type Zinc Finger (Re | 9e-04 | ||
| 1bbo_A | 57 | High-Resolution Solution Structure Of The Double Cy | 2e-04 | ||
| 4gzn_C | 60 | Mouse Zfp57 Zinc Fingers In Complex With Methylated | 4e-04 | ||
| 4gzn_C | 60 | Mouse Zfp57 Zinc Fingers In Complex With Methylated | 4e-04 | ||
| 2ct1_A | 77 | Solution Structure Of The Zinc Finger Domain Of Tra | 6e-04 |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
|
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 | Back alignment and structure |
| >pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 | Back alignment and structure |
| >pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 | Back alignment and structure |
| >pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 | Back alignment and structure |
| >pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 | Back alignment and structure |
| >pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 | Back alignment and structure |
| >pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 | Back alignment and structure |
| >pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 | Back alignment and structure |
| >pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 | Back alignment and structure |
| >pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 | Back alignment and structure |
| >pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 | Back alignment and structure |
| >pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 | Back alignment and structure |
| >pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 | Back alignment and structure |
| >pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 | Back alignment and structure |
| >pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 | Back alignment and structure |
| >pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 | Back alignment and structure |
| >pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 | Back alignment and structure |
| >pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 | Back alignment and structure |
| >pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 | Back alignment and structure |
| >pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 | Back alignment and structure |
| >pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 | Back alignment and structure |
| >pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 | Back alignment and structure |
| >pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 | Back alignment and structure |
| >pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 | Back alignment and structure |
| >pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 | Back alignment and structure |
| >pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 | Back alignment and structure |
| >pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 | Back alignment and structure |
| >pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 | Back alignment and structure |
| >pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 | Back alignment and structure |
| >pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 | Back alignment and structure |
| >pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 | Back alignment and structure |
| >pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 | Back alignment and structure |
| >pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 | Back alignment and structure |
| >pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 | Back alignment and structure |
| >pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 | Back alignment and structure |
| >pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 | Back alignment and structure |
| >pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 | Back alignment and structure |
| >pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 | Back alignment and structure |
| >pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 | Back alignment and structure |
| >pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 | Back alignment and structure |
| >pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 | Back alignment and structure |
| >pdb|2EMX|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 273- 303) Of Human Zinc Finger Protein 268 Length = 44 | Back alignment and structure |
| >pdb|2EMX|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 273- 303) Of Human Zinc Finger Protein 268 Length = 44 | Back alignment and structure |
| >pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 | Back alignment and structure |
| >pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 | Back alignment and structure |
| >pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 | Back alignment and structure |
| >pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 451 | |||
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 9e-48 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 3e-47 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 2e-44 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-41 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 5e-41 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 3e-39 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 8e-17 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 4e-04 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 3e-39 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-28 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 7e-28 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 5e-09 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 7e-39 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 5e-28 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 1e-22 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 1e-11 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 5e-32 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 6e-30 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 2e-23 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 1e-14 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 4e-11 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 3e-04 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 5e-32 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 1e-27 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 9e-22 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 6e-15 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 3e-31 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 5e-28 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 9e-26 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 7e-20 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 9e-16 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 4e-31 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 7e-25 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 9e-21 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 3e-11 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 2e-06 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 7e-31 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 3e-30 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 2e-28 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 4e-13 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 7e-10 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-28 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-23 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 7e-19 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-18 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 3e-06 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 4e-27 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 2e-20 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 5e-20 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 9e-13 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 5e-27 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 7e-22 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 2e-20 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 4e-18 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 3e-17 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 9e-13 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-26 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 1e-24 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 5e-20 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-18 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-07 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 9e-26 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 5e-21 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 1e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 1e-12 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 3e-08 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 4e-25 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-19 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-18 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-13 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 8e-07 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-04 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 8e-25 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 1e-20 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-18 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-09 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-07 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-07 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-23 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 1e-17 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-16 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 7e-10 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-09 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 4e-07 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 3e-23 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 2e-19 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 4e-19 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 7e-18 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 2e-11 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 1e-22 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 7e-20 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-14 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-10 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 2e-05 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 7e-04 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 3e-21 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 4e-15 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 1e-12 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 6e-09 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 2e-06 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 5e-05 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 4e-21 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 3e-17 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 3e-15 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 6e-09 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 4e-07 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 2e-20 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 4e-17 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 4e-16 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 9e-08 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 2e-07 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 2e-05 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-20 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 8e-17 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 1e-15 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-08 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-08 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 3e-19 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 5e-15 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 6e-14 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 1e-09 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 9e-09 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 1e-05 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 3e-19 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 4e-15 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 8e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 1e-10 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-10 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 8e-07 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 6e-19 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 4e-17 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-15 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 2e-08 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 3e-08 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 2e-16 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 1e-14 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 1e-14 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 4e-13 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 3e-07 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 3e-06 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 5e-16 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 4e-12 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 5e-10 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 8e-10 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-04 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 8e-04 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 9e-04 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-15 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 1e-12 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-12 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 1e-10 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 1e-04 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 5e-14 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 5e-11 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 8e-11 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 6e-09 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 2e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-13 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 6e-08 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-07 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 1e-04 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-04 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-13 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-07 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 1e-06 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 3e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-13 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-08 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-13 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-08 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-08 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 9e-06 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-05 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-13 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-08 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-13 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-08 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-05 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-13 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-07 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-07 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 6e-13 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 6e-08 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-06 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 5e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 7e-05 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-13 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-07 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-07 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-13 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-08 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-07 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 6e-13 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-08 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-06 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 6e-04 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-13 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-07 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-07 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-13 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-08 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-06 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-13 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-08 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-06 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-13 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-08 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-07 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-13 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-07 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 9e-13 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-08 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-06 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 2e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-12 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-07 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-07 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-12 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-07 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-06 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-12 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-07 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-07 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-12 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-07 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 2e-12 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 2e-07 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-06 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-12 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-07 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-06 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-12 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-07 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-06 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-12 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-07 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 2e-12 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 9e-08 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 2e-06 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 3e-05 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 5e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-12 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-07 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-06 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-12 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-07 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-06 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 2e-12 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-06 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 2e-05 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-04 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-12 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 1e-10 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 1e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 9e-05 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-12 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-07 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-06 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-04 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 2e-12 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 4e-07 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 4e-06 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 3e-05 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-12 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-07 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-06 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-12 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-07 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-06 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-12 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-07 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 9e-07 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-12 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-07 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-06 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 3e-12 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 4e-07 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 6e-07 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 3e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-12 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-07 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-06 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-12 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-07 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-06 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-12 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-07 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 4e-12 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 5e-07 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 3e-06 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 3e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-12 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-07 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-06 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-12 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-07 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-06 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-05 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-12 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-07 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-06 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 5e-12 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 5e-09 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 3e-06 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 2e-04 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 6e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-12 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-07 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-06 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-12 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-07 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-06 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-12 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-07 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-12 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-07 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 6e-12 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 5e-07 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 5e-06 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-12 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-07 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-06 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-12 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-07 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-06 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-12 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-07 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-06 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-12 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-07 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-07 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-12 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-07 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-06 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-12 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-07 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 7e-07 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-12 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-06 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-06 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 9e-12 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-07 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-06 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-05 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-12 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-07 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-06 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-11 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-06 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-11 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-07 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-11 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-07 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-06 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-11 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 9e-08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 3e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 1e-11 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 1e-06 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 6e-06 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 8e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-11 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-11 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-06 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-06 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-11 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-06 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-06 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-11 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-11 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-07 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-06 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-11 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-06 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 2e-11 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 1e-06 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 3e-06 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 2e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-11 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-06 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-06 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-11 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-06 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-06 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-11 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-06 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 5e-06 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-11 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-07 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-07 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-11 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-11 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-08 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-07 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-05 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-11 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-11 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-06 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-11 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-06 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-06 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-11 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-11 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-06 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-05 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-11 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-06 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-06 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-11 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-06 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-06 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-10 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-06 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-05 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 1e-10 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 1e-06 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 2e-06 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 3e-04 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 1e-10 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 3e-07 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 1e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-10 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-06 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-05 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-05 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 3e-10 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 7e-07 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 1e-05 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 5e-05 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 5e-04 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 7e-04 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 4e-10 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 9e-10 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 3e-09 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 1e-04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 4e-10 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 2e-04 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-10 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 7e-05 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 1e-04 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 2e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-09 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-04 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-09 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-05 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 2e-08 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 2e-05 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 2e-04 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 4e-08 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 2e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 2e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 2e-05 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 3e-04 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-08 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-04 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-04 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 8e-08 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 2e-07 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 4e-06 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 6e-06 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 8e-06 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 4e-07 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 4e-05 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 6e-04 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 6e-04 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 7e-07 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-06 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 4e-06 | |
| 1ej6_B | 1275 | Lambda1; icosahedral, non-equivalence, dsRNA virus | 6e-06 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 1e-05 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 5e-05 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 2e-04 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 1e-04 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 2e-04 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 6e-04 |
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
Score = 161 bits (410), Expect = 9e-48
Identities = 77/245 (31%), Positives = 110/245 (44%), Gaps = 68/245 (27%)
Query: 212 SFSRPWLLQGHIRTHTGEKPFKCKVCDKAFADKSNLRAHIQTHSKVKPFVCEKCGKAFAL 271
S GEKP+ C C K+F+ +L H +TH+ KP+ C +CGK+F+
Sbjct: 2 SEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSD 61
Query: 272 KSYLYKHEDSSCLKSYDSSSSEKPFKCKVCDKAFADKSNLRAHIQTHSKVKPFVCEKCGK 331
K L +H+ + + EKP+KC C K+F+ ++NLRAH +TH+ KP+ C +CGK
Sbjct: 62 KKDLTRHQ--------RTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGK 113
Query: 332 AFALKSYLYKH------EDSSCLKSYDSSSNGHLNKFTTISFQCRDCGKHYSTSSNLARH 385
+F+ ++L H E K Y +C +CGK +S NL H
Sbjct: 114 SFSQLAHLRAHQRTHTGE-----KPY----------------KCPECGKSFSREDNLHTH 152
Query: 386 RQIHRSPDDT--KARTCPQCGKLYVSMPAYSMHLRTHNQICQCPHCSKSFSRPWLLQGHI 443
++ H T K CP+CG KSFSR L H
Sbjct: 153 QRTH-----TGEKPYKCPECG--------------------------KSFSRRDALNVHQ 181
Query: 444 RTHTG 448
RTHTG
Sbjct: 182 RTHTG 186
|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 | Back alignment and structure |
|---|
| >1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 451 | |||
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 100.0 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 100.0 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.98 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.97 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.94 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.93 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.89 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.88 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.88 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.88 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.87 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.87 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.87 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.87 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.86 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.86 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.78 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.77 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.76 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.76 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.75 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.73 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.73 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.72 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.72 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.72 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.71 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.71 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.7 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.68 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.68 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.68 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.68 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.67 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.67 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.66 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.66 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.64 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.62 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.61 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.61 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.61 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.56 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.56 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.56 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.53 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.49 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.47 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.46 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.46 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.45 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.45 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.44 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.43 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.42 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.42 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.41 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.41 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.4 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.4 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.4 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.4 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.39 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.38 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.37 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.37 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.36 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.36 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.34 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.34 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.34 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.33 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.31 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.3 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.29 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.28 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.27 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 99.25 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.23 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 99.2 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 99.19 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 99.17 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 99.16 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 99.13 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 99.11 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.08 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.08 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.08 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.08 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.08 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.07 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 99.07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 99.07 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.07 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.07 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 99.07 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.07 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.07 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.06 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.06 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.05 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.05 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.05 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.05 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.05 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.05 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.05 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 99.04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.04 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.04 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.03 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.03 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.03 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.03 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.03 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.03 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.03 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.03 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.02 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.02 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.02 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.02 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.02 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.02 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.02 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.01 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.01 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.01 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.01 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.01 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.01 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.01 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.01 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.01 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.01 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.01 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.01 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.0 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.0 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 99.0 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.0 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.0 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.0 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.0 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.0 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.0 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.0 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.0 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.0 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.0 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.0 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.99 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.99 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.99 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.99 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.99 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.99 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.99 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.99 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.99 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.98 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.98 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.97 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.97 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.97 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.96 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.96 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.96 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.95 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.95 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.94 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.94 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.94 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.94 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.93 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.93 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.93 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.92 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.91 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.91 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.91 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.9 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.9 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.9 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.89 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.89 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.89 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.89 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.88 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.88 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.88 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.88 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.88 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.88 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.88 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.88 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.88 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.88 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.87 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.87 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.87 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.87 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.87 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.86 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.86 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.86 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.86 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.86 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.86 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.85 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.85 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.85 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.85 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.85 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.85 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.85 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.85 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.85 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.84 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.84 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.84 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.84 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.84 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.84 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.84 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.84 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.84 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.84 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.83 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.83 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.83 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.83 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.83 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.83 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.83 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.83 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.83 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.83 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.83 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.83 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.83 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.82 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.82 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.82 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.82 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.82 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.81 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.81 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.81 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.8 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.8 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.79 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.79 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.79 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.79 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.79 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.79 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.78 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.78 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.78 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.77 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.77 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.77 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.75 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.75 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.74 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.73 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.72 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.72 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.71 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.71 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.68 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.67 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.66 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.66 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.63 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.62 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 98.59 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.54 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 98.49 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 98.48 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.48 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 98.46 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.43 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.41 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.41 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.4 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.39 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 98.37 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 98.36 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 98.35 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 98.33 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.32 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.28 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.27 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 98.26 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 98.26 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.25 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 98.25 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 98.24 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 98.23 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.22 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.22 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.21 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.21 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 98.2 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.2 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.19 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.19 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 98.18 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.15 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.15 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 98.14 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.14 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.43 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.13 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.13 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 98.12 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.11 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.1 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 98.09 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 98.09 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 98.08 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 98.08 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 98.07 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 98.06 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 98.06 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 98.05 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.05 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 98.04 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 98.04 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.3 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 98.03 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 98.03 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 98.02 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 98.02 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 98.01 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.01 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 97.98 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.98 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.94 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 97.93 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 97.92 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 97.92 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 97.15 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 97.9 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.9 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 97.12 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 97.11 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 97.87 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 97.08 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 97.84 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 97.82 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 97.71 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 97.71 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 97.66 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 97.56 | |
| 1zw8_A | 64 | Zinc-responsive transcriptional regulator ZAP1; in | 97.08 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 96.74 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 96.49 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 96.33 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 95.31 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 95.23 | |
| 2e72_A | 49 | POGO transposable element with ZNF domain; zinc fi | 95.15 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 94.73 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 94.1 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 92.29 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 90.96 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 86.37 | |
| 2k5c_A | 95 | Uncharacterized protein PF0385; structural genomic | 85.11 | |
| 2jsp_A | 87 | Transcriptional regulatory protein ROS; prokaryoti | 84.57 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 80.13 | |
| 2jvx_A | 28 | NF-kappa-B essential modulator; CCHC classical zin | 80.06 |
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
Probab=100.00 E-value=8.8e-38 Score=271.60 Aligned_cols=181 Identities=37% Similarity=0.740 Sum_probs=121.3
Q ss_pred HhHHHHHHHcCCCCCeecccccccccChHHHHhchhhcCCCCcCCCCCCcCeeccccccccCChHHHHHHHHHhcCCCce
Q psy18077 245 SNLRAHIQTHSKVKPFVCEKCGKAFALKSYLYKHEDSSCLKSYDSSSSEKPFKCKVCDKAFADKSNLRAHIQTHSKVKPF 324 (451)
Q Consensus 245 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~ 324 (451)
..|..|++.|.++++|.|++|++.|.+...|..|++.| .++++|.|+.|++.|.+...|..|+++|+++++|
T Consensus 7 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h--------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~ 78 (190)
T 2i13_A 7 SSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTH--------TGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPY 78 (190)
T ss_dssp ------------------------CCSSHHHHHGGGCC-----------CCEECTTTCCEESSHHHHHHHHHHHHCCCCE
T ss_pred ccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHc--------CCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCc
Confidence 45566666666677777777777777777777776655 5566777777777777777777777777777777
Q ss_pred ecccCcccccChhhHHhcccccCCCccCCCCCcccCcccccccccccccccCCChHHHHHHHHhccCCCCCCCcccCccc
Q psy18077 325 VCEKCGKAFALKSYLYKHEDSSCLKSYDSSSNGHLNKFTTISFQCRDCGKHYSTSSNLARHRQIHRSPDDTKARTCPQCG 404 (451)
Q Consensus 325 ~C~~C~~~f~~~~~L~~H~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~~~~C~~C~ 404 (451)
.|+.|++.|.+...|..|++.+.+ ..+|.|++|++.|.+...|..|+++|++ +++|.|++|+
T Consensus 79 ~C~~C~~~f~~~~~l~~H~~~h~~---------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~ 140 (190)
T 2i13_A 79 KCPECGKSFSQRANLRAHQRTHTG---------------EKPYACPECGKSFSQLAHLRAHQRTHTG---EKPYKCPECG 140 (190)
T ss_dssp ECTTTCCEESCHHHHHHHHHHHHT---------------CCCEECTTTCCEESSHHHHHHHHHHHHC---CCCEECTTTC
T ss_pred cCcccCCccCCHHHHHHHHHhcCC---------------CCCCcCCCCCCccCCHHHHHHHHHHhCC---CCCeECCCCC
Confidence 888888778777777777754432 2368888888888888889999998886 7899999999
Q ss_pred cccCChHHHHHHHHHcCC--ccccccccccCCChhhHHHHHhhhcCCCC
Q psy18077 405 KLYVSMPAYSMHLRTHNQ--ICQCPHCSKSFSRPWLLQGHIRTHTGGTN 451 (451)
Q Consensus 405 ~~f~~~~~l~~H~~~H~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~ 451 (451)
+.|.+...|..|+++|++ +|+|++|++.|.+...|..|+++|+|++|
T Consensus 141 ~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~ 189 (190)
T 2i13_A 141 KSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT 189 (190)
T ss_dssp CEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC-----
T ss_pred cccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCC
Confidence 999999999999999865 49999999999999999999999999886
|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 451 | ||||
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 6e-12 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 6e-06 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 8e-05 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 8e-05 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 4e-11 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 7e-07 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 5e-05 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 5e-05 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 3e-10 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 3e-06 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 4e-10 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 3e-07 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 5e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 5e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 6e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 5e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.001 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.001 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 7e-10 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 2e-09 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 1e-08 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 2e-06 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 6e-04 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 1e-09 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 1e-09 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 9e-08 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 1e-07 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 4e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 0.001 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 0.001 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 0.002 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 0.002 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 2e-09 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 2e-05 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 2e-05 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 3e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 3e-09 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 2e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 5e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 5e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 0.002 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 2e-07 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 4e-05 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 0.002 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 5e-07 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 5e-07 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 5e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 5e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 7e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 7e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.001 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.001 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 3e-06 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 3e-06 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 4e-06 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 2e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 5e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 5e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.002 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.002 | |
| d1sp2a_ | 31 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 1e-05 | |
| d1sp2a_ | 31 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 3e-04 | |
| d1sp2a_ | 31 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 3e-04 | |
| d1sp2a_ | 31 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 5e-04 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 2e-05 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 2e-05 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 3e-05 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.001 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.003 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.003 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.003 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.003 | |
| d1ncsa_ | 47 | g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye | 5e-05 | |
| d1ncsa_ | 47 | g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye | 4e-04 | |
| d1zfda_ | 32 | g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye | 5e-05 | |
| d1zfda_ | 32 | g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye | 5e-05 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 8e-05 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 8e-05 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.002 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.002 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.002 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.002 | |
| d2glia3 | 30 | g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo | 1e-04 | |
| d2glia3 | 30 | g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo | 3e-04 | |
| d2glia3 | 30 | g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo | 3e-04 | |
| d2glia3 | 30 | g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo | 0.001 | |
| d1a1ia1 | 29 | g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) | 0.001 | |
| d1a1ia1 | 29 | g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) | 0.001 | |
| d1a1ia1 | 29 | g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) | 0.004 | |
| d1a1ia1 | 29 | g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) | 0.004 | |
| d1ubdc3 | 30 | g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger | 0.002 | |
| d1ubdc3 | 30 | g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger | 0.002 | |
| d1ubdc3 | 30 | g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger | 0.002 | |
| d1ubdc4 | 28 | g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger | 0.003 | |
| d1ubdc4 | 28 | g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger | 0.003 | |
| d1bboa1 | 28 | g.37.1.1 (A:1-28) Enhancer binding protein {Human | 0.004 |
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Kruppel-like factor 3, Bklf species: Mouse (Mus musculus) [TaxId: 10090]
Score = 57.8 bits (140), Expect = 6e-12
Identities = 15/37 (40%), Positives = 21/37 (56%)
Query: 221 GHIRTHTGEKPFKCKVCDKAFADKSNLRAHIQTHSKV 257
G R TG KPF+C CD++F+ +L H + H V
Sbjct: 1 GSTRGSTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV 37
|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 28 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 451 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.57 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.54 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 99.21 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 99.1 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.05 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 99.01 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.97 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.96 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.93 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.93 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.93 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.92 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.9 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.9 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.89 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.87 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.84 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.84 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.83 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.79 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.78 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.76 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.74 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.73 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.73 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.73 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.69 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.68 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.62 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.61 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.61 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.6 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.54 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.5 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.46 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.41 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.36 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.32 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.31 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.3 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.27 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 98.26 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.14 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.13 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 98.06 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.06 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.04 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.04 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.01 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.86 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.77 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.72 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.69 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.6 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.6 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.56 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 97.5 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 97.49 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.48 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.45 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 97.37 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.23 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.22 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.22 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 97.19 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.99 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 96.95 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.86 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 96.81 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.8 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.75 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.7 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.66 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.6 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.41 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.4 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.33 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.22 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.18 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.11 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 96.07 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.04 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 96.03 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 96.02 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.0 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 95.93 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 95.68 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 95.53 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 95.52 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 95.39 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 95.34 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 95.34 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 94.98 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 94.7 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 94.67 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 94.45 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 93.86 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 93.62 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 93.27 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 92.87 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 92.77 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 92.66 | |
| d1x6fa1 | 75 | Zinc finger protein 462, ZNF462 {Human (Homo sapie | 91.3 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 91.21 | |
| d1ubdc1 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 91.02 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 90.79 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 90.66 | |
| d1ubdc1 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 90.65 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 90.13 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 88.28 | |
| d1yuja_ | 54 | GAGA factor {Drosophila melanogaster [TaxId: 7227] | 88.08 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 87.66 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 87.47 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 87.03 | |
| d2drpa1 | 37 | Tramtrack protein (two zinc-finger peptide) {Droso | 85.69 | |
| d2drpa1 | 37 | Tramtrack protein (two zinc-finger peptide) {Droso | 84.67 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 84.22 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 83.2 | |
| d1x6fa1 | 75 | Zinc finger protein 462, ZNF462 {Human (Homo sapie | 83.04 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.57 E-value=9.3e-16 Score=99.71 Aligned_cols=52 Identities=35% Similarity=0.752 Sum_probs=48.2
Q ss_pred CcCeeccccccccCChHHHHHHHHHhcCCCceecccCcccccChhhHHhcccc
Q psy18077 293 EKPFKCKVCDKAFADKSNLRAHIQTHSKVKPFVCEKCGKAFALKSYLYKHEDS 345 (451)
Q Consensus 293 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~ 345 (451)
++||.|. ||+.|.....|..|+++|++++||.|++|+++|...+.|.+|++.
T Consensus 1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~ 52 (53)
T d2csha1 1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI 52 (53)
T ss_dssp CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence 5899995 999999999999999999999999999999999999999999864
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|