Psyllid ID: psy1807

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62
KDNKEYILSVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEKAASAEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATPVKNTENIEGAVRKEEQTAAVMSYASLSDGGGDNIYENVAENTYDNPYETALAFAEWR
cccccEEEEEccccccccccccccccccccccccEEEEEcccccccEEEEEEccccccccEEEEEEcccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccEEcccccccccccccccccEEEEcccccccccccEEEEEccEEEEEcccccccccccccccEEEEEEcccccEEccccccccccccccEEccccccccccccccEEEEccccccccEEEEEcccccEEccccEEEEcccccccccccEEEEEcccccccccEEEEEcccccccccEEEEEcccccEEccccEEEEccccEEccccccEEEEcccccccccccEEEccccccccEEEEEcccccEEEcccEEEEcccccccccccEEEEcccccccccccEEEEccccccccccEEEEEcccccEEccccccEEEEccccEEccccccEEEccccccccccccEEEccccccccEEEEEcccccEEEccccEEEcccccEEcccccEEEcccccccccccccccccccEEEEEccEEEEEEccccEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccc
cccccEEEEEcccccccccccccccccccEcccccccccccccccEEEEEEEEEccccEEEEEEEEccccccHHHccccccccccEEEEcccEEEEEccccccHHHHHHHHHHccccccccccccEcccEEEEccEEEEcccccEEEEEccccccccccccccccccccEccccccccEEEEEccccEEEEEcccccEEccccccccccccccccEEccccccccccccEEEcccccEcccEEEEEEcccEEEEcccEEEEcccccccccccEEEEEccccccccccEEEccccccccccEEEEEEcccEEEEcccEEEEccccccccccccEEEEcccccccccccEEEccccccccEEEEEEcccEEEEcccEEEEccccccccccccEEEEcccccccccccEEEccccccccccEEEEEEcccEEEEcccEEEEEEccccccccccccEEEccccccccccccEEEccccccccEEEEEEcccEEEEcccEEEEccccccccccccEEcccccccccccccEEccccccccccccccEEEEEEEcccEEEccccccccccccccEEEEccccccccccccccccccccccccccEEEEEcccccccEEEEEEcc
kdnkeyilsvggikpvtslllnsnheqTVLNSITTLMYLVTPQSKSVFIQLVGVegslslceveifttdefstdrcaseKAASAEITsfdrncyefnidkgasfADARSKcqasggdlvhgfrgitnTFLLGELERRKDRLKTLLVWIGaqkdpgitartwkwvdgevvtkpswgkdqpnnyngeqncvvldggrgwlwndvgcKLDYLHWicqhnpancgspdrhlnttfVGTVNTklgstisyacpegnmlvgsatrtckegfwtgvaptcqyvdcgklehiehgtvtlettrtthGAVAIYACHenytligetrrvcgdggkwngtepqclfdwcaeppqisggivttsgrrtgsvatyscepgfilfgsnelkcglggdwsgkaptckyvdcgspanidnghysllngttthgsvaeytcdddywleAGAMRRQVCmrdgkwsgdtpscelitcpepevpkggyvvgydlnvhstlefhcepghllvgqaslkctrqgdwdnmspqfisfyfppsetisaVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRkatpvknteniegAVRKEEQTAAVMSYAslsdgggdniyenvaentydnpyeTALAFAEWR
kdnkeyilsvggikpvtslllnSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTtdefstdrcaSEKAASAEITSFDRNCYEFNIDKGASFADARSKCQAsggdlvhgfrGITNTFLLGELERRKDRLKTLLVwigaqkdpgitartwkwvDGEVVTKpswgkdqpnnynGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLrkatpvknteniegavrkeeqtAAVMSYASLSDGGGDNIYENVAENTYDNPYETALAFAEWR
KDNKEYILSVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEKAASAEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISvgagvvlfllillaiiyarlrKATPVKNTENIEGAVRKEEQTAAVMSYASLSDGGGDNIYENVAENTYDNPYETALAFAEWR
*****YILSVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEKAASAEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATPVK********************Y*******GDNIYENVAENTYDNPYETALAF****
***KEYI*SVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTD**********EITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISA*SEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATP**NTENIEGAVRKEEQT****************IYENVAENTYDNPYETA*******
KDNKEYILSVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFS**********SAEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATPVKNTENIEGAVRKEEQTAAVMSYASLSDGGGDNIYENVAENTYDNPYETALAFAEWR
***KEYILSVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEKAASAEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATPVKNTENIEGAVRKEEQTAAVMSYASLSDGGGDNIYENVAENTYDNPYETALAFAEWR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KDNKEYILSVGGIKPVTSLLLNSNHEQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEKAASAEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGDWDNMSPQFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATPVKNTENIEGAVRKEEQTAAVMSYASLSDGGGDNIYENVAENTYDNPYETALAFAEWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query618 2.2.26 [Sep-21-2011]
Q80T79 3707 CUB and sushi domain-cont yes N/A 0.503 0.083 0.316 1e-38
Q7Z407 3707 CUB and sushi domain-cont yes N/A 0.503 0.083 0.319 2e-38
P0C6B8 3564 Sushi, von Willebrand fac no N/A 0.512 0.088 0.313 4e-37
A2AVA0 3567 Sushi, von Willebrand fac no N/A 0.451 0.078 0.333 9e-37
Q7Z408 3487 CUB and sushi domain-cont no N/A 0.509 0.090 0.3 2e-36
Q4LDE5 3571 Sushi, von Willebrand fac no N/A 0.433 0.075 0.327 1e-35
Q923L3 3564 CUB and sushi domain-cont no N/A 0.441 0.076 0.313 8e-32
Q96PZ7 3565 CUB and sushi domain-cont no N/A 0.467 0.081 0.289 5e-31
Q00690612 E-selectin OS=Mus musculu no N/A 0.572 0.578 0.253 4e-28
Q95LG1610 E-selectin OS=Equus cabal no N/A 0.555 0.562 0.256 3e-27
>sp|Q80T79|CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus GN=Csmd3 PE=2 SV=3 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/344 (31%), Positives = 158/344 (45%), Gaps = 33/344 (9%)

Query: 194  GRGWLWNDV---GCKLDYLHW-----ICQ------HNP-----ANCGSPDRHLNTTFVGT 234
            G G+ +NDV    C + YL        CQ      H P      NC  P    N+     
Sbjct: 2888 GNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESK 2947

Query: 235  V---NTKLGSTISYACPEGNMLVGSATRTCK-EGFWTGVAPTCQYVDCGKLEHIEHGTVT 290
            +   N   G+ + Y C  G  L GS+   C+  G W    P C  +DCG      +  ++
Sbjct: 2948 IEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECIMIDCGHPGIPPNAVLS 3007

Query: 291  LETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDW---CAEPPQISGG 347
             E  + T G+   Y+C    +L+G+  R C   G W+G++P C  D    C +P     G
Sbjct: 3008 GE--KYTFGSTVHYSCTGKRSLLGQASRTCQLNGHWSGSQPHCSGDTTGTCGDPGTPGHG 3065

Query: 348  IVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNGHY 407
                S  RT S   ++C+ G+IL+GS E  C   G W+G+ P CK V CG+P    NG  
Sbjct: 3066 SRQESDFRTKSTVRFACDTGYILYGSEERTCLSNGSWTGRQPECKAVQCGNPGTTANGKV 3125

Query: 408  SLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGG 467
              ++GTT   SV  Y+C + Y L   ++R+  C  +G WSG  P+C +I+C +P +P  G
Sbjct: 3126 FRIDGTTFSSSVI-YSCLEGYILSGPSVRQ--CTANGTWSGSLPNCTIISCGDPGIPANG 3182

Query: 468  YVVGYDLNVHSTLEFHCEPGHL--LVGQASLKCTRQGDWDNMSP 509
               G D  V   + + C+PG+   L G     CT  G W  + P
Sbjct: 3183 LRYGDDFVVGQNVSYMCQPGYTIELNGSRVRTCTTNGTWSGVMP 3226

Mus musculus (taxid: 10090)
>sp|Q7Z407|CSMD3_HUMAN CUB and sushi domain-containing protein 3 OS=Homo sapiens GN=CSMD3 PE=2 SV=3 Back     alignment and function description
>sp|P0C6B8|SVEP1_RAT Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|A2AVA0|SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|Q7Z408|CSMD2_HUMAN CUB and sushi domain-containing protein 2 OS=Homo sapiens GN=CSMD2 PE=1 SV=2 Back     alignment and function description
>sp|Q4LDE5|SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3 Back     alignment and function description
>sp|Q923L3|CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus GN=Csmd1 PE=2 SV=2 Back     alignment and function description
>sp|Q96PZ7|CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens GN=CSMD1 PE=1 SV=2 Back     alignment and function description
>sp|Q00690|LYAM2_MOUSE E-selectin OS=Mus musculus GN=Sele PE=2 SV=1 Back     alignment and function description
>sp|Q95LG1|LYAM2_HORSE E-selectin OS=Equus caballus GN=SELE PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query618
242022444 1103 furrowed, putative [Pediculus humanus co 0.922 0.516 0.576 0.0
307200073 1105 Sushi, von Willebrand factor type A, EGF 0.744 0.416 0.653 0.0
340715485 1109 PREDICTED: sushi, von Willebrand factor 0.744 0.414 0.651 0.0
270004998 1056 hypothetical protein TcasGA2_TC030754 [T 0.744 0.435 0.649 0.0
189235439 1087 PREDICTED: similar to C-type lectin, sel 0.744 0.423 0.649 0.0
350396836 1109 PREDICTED: sushi, von Willebrand factor 0.744 0.414 0.651 0.0
380019709 1154 PREDICTED: sushi, von Willebrand factor 0.775 0.415 0.630 0.0
66531379 1109 PREDICTED: sushi, von Willebrand factor 0.775 0.431 0.628 0.0
332026645 1086 Sushi, von Willebrand factor type A, EGF 0.744 0.423 0.643 0.0
357622670 1119 putative furrowed [Danaus plexippus] 0.776 0.428 0.619 1e-180
>gi|242022444|ref|XP_002431650.1| furrowed, putative [Pediculus humanus corporis] gi|212516958|gb|EEB18912.1| furrowed, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/588 (57%), Positives = 417/588 (70%), Gaps = 18/588 (3%)

Query: 26  EQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEKA-ASA 84
           E+ +  + T    L+    + VF+QLVGV+GSLSLCEVE+F+T EFS+DRCA   A A A
Sbjct: 168 EEGITKTFTCARTLI---GQFVFLQLVGVDGSLSLCEVEVFSTGEFSSDRCAPPGASADA 224

Query: 85  EITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTL 144
           +++SFDR C+EF++ KG SF  AR+ C+  GGDL+HG  G  NTFLL ELERRK +LKT 
Sbjct: 225 DLSSFDRTCFEFSVTKGGSFEVARTYCKNHGGDLIHGLGGPVNTFLLSELERRKPKLKTQ 284

Query: 145 LVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGC 204
           LVWIG QKD GIT+RTWKWVDG+VV+KPSWGKDQPNNYNGEQNC VLDGGR WLWNDVGC
Sbjct: 285 LVWIGVQKDEGITSRTWKWVDGQVVSKPSWGKDQPNNYNGEQNCAVLDGGRNWLWNDVGC 344

Query: 205 KLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTC-KE 263
            LDYLHW+CQ+ P+ CGSPD+  NTT  G      GS I Y CPEG+MLVGS TRTC  E
Sbjct: 345 NLDYLHWVCQYQPSGCGSPDKEANTTITGN-GYNSGSVIKYNCPEGHMLVGSETRTCTPE 403

Query: 264 GFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDG 323
           GFW+  APTC+YVDCG L+ IEHG+V L+  +TT GAVAIY+CHENYTLIG+ +R+CGDG
Sbjct: 404 GFWSDFAPTCKYVDCGPLQSIEHGSVQLQNGKTTFGAVAIYSCHENYTLIGKEKRICGDG 463

Query: 324 GKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGD 383
           G+W    PQCL DWC EPP + GG V  SGRR GSVATY+C+ GFILFGS  L CGLGGD
Sbjct: 464 GEWTEQVPQCLLDWCPEPPSVHGGKVEVSGRRAGSVATYTCQSGFILFGSPVLSCGLGGD 523

Query: 384 WSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRD 443
           WSGKAPTCK+VDCG+P NIDNG YSLLN +TT GS+ EYTC DDYWLE    ++Q+C R+
Sbjct: 524 WSGKAPTCKFVDCGAPPNIDNGQYSLLNDSTTFGSIVEYTCSDDYWLE--GQKKQICTRE 581

Query: 444 GKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGD 503
           GKWS D PSCELITC EPEVP G YVVGYD N+HS +E+HCE GH+L G+++ +CT+ G+
Sbjct: 582 GKWSADAPSCELITCDEPEVPSGSYVVGYDFNIHSNIEYHCEVGHILRGESTHQCTQTGE 641

Query: 504 WDNMSP--QFISFYFPPSETISAVSEAQTLGYMISVGAGVVLFLLILLAIIYARLRKATP 561
           W    P  +FI     P     AV+   +  Y+   G+ +    +    +    +R    
Sbjct: 642 WSGSPPVCEFIDCGKVPPMLYGAVAYTNSTTYL---GSEIRYSCVKNYRLAGPSVRYC-- 696

Query: 562 VKNTENIEGAVRKEE---QTAAVMSYASLSDGGGDNIYENVAENTYDN 606
           ++N +  EG+ + EE       V  ++ LS  G D +Y      T D+
Sbjct: 697 MENKQWSEGSPKCEEIRCPEPIVAEHSILSVTGNDRVYGRTLIRTSDS 744

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307200073|gb|EFN80419.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340715485|ref|XP_003396243.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|270004998|gb|EFA01446.1| hypothetical protein TcasGA2_TC030754 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189235439|ref|XP_001812859.1| PREDICTED: similar to C-type lectin, selectin-like (AGAP000929-PA) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350396836|ref|XP_003484683.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380019709|ref|XP_003693745.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|66531379|ref|XP_396985.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|332026645|gb|EGI66754.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357622670|gb|EHJ74096.1| putative furrowed [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query618
FB|FBgn0001083 1174 fw "furrowed" [Drosophila mela 0.771 0.406 0.555 9.6e-161
FB|FBgn0030617 1141 CG9095 [Drosophila melanogaste 0.610 0.330 0.320 9.6e-52
UNIPROTKB|F1NE59 3406 SVEP1 "Uncharacterized protein 0.449 0.081 0.336 8e-44
MGI|MGI:2386403 3707 Csmd3 "CUB and Sushi multiple 0.532 0.088 0.309 1.5e-42
UNIPROTKB|F1SND0 3573 SVEP1 "Uncharacterized protein 0.438 0.075 0.361 2.7e-42
UNIPROTKB|Q7Z407 3707 CSMD3 "CUB and sushi domain-co 0.555 0.092 0.306 1.6e-41
UNIPROTKB|F1Q0A7 3253 SVEP1 "Uncharacterized protein 0.511 0.097 0.324 5.8e-41
UNIPROTKB|J9NWK3 3569 SVEP1 "Uncharacterized protein 0.511 0.088 0.324 6.5e-41
UNIPROTKB|J9P1K9 3640 SVEP1 "Uncharacterized protein 0.511 0.086 0.324 6.6e-41
UNIPROTKB|F1MNH3 3573 SVEP1 "Uncharacterized protein 0.521 0.090 0.318 1.1e-40
FB|FBgn0001083 fw "furrowed" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1549 (550.3 bits), Expect = 9.6e-161, Sum P(2) = 9.6e-161
 Identities = 270/486 (55%), Positives = 348/486 (71%)

Query:    26 EQTVLNSITTLMYLVTPQSKSVFIQLVGVEGSLSLCEVEIFTTDEFSTDRCASEK-AASA 84
             ++ V+ + T    LV    + V IQLVGVEGSLSLCEVE FT DEFS DRC S K     
Sbjct:   216 DEGVVKTFTCARPLV---GQYVAIQLVGVEGSLSLCEVETFTNDEFSVDRCLSPKIGVDT 272

Query:    85 EITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTL 144
              +T+F + CY+F+I KG SF  A++ C+ +GGDLVH FRG T++++L ELERRK  LK  
Sbjct:   273 VVTTFSKTCYDFHITKGESFDKAQAICKQTGGDLVHDFRGATSSYILSELERRKSELKPQ 332

Query:   145 LVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGC 204
             LVWIGAQK+PGIT+RTWKWV+G+VV KP+WGKDQPNNYNGEQNCVVLDGGR WLWNDVGC
Sbjct:   333 LVWIGAQKEPGITSRTWKWVNGDVVQKPTWGKDQPNNYNGEQNCVVLDGGRNWLWNDVGC 392

Query:   205 KLDYLHWICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRTCK-E 263
              LDYLH+ICQH+P +CGSPD   NTT +G   T LG  I Y CP+G+ L+G   R C+ +
Sbjct:   393 NLDYLHFICQHSPLSCGSPDAQQNTTVMGKKFT-LGEKIQYTCPKGHSLLGQTERECRLD 451

Query:   264 GFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDG 323
             G W+G +PTC+YVDCG L  ++ G++ +   RT+ G VA Y+CHENYTLIG   R C   
Sbjct:   452 GTWSGSSPTCKYVDCGSLPELKFGSIHMSEERTSFGVVATYSCHENYTLIGNENRTCAMD 511

Query:   324 GKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGD 383
             G W+G +P+CL DWC +P  I+GG V  + +R GS ATY CEPG++L G   + CGLGG+
Sbjct:   512 G-WSGKQPECLVDWCPDPQPIAGGDVRFNDKRAGSTATYVCEPGYVLVGEAIISCGLGGE 570

Query:   384 WSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRD 443
             WS K P+C++VDCG+PA  + G   LLNGTTT  SV +Y CD+D+WL+  +     C R+
Sbjct:   571 WSSKTPSCRFVDCGAPARPNRGIAILLNGTTTVNSVVKYECDEDHWLDGQS--ELYCTRE 628

Query:   444 GKWSGDTPSCELITCPEPEVPKGGYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGD 503
             GKWSG+ P CEL+TC  P VP G +V+GYD NVHS ++++C+PGH++ G   L+C   G+
Sbjct:   629 GKWSGEAPVCELVTCETPSVPSGSFVIGYDYNVHSKIQYNCDPGHIMHGTPVLECLDSGE 688

Query:   504 WDNMSP 509
             W   +P
Sbjct:   689 WSADAP 694
GO:0007423 "sensory organ development" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0007155 "cell adhesion" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=ISS
FB|FBgn0030617 CG9095 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE59 SVEP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2386403 Csmd3 "CUB and Sushi multiple domains 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SND0 SVEP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z407 CSMD3 "CUB and sushi domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0A7 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWK3 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1K9 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNH3 SVEP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query618
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 8e-23
cd03590126 cd03590, CLECT_DC-SIGN_like, C-type lectin-like do 4e-18
cd00037116 cd00037, CLECT, C-type lectin (CTL)/C-type lectin- 9e-18
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 3e-16
smart00034124 smart00034, CLECT, C-type lectin (CTL) or carbohyd 1e-15
smart0003256 smart00032, CCP, Domain abundant in complement con 9e-14
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 1e-13
pfam00059108 pfam00059, Lectin_C, Lectin C-type domain 2e-13
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 1e-12
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 3e-12
smart0003256 smart00032, CCP, Domain abundant in complement con 5e-12
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 8e-12
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 4e-11
smart0003256 smart00032, CCP, Domain abundant in complement con 8e-11
PHA02817225 PHA02817, PHA02817, EEV Host range protein; Provis 2e-10
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 6e-10
cd03589137 cd03589, CLECT_CEL-1_like, C-type lectin-like doma 2e-09
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 3e-09
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 6e-09
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 7e-09
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 4e-08
cd03591114 cd03591, CLECT_collectin_like, C-type lectin-like 4e-08
cd03592115 cd03592, CLECT_selectins_like, C-type lectin-like 5e-08
cd03598117 cd03598, CLECT_EMBP_like, C-type lectin-like domai 5e-08
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 9e-08
smart0003256 smart00032, CCP, Domain abundant in complement con 2e-07
smart0003256 smart00032, CCP, Domain abundant in complement con 2e-07
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 2e-07
PHA02817225 PHA02817, PHA02817, EEV Host range protein; Provis 2e-07
cd03603118 cd03603, CLECT_VCBS, A bacterial subgroup of the C 4e-07
PHA02831268 PHA02831, PHA02831, EEV host range protein; Provis 1e-06
PHA02831268 PHA02831, PHA02831, EEV host range protein; Provis 2e-06
PHA02954317 PHA02954, PHA02954, EEV membrane glycoprotein; Pro 8e-06
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 9e-06
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 9e-06
cd03594129 cd03594, CLECT_REG-1_like, C-type lectin-like doma 9e-06
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 2e-05
cd03593116 cd03593, CLECT_NK_receptors_like, C-type lectin-li 2e-04
PHA02817225 PHA02817, PHA02817, EEV Host range protein; Provis 0.001
cd03601119 cd03601, CLECT_TC14_like, C-type lectin-like domai 0.001
cd03595149 cd03595, CLECT_chondrolectin_like, C-type lectin-l 0.002
TIGR00864 2740 TIGR00864, PCC, polycystin cation channel protein 0.003
cd03588124 cd03588, CLECT_CSPGs, C-type lectin-like domain (C 0.003
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information 
 Score = 98.2 bits (244), Expect = 8e-23
 Identities = 61/187 (32%), Positives = 89/187 (47%), Gaps = 14/187 (7%)

Query: 332 QCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGD----WSGK 387
           QC+   C  P  I  G +   G   GS  TYSC  G+ L G ++  C LG      W+ +
Sbjct: 80  QCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYQLIGESKSYCELGSTGSMVWNPE 139

Query: 388 APTCKYVDCGSPANIDNGHYSLLNGTTTHGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWS 447
           AP C+ V C SP +I NG ++      T GSV  Y+C+  Y L   +    V    G+WS
Sbjct: 140 APICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNS---GVLCSGGEWS 196

Query: 448 GDTPSCELITCPEPEVPKG----GYVVGYDLNVHSTLEFHCEPGHLLVGQASLKCTRQGD 503
            D P+C+++ CP P +  G    G+   Y  N    ++F C+ G+ L G +S  C+    
Sbjct: 197 -DPPTCQIVKCPHPTISNGYLSSGFKRSYSYN--DNVDFKCKYGYKLSGSSSSTCSPGNT 253

Query: 504 WDNMSPQ 510
           W    P+
Sbjct: 254 WQPELPK 260

Length = 263
>gnl|CDD|153060 cd03590, CLECT_DC-SIGN_like, C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) Back     alignment and domain information
>gnl|CDD|153057 cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214480 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|215684 pfam00059, Lectin_C, Lectin C-type domain Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|153059 cd03589, CLECT_CEL-1_like, C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|153061 cd03591, CLECT_collectin_like, C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) Back     alignment and domain information
>gnl|CDD|153062 cd03592, CLECT_selectins_like, C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels) Back     alignment and domain information
>gnl|CDD|153068 cd03598, CLECT_EMBP_like, C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153073 cd03603, CLECT_VCBS, A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>gnl|CDD|165176 PHA02831, PHA02831, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165176 PHA02831, PHA02831, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165263 PHA02954, PHA02954, EEV membrane glycoprotein; Provisional Back     alignment and domain information
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153064 cd03594, CLECT_REG-1_like, C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153063 cd03593, CLECT_NK_receptors_like, C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153071 cd03601, CLECT_TC14_like, C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm Back     alignment and domain information
>gnl|CDD|153065 cd03595, CLECT_chondrolectin_like, C-type lectin-like domain (CTLD) of the type found in the human type-1A transmembrane proteins chondrolectin (CHODL) and layilin Back     alignment and domain information
>gnl|CDD|188093 TIGR00864, PCC, polycystin cation channel protein Back     alignment and domain information
>gnl|CDD|153058 cd03588, CLECT_CSPGs, C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 618
PHA02927263 secreted complement-binding protein; Provisional 100.0
PHA02927263 secreted complement-binding protein; Provisional 100.0
PHA02954317 EEV membrane glycoprotein; Provisional 100.0
PHA02639295 EEV host range protein; Provisional 100.0
PHA02954317 EEV membrane glycoprotein; Provisional 100.0
PHA02639295 EEV host range protein; Provisional 99.97
PHA02831268 EEV host range protein; Provisional 99.97
PHA02831268 EEV host range protein; Provisional 99.95
cd03597129 CLECT_attractin_like C-type lectin-like domain (CT 99.93
cd03588124 CLECT_CSPGs C-type lectin-like domain (CTLD) of th 99.93
cd03589137 CLECT_CEL-1_like C-type lectin-like domain (CTLD) 99.93
cd03599153 CLECT_DGCR2_like C-type lectin-like domain (CTLD) 99.92
cd03590126 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD 99.91
cd03594129 CLECT_REG-1_like C-type lectin-like domain (CTLD) 99.9
cd03596129 CLECT_tetranectin_like C-type lectin-like domain ( 99.9
PHA02817225 EEV Host range protein; Provisional 99.89
cd03593116 CLECT_NK_receptors_like C-type lectin-like domain 99.88
cd03598117 CLECT_EMBP_like C-type lectin-like domain (CTLD) o 99.88
cd03591114 CLECT_collectin_like C-type lectin-like domain (CT 99.88
cd03603118 CLECT_VCBS A bacterial subgroup of the C-type lect 99.87
cd03601119 CLECT_TC14_like C-type lectin-like domain (CTLD) o 99.86
cd03592115 CLECT_selectins_like C-type lectin-like domain (CT 99.86
PHA02817225 EEV Host range protein; Provisional 99.86
PHA02642216 C-type lectin-like protein; Provisional 99.85
cd03600141 CLECT_thrombomodulin_like C-type lectin-like domai 99.85
smart00034126 CLECT C-type lectin (CTL) or carbohydrate-recognit 99.84
cd03595149 CLECT_chondrolectin_like C-type lectin-like domain 99.84
PHA02953170 IEV and EEV membrane glycoprotein; Provisional 99.83
cd03602108 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CT 99.82
PHA03097157 C-type lectin-like protein; Provisional 99.8
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 99.8
PHA02867167 C-type lectin protein; Provisional 99.76
cd00037116 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD 99.62
PF00059105 Lectin_C: Lectin C-type domain; InterPro: IPR00130 99.58
PHA02911213 C-type lectin-like protein; Provisional 99.3
cd0003357 CCP Complement control protein (CCP) modules (aka 98.98
PF0008456 Sushi: Sushi domain (SCR repeat); InterPro: IPR000 98.94
smart0003257 CCP Domain abundant in complement control proteins 98.93
cd0003357 CCP Complement control protein (CCP) modules (aka 98.9
smart0003257 CCP Domain abundant in complement control proteins 98.9
PF0008456 Sushi: Sushi domain (SCR repeat); InterPro: IPR000 98.88
PF05473200 Herpes_UL45: UL45 protein; InterPro: IPR008646 Thi 98.24
PHA02672166 ORF110 EEV glycoprotein; Provisional 96.42
KOG4646|consensus173 95.54
PHA03093185 EEV glycoprotein; Provisional 95.52
PHA02673161 ORF109 EEV glycoprotein; Provisional 95.39
PF05966190 Chordopox_A33R: Chordopoxvirus A33R protein; Inter 94.08
PF12191129 stn_TNFRSF12A: Tumour necrosis factor receptor stn 91.97
cd0351991 Link_domain_HAPLN_module_2 Link_domain_HAPLN_modul 90.37
cd0352096 Link_domain_CSPGs_modules_2_4 Link_domain_CSPGs_mo 88.19
KOG4564|consensus 473 86.87
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 85.63
cd0110292 Link_Domain The link domain is a hyaluronan (HA)-b 84.91
smart0044594 LINK Link (Hyaluronan-binding). 84.62
cd0351895 Link_domain_HAPLN_module_1 Link_domain_HAPLN_modul 81.93
cd0351593 Link_domain_TSG_6_like This is the extracellular l 81.66
PF14704152 DERM: Dermatopontin 81.6
PF0019392 Xlink: Extracellular link domain; InterPro: IPR000 80.91
PF0720498 Orthoreo_P10: Orthoreovirus membrane fusion protei 80.23
>PHA02927 secreted complement-binding protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.7e-41  Score=338.80  Aligned_cols=234  Identities=29%  Similarity=0.637  Sum_probs=210.8

Q ss_pred             ceeeecCCCCCccCCeeEEec-----CCCcccCCEEEEEeCCCceec--CCCeEEeCCCCCcCCCCCcccccccCCCCCc
Q psy1807         272 TCQYVDCGKLEHIEHGTVTLE-----TTRTTHGAVAIYACHENYTLI--GETRRVCGDGGKWNGTEPQCLFDWCAEPPQI  344 (618)
Q Consensus       272 ~C~~~~C~~~~~~~ng~~~~~-----~~~~~~g~~~~~~C~~Gy~l~--G~~~~~C~~~G~Ws~~~p~C~~~~C~~p~~~  344 (618)
                      .|.++.|+.|..+.||.+..+     ...|.+|++++|+|++||.+.  |...++|+.+| |+. .|.|+.+.|+.|+.+
T Consensus        15 ~c~~~~c~~~~~~~~~~~~~~~~~~~~~~y~~g~~v~y~C~~Gy~~~~~g~~~~~C~~~g-Ws~-~p~C~~~~C~~p~~i   92 (263)
T PHA02927         15 GCVLSCCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTG-WTL-FNQCIKRRCPSPRDI   92 (263)
T ss_pred             HHHhccCCCCCcccceeeccccccccCceeCCCCEEEEEeCCCceecCCCccEEEecCCC-CCC-CCcEEeCCCcCCCCC
Confidence            477889999999999998732     346889999999999999975  77889999888 995 799999999999999


Q ss_pred             cccEEEecccccCceeeecCCCCcEEcCCceEEEccCC----eecCCCCceeeecCCCCCccCCCceEeecCcccccceE
Q psy1807         345 SGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGG----DWSGKAPTCKYVDCGSPANIDNGHYSLLNGTTTHGSVA  420 (618)
Q Consensus       345 ~~g~~~~~~~~~g~~~~~~C~~Gy~l~G~~~~~C~~~G----~Ws~~~p~C~~~~C~~p~~~~~g~~~~~~~~~~~g~~~  420 (618)
                      .||.+....+.+|++|+|+|++||.|.|...++|+.+|    +|++..|.|+.+.|+.|+.+.||.+......|.+|++|
T Consensus        93 ~NG~~~~~~~~~G~~v~y~C~~Gy~l~G~~~~~C~~~~~g~~~Ws~~~P~C~~~~C~~P~~~~nG~~~~~~~~y~~g~~v  172 (263)
T PHA02927         93 DNGQLDIGGVDFGSSITYSCNSGYQLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVV  172 (263)
T ss_pred             CCCEEeCCCccCCCEEEEECCCCCEEcCCCeeEEEeCCCCcceECCCCCccccccCCCCCCCCCcEEcCCcccccCCCEE
Confidence            99999888889999999999999999999999999753    89999999999999999999999987655568899999


Q ss_pred             EEEcCCCceeccCCcceEEeccCCeeeCCCCceeeecCCCCCcCCCcEEEc---ccCCCCcEEEEEcCCCCeeeCCceeE
Q psy1807         421 EYTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPEPEVPKGGYVVG---YDLNVHSTLEFHCEPGHLLVGQASLK  497 (618)
Q Consensus       421 ~~~C~~Gy~l~~~G~~~~~C~~~G~Ws~~~p~C~~~~C~~p~~~~~g~~~~---~~~~~g~~v~~~C~~Gy~l~G~~~~~  497 (618)
                      +|+|++||.|.  |...++|. +|+|+. +|.|+.+.|+.|.++ ||.+..   ..|.+|++|+|+|++||+|.|++.++
T Consensus       173 ~y~C~~Gy~l~--G~~~~~C~-~G~Ws~-~P~C~~v~C~~P~i~-ng~~~~~~k~~y~~g~~v~y~C~~Gy~l~G~~~~~  247 (263)
T PHA02927        173 TYSCNSGYSLI--GNSGVLCS-GGEWSD-PPTCQIVKCPHPTIS-NGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSST  247 (263)
T ss_pred             EEECCCCCEEC--CCCeeEEC-CCccCC-CCeEeEeECcCCCCC-CCEEecCCCCccccCCEEEEECCCCCeEcCCCCeE
Confidence            99999999999  99999997 899997 799999999998765 565543   36899999999999999999999999


Q ss_pred             eCcCCcccCCCCceE
Q psy1807         498 CTRQGDWDNMSPQFI  512 (618)
Q Consensus       498 C~~~G~Ws~~~P~C~  512 (618)
                      |+++|+|++++|+|+
T Consensus       248 C~~~g~Ws~~~P~C~  262 (263)
T PHA02927        248 CSPGNTWQPELPKCV  262 (263)
T ss_pred             ECCCCEECCCCCeec
Confidence            999999999999996

>PHA02927 secreted complement-binding protein; Provisional Back     alignment and domain information
>PHA02954 EEV membrane glycoprotein; Provisional Back     alignment and domain information
>PHA02639 EEV host range protein; Provisional Back     alignment and domain information
>PHA02954 EEV membrane glycoprotein; Provisional Back     alignment and domain information
>PHA02639 EEV host range protein; Provisional Back     alignment and domain information
>PHA02831 EEV host range protein; Provisional Back     alignment and domain information
>PHA02831 EEV host range protein; Provisional Back     alignment and domain information
>cd03597 CLECT_attractin_like C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP) Back     alignment and domain information
>cd03588 CLECT_CSPGs C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins Back     alignment and domain information
>cd03589 CLECT_CEL-1_like C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina Back     alignment and domain information
>cd03599 CLECT_DGCR2_like C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS) Back     alignment and domain information
>cd03590 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) Back     alignment and domain information
>cd03594 CLECT_REG-1_like C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) Back     alignment and domain information
>cd03596 CLECT_tetranectin_like C-type lectin-like domain (CTLD) of the type found in the tetranectin (TN), cartilage derived C-type lectin (CLECSF1), and stem cell growth factor (SCGF) Back     alignment and domain information
>PHA02817 EEV Host range protein; Provisional Back     alignment and domain information
>cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) Back     alignment and domain information
>cd03598 CLECT_EMBP_like C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) Back     alignment and domain information
>cd03591 CLECT_collectin_like C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) Back     alignment and domain information
>cd03603 CLECT_VCBS A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>cd03601 CLECT_TC14_like C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm Back     alignment and domain information
>cd03592 CLECT_selectins_like C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels) Back     alignment and domain information
>PHA02817 EEV Host range protein; Provisional Back     alignment and domain information
>PHA02642 C-type lectin-like protein; Provisional Back     alignment and domain information
>cd03600 CLECT_thrombomodulin_like C-type lectin-like domain (CTLD) of the type found in human thrombomodulin(TM), Endosialin, C14orf27, and C1qR Back     alignment and domain information
>smart00034 CLECT C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>cd03595 CLECT_chondrolectin_like C-type lectin-like domain (CTLD) of the type found in the human type-1A transmembrane proteins chondrolectin (CHODL) and layilin Back     alignment and domain information
>PHA02953 IEV and EEV membrane glycoprotein; Provisional Back     alignment and domain information
>cd03602 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>PHA03097 C-type lectin-like protein; Provisional Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PHA02867 C-type lectin protein; Provisional Back     alignment and domain information
>cd00037 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
>PF00059 Lectin_C: Lectin C-type domain; InterPro: IPR001304 Lectins occur in plants, animals, bacteria and viruses Back     alignment and domain information
>PHA02911 C-type lectin-like protein; Provisional Back     alignment and domain information
>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins Back     alignment and domain information
>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins Back     alignment and domain information
>PF05473 Herpes_UL45: UL45 protein; InterPro: IPR008646 This family consists several UL45 proteins and homologues found in the herpes simplex virus family Back     alignment and domain information
>PHA02672 ORF110 EEV glycoprotein; Provisional Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>PHA03093 EEV glycoprotein; Provisional Back     alignment and domain information
>PHA02673 ORF109 EEV glycoprotein; Provisional Back     alignment and domain information
>PF05966 Chordopox_A33R: Chordopoxvirus A33R protein; InterPro: IPR009238 This family consists of several Chordopoxvirus A33R proteins Back     alignment and domain information
>PF12191 stn_TNFRSF12A: Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain; InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins Back     alignment and domain information
>cd03519 Link_domain_HAPLN_module_2 Link_domain_HAPLN_module_2; this link domain is found in the second link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein Back     alignment and domain information
>cd03520 Link_domain_CSPGs_modules_2_4 Link_domain_CSPGs_modules_2_4; this link domain is found in the second and fourth link modules of the chondroitin sulfate proteoglycan core protein (CSPG) aggrecan and, in the second link module of three other CSPGs: versican, neurocan, and brevican Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>cd01102 Link_Domain The link domain is a hyaluronan (HA)-binding domain Back     alignment and domain information
>smart00445 LINK Link (Hyaluronan-binding) Back     alignment and domain information
>cd03518 Link_domain_HAPLN_module_1 Link_domain_HAPLN_module_1; this link domain is found in the first link module of proteins similar to the vertebrate HAPLN (hyaluronan/HA and proteoglycan binding link) protein family which includes cartilage link protein Back     alignment and domain information
>cd03515 Link_domain_TSG_6_like This is the extracellular link domain of the type found in human TSG-6 Back     alignment and domain information
>PF14704 DERM: Dermatopontin Back     alignment and domain information
>PF00193 Xlink: Extracellular link domain; InterPro: IPR000538 The link domain [] is a hyaluronan(HA)-binding region found in proteins of vertebrates that are involved in the assembly of extracellular matrix, cell adhesion, and migration Back     alignment and domain information
>PF07204 Orthoreo_P10: Orthoreovirus membrane fusion protein p10; InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query618
2q7z_A 1931 Solution Structure Of The 30 Scr Domains Of Human C 3e-27
2q7z_A 1931 Solution Structure Of The 30 Scr Domains Of Human C 5e-17
2gsx_A 951 Complement Receptor Type 2 Length = 951 1e-24
1ntl_A551 Model Of Mouse Crry-Ig Determined By Solution Scatt 2e-20
1ntl_A 551 Model Of Mouse Crry-Ig Determined By Solution Scatt 2e-15
3gau_A1213 Solution Structure Of Human Complement Factor H In 1e-19
3gau_A 1213 Solution Structure Of Human Complement Factor H In 1e-12
1haq_A1213 Four Models Of Human Factor H Determined By Solutio 1e-19
1haq_A 1213 Four Models Of Human Factor H Determined By Solutio 1e-12
1g40_A244 Crystal Structure Of A Complement Protein That Regu 7e-17
1ntj_A320 Model Of Rat Crry Determined By Solution Scattering 1e-16
1ntj_A320 Model Of Rat Crry Determined By Solution Scattering 5e-14
1ntj_A320 Model Of Rat Crry Determined By Solution Scattering 7e-14
2qfg_A312 Solution Structure Of The N-Terminal Scr-15 FRAGMEN 2e-15
2qfg_A312 Solution Structure Of The N-Terminal Scr-15 FRAGMEN 4e-13
2xrb_A290 Structure Of The N-Terminal Four Domains Of The Com 7e-14
2c8i_E316 Complex Of Echovirus Type 12 With Domains 1, 2, 3 A 2e-13
2c8i_E316 Complex Of Echovirus Type 12 With Domains 1, 2, 3 A 3e-13
3erb_A223 The Crystal Structure Of C2b, A Fragment Of Complem 3e-13
2wii_C277 Complement C3b In Complex With Factor H Domains 1-4 5e-13
3o8e_B252 Structure Of Extracelllar Portion Of Cd46 In Comple 1e-12
3o8e_B252 Structure Of Extracelllar Portion Of Cd46 In Comple 8e-11
1ojv_A254 Decay Accelerating Factor (Cd55): The Structure Of 1e-12
1ojv_A254 Decay Accelerating Factor (Cd55): The Structure Of 5e-09
3iyp_F381 The Interaction Of Decay-Accelerating Factor With E 1e-12
3iyp_F381 The Interaction Of Decay-Accelerating Factor With E 4e-09
1m11_R243 Structural Model Of Human Decay-accelerating Factor 3e-12
1m11_R243 Structural Model Of Human Decay-accelerating Factor 3e-09
1ok3_A254 Decay Accelerating Factor (cd55): The Structure Of 5e-12
1ok3_A254 Decay Accelerating Factor (cd55): The Structure Of 6e-09
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 2e-11
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 1e-10
2ok5_A 752 Human Complement Factor B Length = 752 2e-11
2ok5_A 752 Human Complement Factor B Length = 752 1e-10
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 2e-11
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 1e-10
1e5g_A120 Solution Structure Of Central Cp Module Pair Of A P 1e-10
1e5g_A120 Solution Structure Of Central Cp Module Pair Of A P 5e-04
2qfh_A333 Solution Structure Of The C-Terminal Scr-1620 FRAGM 1e-10
1c1z_A326 Crystal Structure Of Human Beta-2-Glycoprotein-I (A 3e-10
1c1z_A 326 Crystal Structure Of Human Beta-2-Glycoprotein-I (A 6e-06
1qub_A319 Crystal Structure Of The Glycosylated Five-domain H 5e-10
1qub_A319 Crystal Structure Of The Glycosylated Five-domain H 8e-06
1upn_E129 Complex Of Echovirus Type 12 With Domains 3 And 4 O 2e-09
1upn_E129 Complex Of Echovirus Type 12 With Domains 3 And 4 O 2e-06
1upn_E129 Complex Of Echovirus Type 12 With Domains 3 And 4 O 2e-05
1h2p_P125 Human Cd55 Domains 3 & 4 Length = 125 5e-09
1h2p_P125 Human Cd55 Domains 3 & 4 Length = 125 6e-07
1h2p_P125 Human Cd55 Domains 3 & 4 Length = 125 2e-04
1h03_P125 Human Cd55 Domains 3 & 4 Length = 125 5e-09
1h03_P125 Human Cd55 Domains 3 & 4 Length = 125 2e-06
1h03_P125 Human Cd55 Domains 3 & 4 Length = 125 2e-04
1h04_P125 Human Cd55 Domains 3 & 4 Length = 125 8e-09
1h04_P125 Human Cd55 Domains 3 & 4 Length = 125 7e-05
1h04_P125 Human Cd55 Domains 3 & 4 Length = 125 3e-04
1gkg_A136 Structure Determination And Rational Mutagenesis Re 2e-08
2rlq_A129 Nmr Structure Of Ccp Modules 2-3 Of Complement Fact 8e-08
1hfh_A120 Solution Structure Of A Pair Of Complement Modules 1e-07
3sw0_X188 Structure Of The C-terminal Region (modules 18-20) 2e-07
3gov_A155 Crystal Structure Of The Catalytic Region Of Human 8e-07
4igd_A 406 Crystal Structure Of The Zymogen Catalytic Region O 1e-06
1vvc_A118 C-Terminal Half Of Vaccinia Virus Complement Contro 1e-06
1ghq_B134 Cr2-C3d Complex Structure Length = 134 2e-06
3oed_C135 The Structure Of The Complex Between Complement Rec 2e-06
2a55_A133 Solution Structure Of The Two N-Terminal Ccp Module 3e-06
2a55_A133 Solution Structure Of The Two N-Terminal Ccp Module 3e-04
4fxg_G154 Complement C4 In Complex With Masp-2 Length = 154 3e-06
2vuv_A129 Crystal Structure Of Codakine At 1.3a Resolution Le 3e-06
2ls8_A156 Solution Structure Of Human C-Type Lectin Domain Fa 3e-06
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 3e-06
2aty_A 376 Complement Receptor Chimaeric Conjugate Cr2-Ig Leng 4e-06
2rlp_A129 Nmr Structure Of Ccp Modules 1-2 Of Complement Fact 4e-06
1w2r_A142 Solution Structure Of Cr2 Scr 1-2 By X-Ray Scatteri 4e-06
1ly2_A130 Crystal Structure Of Unliganded Human Cd21 Scr1-Scr 5e-06
1egg_A147 Structure Of A C-Type Carbohydrate-Recognition Doma 5e-06
2xr5_A166 Crystal Structure Of The Complex Of The Carbohydrat 6e-06
1k9i_A156 Complex Of Dc-Sign And Glcnac2man3 Length = 156 6e-06
2b6b_D175 Cryo Em Structure Of Dengue Complexed With Crd Of D 7e-06
1sl4_A155 Crystal Structure Of Dc-Sign Carbohydrate Recogniti 7e-06
1sl5_A139 Crystal Structure Of Dc-Sign Carbohydrate Recogniti 1e-05
1nwv_A129 Solution Structure Of A Functionally Active Compone 4e-05
2qy0_A159 Active Dimeric Structure Of The Catalytic Domain Of 5e-05
4b2r_A126 Solution Structure Of Ccp Modules 10-11 Of Compleme 5e-05
2xr6_A170 Crystal Structure Of The Complex Of The Carbohydrat 6e-05
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 8e-05
1qdd_A144 Crystal Structure Of Human Lithostathine To 1.3 A R 1e-04
4b2s_A127 Solution Structure Of Ccp Modules 11-12 Of Compleme 1e-04
1lit_A144 Human Lithostathine Length = 144 2e-04
1gkn_A128 Structure Determination And Rational Mutagenesis Re 4e-04
2qzd_A65 Fitted Structure Of Scr4 Of Daf Into Cryoem Density 5e-04
1sl6_A184 Crystal Structure Of A Fragment Of Dc-signr (contai 5e-04
>pdb|2Q7Z|A Chain A, Solution Structure Of The 30 Scr Domains Of Human Complement Receptor 1 Length = 1931 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 144/346 (41%), Gaps = 34/346 (9%)
Query: 206  LDYLHW-----ICQHNPANCGSPDRHLNTTFVGTVNTKLGSTISYACPEGNMLVGSATRT 260
            LD L W     +C+    +C +P   +N       + ++GS I+Y+C  G+ L+G ++  
Sbjct: 946  LDNLVWSSPKDVCKRK--SCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAE 1003
Query: 261  C----KEGFWTGVAPTCQYVDCGKLEHIEHGTVTLETTRTTH-GAVAIYACH------EN 309
            C        W+   P CQ + CG    I +G          H G+V  Y C+      + 
Sbjct: 1004 CILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKV 1063
Query: 310  YTLIGETRRVCGDG----GKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGS---VATY 362
            + L+GE    C       G W+G  PQC+      PP +  GI+ +  R   S   V  +
Sbjct: 1064 FELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEF 1123
Query: 363  SCEPGFILFGSNELKCGLGGDWSGKAPTCKYVDCGSPANIDNG-HYSLLNGTTTHGSVAE 421
             C+PGF++ G   +KC     W  + P+C  V C  P  I +G H        + G    
Sbjct: 1124 RCQPGFVMKGPRRVKCQALNKWEPELPSCSRV-CQPPPEILHGEHTPSHQDNFSPGQEVF 1182
Query: 422  YTCDDDYWLEAGAMRRQVCMRDGKWSGDTPSCELITCPE--PEVPKGGYVVGYDLNVHST 479
            Y+C+  Y L   A     C   G WS + P C + +C +   ++P G  +   +L + + 
Sbjct: 1183 YSCEPGYDLRGAASLH--CTPQGDWSPEAPRCAVKSCDDFLGQLPHGRVLFPLNLQLGAK 1240
Query: 480  LEFHCEPGHLLVGQASLKCTRQGD---WDNMSPQFISFYFPPSETI 522
            + F C+ G  L G +   C   G    W+N  P     + P    I
Sbjct: 1241 VSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIFCPNPPAI 1286
>pdb|2Q7Z|A Chain A, Solution Structure Of The 30 Scr Domains Of Human Complement Receptor 1 Length = 1931 Back     alignment and structure
>pdb|2GSX|A Chain A, Complement Receptor Type 2 Length = 951 Back     alignment and structure
>pdb|1NTL|A Chain A, Model Of Mouse Crry-Ig Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 551 Back     alignment and structure
>pdb|1NTL|A Chain A, Model Of Mouse Crry-Ig Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 551 Back     alignment and structure
>pdb|3GAU|A Chain A, Solution Structure Of Human Complement Factor H In 50 Mm Nacl Buffer Length = 1213 Back     alignment and structure
>pdb|3GAU|A Chain A, Solution Structure Of Human Complement Factor H In 50 Mm Nacl Buffer Length = 1213 Back     alignment and structure
>pdb|1HAQ|A Chain A, Four Models Of Human Factor H Determined By Solution Scattering Curve-Fitting And Homology Modelling Length = 1213 Back     alignment and structure
>pdb|1HAQ|A Chain A, Four Models Of Human Factor H Determined By Solution Scattering Curve-Fitting And Homology Modelling Length = 1213 Back     alignment and structure
>pdb|1G40|A Chain A, Crystal Structure Of A Complement Protein That Regulates Both Pathways Of Complement Activation And Binds Heparan Sulfate Proteoglycans Length = 244 Back     alignment and structure
>pdb|1NTJ|A Chain A, Model Of Rat Crry Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 320 Back     alignment and structure
>pdb|1NTJ|A Chain A, Model Of Rat Crry Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 320 Back     alignment and structure
>pdb|1NTJ|A Chain A, Model Of Rat Crry Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 320 Back     alignment and structure
>pdb|2QFG|A Chain A, Solution Structure Of The N-Terminal Scr-15 FRAGMENT OF Complement Factor H Length = 312 Back     alignment and structure
>pdb|2QFG|A Chain A, Solution Structure Of The N-Terminal Scr-15 FRAGMENT OF Complement Factor H Length = 312 Back     alignment and structure
>pdb|2XRB|A Chain A, Structure Of The N-Terminal Four Domains Of The Complement Regulator Rat Crry Length = 290 Back     alignment and structure
>pdb|3ERB|A Chain A, The Crystal Structure Of C2b, A Fragment Of Complement Component C2 Produced During C3-Convertase Formation Length = 223 Back     alignment and structure
>pdb|2WII|C Chain C, Complement C3b In Complex With Factor H Domains 1-4 Length = 277 Back     alignment and structure
>pdb|3O8E|B Chain B, Structure Of Extracelllar Portion Of Cd46 In Complex With Adenovirus Type 11 Knob Length = 252 Back     alignment and structure
>pdb|3O8E|B Chain B, Structure Of Extracelllar Portion Of Cd46 In Complex With Adenovirus Type 11 Knob Length = 252 Back     alignment and structure
>pdb|1OJV|A Chain A, Decay Accelerating Factor (Cd55): The Structure Of An Intact Human Complement Regulator. Length = 254 Back     alignment and structure
>pdb|1OJV|A Chain A, Decay Accelerating Factor (Cd55): The Structure Of An Intact Human Complement Regulator. Length = 254 Back     alignment and structure
>pdb|3IYP|F Chain F, The Interaction Of Decay-Accelerating Factor With Echovirus 7 Length = 381 Back     alignment and structure
>pdb|3IYP|F Chain F, The Interaction Of Decay-Accelerating Factor With Echovirus 7 Length = 381 Back     alignment and structure
>pdb|1M11|R Chain R, Structural Model Of Human Decay-accelerating Factor Bound To Echovirus 7 From Cryo-electron Microscopy Length = 243 Back     alignment and structure
>pdb|1M11|R Chain R, Structural Model Of Human Decay-accelerating Factor Bound To Echovirus 7 From Cryo-electron Microscopy Length = 243 Back     alignment and structure
>pdb|1OK3|A Chain A, Decay Accelerating Factor (cd55): The Structure Of An Intact Human Complement Regulator. Length = 254 Back     alignment and structure
>pdb|1OK3|A Chain A, Decay Accelerating Factor (cd55): The Structure Of An Intact Human Complement Regulator. Length = 254 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|1E5G|A Chain A, Solution Structure Of Central Cp Module Pair Of A Pox Virus Complement Inhibitor Length = 120 Back     alignment and structure
>pdb|1E5G|A Chain A, Solution Structure Of Central Cp Module Pair Of A Pox Virus Complement Inhibitor Length = 120 Back     alignment and structure
>pdb|2QFH|A Chain A, Solution Structure Of The C-Terminal Scr-1620 FRAGMENT OF Complement Factor H Length = 333 Back     alignment and structure
>pdb|1C1Z|A Chain A, Crystal Structure Of Human Beta-2-Glycoprotein-I (Apolipoprotein-H) Length = 326 Back     alignment and structure
>pdb|1C1Z|A Chain A, Crystal Structure Of Human Beta-2-Glycoprotein-I (Apolipoprotein-H) Length = 326 Back     alignment and structure
>pdb|1QUB|A Chain A, Crystal Structure Of The Glycosylated Five-domain Human Beta2- Glycoprotein I Purified From Blood Plasma Length = 319 Back     alignment and structure
>pdb|1QUB|A Chain A, Crystal Structure Of The Glycosylated Five-domain Human Beta2- Glycoprotein I Purified From Blood Plasma Length = 319 Back     alignment and structure
>pdb|1UPN|E Chain E, Complex Of Echovirus Type 12 With Domains 3 And 4 Of Its Receptor Decay Accelerating Factor (Cd55) By Cryo Electron Microscopy At 16 A Length = 129 Back     alignment and structure
>pdb|1UPN|E Chain E, Complex Of Echovirus Type 12 With Domains 3 And 4 Of Its Receptor Decay Accelerating Factor (Cd55) By Cryo Electron Microscopy At 16 A Length = 129 Back     alignment and structure
>pdb|1UPN|E Chain E, Complex Of Echovirus Type 12 With Domains 3 And 4 Of Its Receptor Decay Accelerating Factor (Cd55) By Cryo Electron Microscopy At 16 A Length = 129 Back     alignment and structure
>pdb|1H2P|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H2P|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H2P|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H03|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H03|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H03|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H04|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H04|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H04|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1GKG|A Chain A, Structure Determination And Rational Mutagenesis Reveal Binding Surface Of Immune Adherence Receptor, Cr1 (Cd35) Length = 136 Back     alignment and structure
>pdb|2RLQ|A Chain A, Nmr Structure Of Ccp Modules 2-3 Of Complement Factor H Length = 129 Back     alignment and structure
>pdb|1HFH|A Chain A, Solution Structure Of A Pair Of Complement Modules By Nuclear Magnetic Resonance Length = 120 Back     alignment and structure
>pdb|3SW0|X Chain X, Structure Of The C-terminal Region (modules 18-20) Of Complement Regulator Factor H Length = 188 Back     alignment and structure
>pdb|3GOV|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 155 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|1VVC|A Chain A, C-Terminal Half Of Vaccinia Virus Complement Control Protein, Nmr, Minimized Average Structure Length = 118 Back     alignment and structure
>pdb|1GHQ|B Chain B, Cr2-C3d Complex Structure Length = 134 Back     alignment and structure
>pdb|3OED|C Chain C, The Structure Of The Complex Between Complement Receptor Cr2 And Its Ligand Complement Fragment C3d Length = 135 Back     alignment and structure
>pdb|2A55|A Chain A, Solution Structure Of The Two N-Terminal Ccp Modules Of C4b- Binding Protein (C4bp) Alpha-Chain Length = 133 Back     alignment and structure
>pdb|2A55|A Chain A, Solution Structure Of The Two N-Terminal Ccp Modules Of C4b- Binding Protein (C4bp) Alpha-Chain Length = 133 Back     alignment and structure
>pdb|4FXG|G Chain G, Complement C4 In Complex With Masp-2 Length = 154 Back     alignment and structure
>pdb|2VUV|A Chain A, Crystal Structure Of Codakine At 1.3a Resolution Length = 129 Back     alignment and structure
>pdb|2LS8|A Chain A, Solution Structure Of Human C-Type Lectin Domain Family 4 Member D Length = 156 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|2ATY|A Chain A, Complement Receptor Chimaeric Conjugate Cr2-Ig Length = 376 Back     alignment and structure
>pdb|2RLP|A Chain A, Nmr Structure Of Ccp Modules 1-2 Of Complement Factor H Length = 129 Back     alignment and structure
>pdb|1W2R|A Chain A, Solution Structure Of Cr2 Scr 1-2 By X-Ray Scattering Length = 142 Back     alignment and structure
>pdb|1LY2|A Chain A, Crystal Structure Of Unliganded Human Cd21 Scr1-Scr2 (Complement Receptor Type 2) Length = 130 Back     alignment and structure
>pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydrate-Recognition Domain (Crd- 4) From The Macrophage Mannose Receptor Length = 147 Back     alignment and structure
>pdb|2XR5|A Chain A, Crystal Structure Of The Complex Of The Carbohydrate Recognition Domain Of Human Dc-Sign With Pseudo Dimannoside Mimic Length = 166 Back     alignment and structure
>pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2man3 Length = 156 Back     alignment and structure
>pdb|2B6B|D Chain D, Cryo Em Structure Of Dengue Complexed With Crd Of Dc-Sign Length = 175 Back     alignment and structure
>pdb|1SL4|A Chain A, Crystal Structure Of Dc-Sign Carbohydrate Recognition Domain Complexed With Man4 Length = 155 Back     alignment and structure
>pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Carbohydrate Recognition Domain Complexed With Lnfp Iii (Dextra L504). Length = 139 Back     alignment and structure
>pdb|1NWV|A Chain A, Solution Structure Of A Functionally Active Component Of Decay Accelerating Factor Length = 129 Back     alignment and structure
>pdb|2QY0|A Chain A, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 159 Back     alignment and structure
>pdb|4B2R|A Chain A, Solution Structure Of Ccp Modules 10-11 Of Complement Factor H Length = 126 Back     alignment and structure
>pdb|2XR6|A Chain A, Crystal Structure Of The Complex Of The Carbohydrate Recognition Domain Of Human Dc-Sign With Pseudo Trimannoside Mimic Length = 170 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|1QDD|A Chain A, Crystal Structure Of Human Lithostathine To 1.3 A Resolution Length = 144 Back     alignment and structure
>pdb|4B2S|A Chain A, Solution Structure Of Ccp Modules 11-12 Of Complement Factor H Length = 127 Back     alignment and structure
>pdb|1LIT|A Chain A, Human Lithostathine Length = 144 Back     alignment and structure
>pdb|1GKN|A Chain A, Structure Determination And Rational Mutagenesis Reveal Binding Surface Of Immune Adherence Receptor, Cr1 (Cd35) Length = 128 Back     alignment and structure
>pdb|2QZD|A Chain A, Fitted Structure Of Scr4 Of Daf Into Cryoem Density Length = 65 Back     alignment and structure
>pdb|1SL6|A Chain A, Crystal Structure Of A Fragment Of Dc-signr (containg The Carbohydrate Recognition Domain And Two Repeats Of The Neck) Complexed With Lewis-x. Length = 184 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query618
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 3e-68
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 3e-55
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 3e-41
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 5e-28
1qub_A 319 Protein (human BETA2-glycoprotein I); short consen 2e-04
1ntj_A320 Complement receptor related protein; immunology, g 3e-67
1ntj_A320 Complement receptor related protein; immunology, g 9e-52
1ntj_A320 Complement receptor related protein; immunology, g 5e-51
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 5e-67
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 2e-53
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 8e-40
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 2e-36
2c8i_E316 CD55, complement decay-accelerating factor; picorn 3e-65
2c8i_E316 CD55, complement decay-accelerating factor; picorn 4e-52
2c8i_E316 CD55, complement decay-accelerating factor; picorn 4e-26
1rid_A244 Complement control protein; regulation, SCR, immun 5e-64
1rid_A244 Complement control protein; regulation, SCR, immun 3e-55
1rid_A244 Complement control protein; regulation, SCR, immun 1e-42
1rid_A244 Complement control protein; regulation, SCR, immun 7e-25
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 6e-61
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 4e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 9e-54
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 1e-53
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 1e-53
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-53
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 3e-53
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 3e-52
2q7z_A1931 Complement receptor type 1; SCR domain, blood grou 9e-52
2q7z_A1931 Complement receptor type 1; SCR domain, blood grou 1e-51
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 3e-51
2q7z_A1931 Complement receptor type 1; SCR domain, blood grou 4e-50
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 4e-45
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 6e-45
2q7z_A1931 Complement receptor type 1; SCR domain, blood grou 8e-44
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 1e-42
2xrb_A290 Complement regulatory protein CRRY; immune system, 1e-60
2xrb_A290 Complement regulatory protein CRRY; immune system, 2e-54
3o8e_B252 Membrane cofactor protein; short consensus repeat, 2e-60
3o8e_B252 Membrane cofactor protein; short consensus repeat, 1e-56
3o8e_B252 Membrane cofactor protein; short consensus repeat, 7e-24
3iyp_F381 Complement decay-accelerating factor; virus, recep 1e-59
3iyp_F381 Complement decay-accelerating factor; virus, recep 2e-55
3iyp_F381 Complement decay-accelerating factor; virus, recep 2e-53
3iyp_F381 Complement decay-accelerating factor; virus, recep 9e-39
2wii_C277 H factor 1, complement factor H; immune system, su 6e-59
2wii_C277 H factor 1, complement factor H; immune system, su 5e-56
2wii_C277 H factor 1, complement factor H; immune system, su 4e-41
2wii_C277 H factor 1, complement factor H; immune system, su 9e-20
2wii_C277 H factor 1, complement factor H; immune system, su 1e-08
2gsx_A951 Complement receptor type 2; SCR domain, CCP domain 7e-59
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 2e-57
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 2e-56
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 5e-56
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 8e-55
2gsx_A951 Complement receptor type 2; SCR domain, CCP domain 6e-54
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 4e-53
2gsx_A951 Complement receptor type 2; SCR domain, CCP domain 3e-49
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 7e-47
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 2e-57
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 2e-54
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 2e-25
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 1e-04
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 3e-54
1haq_A1213 Complement factor H; immunology, glycoprotein, com 3e-52
1haq_A1213 Complement factor H; immunology, glycoprotein, com 8e-50
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 3e-49
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 2e-45
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 1e-43
1haq_A1213 Complement factor H; immunology, glycoprotein, com 6e-42
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 8e-42
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 8e-40
3hrz_D 741 Complement factor B; serine protease, glycosilated 2e-51
3hrz_D 741 Complement factor B; serine protease, glycosilated 4e-46
3hrz_D 741 Complement factor B; serine protease, glycosilated 7e-39
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 3e-50
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 2e-45
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 3e-43
3sw0_X188 H factor 1, complement factor H; innate immune res 3e-39
3sw0_X188 H factor 1, complement factor H; innate immune res 2e-38
3sw0_X188 H factor 1, complement factor H; innate immune res 1e-37
3sw0_X188 H factor 1, complement factor H; innate immune res 9e-21
3sw0_X188 H factor 1, complement factor H; innate immune res 2e-05
3sw0_X188 H factor 1, complement factor H; innate immune res 8e-04
2uwn_A187 H factor 1, human complement factor H; alternative 4e-33
2uwn_A187 H factor 1, human complement factor H; alternative 2e-27
2uwn_A187 H factor 1, human complement factor H; alternative 5e-27
2uwn_A187 H factor 1, human complement factor H; alternative 4e-16
2uwn_A187 H factor 1, human complement factor H; alternative 4e-16
1h03_P125 Complement decay-accelerating factor; immune syste 4e-31
1h03_P125 Complement decay-accelerating factor; immune syste 5e-29
1h03_P125 Complement decay-accelerating factor; immune syste 1e-28
1h03_P125 Complement decay-accelerating factor; immune syste 9e-25
1h03_P125 Complement decay-accelerating factor; immune syste 3e-07
1h03_P125 Complement decay-accelerating factor; immune syste 6e-07
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 1e-30
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 4e-25
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 5e-22
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 4e-28
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 4e-27
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 8e-24
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 9e-22
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 3e-06
1gkn_A128 Complement receptor type 1; module, SCR, structure 3e-27
1gkn_A128 Complement receptor type 1; module, SCR, structure 6e-26
1gkn_A128 Complement receptor type 1; module, SCR, structure 1e-25
1gkn_A128 Complement receptor type 1; module, SCR, structure 7e-25
1gkn_A128 Complement receptor type 1; module, SCR, structure 3e-09
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 4e-27
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 7e-27
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 5e-25
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 1e-22
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 7e-12
1gkg_A136 Complement receptor type 1; module, SCR, structure 6e-27
1gkg_A136 Complement receptor type 1; module, SCR, structure 7e-26
1gkg_A136 Complement receptor type 1; module, SCR, structure 7e-26
1gkg_A136 Complement receptor type 1; module, SCR, structure 1e-22
2h2t_B175 Low affinity immunoglobulin epsilon FC receptor ( 2e-25
2qy0_A159 Complement C1R subcomponent; serine protease, beta 3e-25
2qy0_A159 Complement C1R subcomponent; serine protease, beta 1e-19
2qy0_A159 Complement C1R subcomponent; serine protease, beta 2e-17
2qy0_A159 Complement C1R subcomponent; serine protease, beta 2e-16
2qy0_A159 Complement C1R subcomponent; serine protease, beta 1e-05
3r62_A129 H factor 1, complement factor H; immunity, repeati 3e-24
3r62_A129 H factor 1, complement factor H; immunity, repeati 6e-22
3r62_A129 H factor 1, complement factor H; immunity, repeati 3e-20
3r62_A129 H factor 1, complement factor H; immunity, repeati 8e-19
1egg_A147 Macrophage mannose receptor; C-type lectin, sugar 7e-24
2py2_A136 Antifreeze protein type II; type II antifreeze pro 1e-23
3c22_A156 C-type lectin domain family 4 member K; coiled coi 2e-23
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 2e-23
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 6e-23
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 1e-04
2afp_A129 Protein (SEA raven type II antifreeze protein); re 8e-23
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 1e-22
1byf_A125 TC14, protein (polyandrocarpa lectin); C-type lect 2e-22
2zib_A133 Type II antifreeze protein; thermal hysteresis, le 2e-22
2ls8_A156 C-type lectin domain family 4 member D; structural 6e-22
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 3e-21
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 4e-21
1tdq_B130 Aggrecan core protein; extracellular matrix, lecti 5e-21
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 9e-21
1wmz_A140 Lectin CEL-I, N-acetyl-D-galactosamine-specific C- 9e-21
1tn3_A137 Tetranectin; plasminogen binding, kringle 4, C-typ 1e-20
1rtm_1149 Mannose-binding protein-A; lectin; 1.80A {Rattus n 1e-20
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 1e-20
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 1e-20
1jzn_A135 Galactose-specific lectin; C-type lectin, protein- 1e-20
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 1e-20
1htn_A182 Tetranectin; plasminogen binding, kringle 4, alpha 2e-20
3alu_A157 Lectin CEL-IV, C-type; C-type lectin, raffinose, s 2e-20
1wk1_A150 Hypothetical protein YK1067A12; lectin C-type doma 3e-20
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 4e-20
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 3e-19
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 8e-15
1buu_A168 Protein (mannose-binding protein A); lectin, HOST 4e-20
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 5e-20
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 1e-17
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 5e-17
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 6e-17
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 3e-12
3pbf_A148 Pulmonary surfactant-associated protein A; collect 6e-20
2msb_A115 Mannose-binding protein-A; lectin; HET: BMA MAN; 1 7e-20
1qdd_A144 Lithostathine; pancreatic stone inhibitor, metal b 7e-20
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 1e-19
1rdl_1113 SUB-MBP-C, mannose-binding protein-C; C-type lecti 2e-19
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 3e-19
1uv0_A149 Pancreatitis-associated protein 1; lectin, C-type, 4e-19
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 8e-19
2kv3_A131 Regenerating islet-derived protein 4; GISP, C-type 1e-18
1dv8_A128 Asialoglycoprotein receptor 1; C-type lectin CRD, 2e-18
1h8u_A117 MBP, eosinophil granule major basic protein 1; lec 2e-18
1gz2_A142 Ovocleidin-17, OC-17 ovocleidin; structural protei 5e-18
2e3x_B134 Coagulation factor X-activating enzyme light CHAI; 6e-18
3bx4_A136 Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh 8e-18
1fvu_A133 Botrocetin alpha chain; VON WILLBRAND factor modul 1e-17
3ubu_A131 Agglucetin subunit alpha-1; platelet inhibiting, a 2e-17
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 3e-17
1ukm_A134 EMS16 A chain, EMS16 subunit A; domain swapping, C 3e-17
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 8e-17
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 2e-13
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 2e-08
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 5e-07
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 5e-05
1j34_A129 Coagulation factor IX-binding protein A chain; mag 8e-17
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 2e-16
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 4e-16
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 2e-14
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 7e-10
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 1e-09
1c3a_A135 Flavocetin-A: alpha subunit; C-type lectin-like do 3e-16
3gpr_C134 Rhodocetin subunit gamma; disulfide bond, lectin, 4e-16
3vpp_A132 C-type lectin domain family 9 member A; dendritic 9e-16
1fvu_B125 Botrocetin beta chain; VON WILLBRAND factor modula 1e-15
1umr_A135 Convulxin alpha, CVX alpha; lectin, C-type lectin, 2e-15
1sb2_B129 Rhodocetin beta subunit; C-type lectin, domain swa 2e-15
2yby_A124 Complement factor H; immune system, complement reg 2e-15
2yby_A124 Complement factor H; immune system, complement reg 1e-12
2yby_A124 Complement factor H; immune system, complement reg 3e-12
1jwi_B125 Platelet aggregation inducer; domain swapping, C-t 3e-15
1sb2_A133 Rhodocetin alpha subunit; C-type lectin, domain sw 5e-15
3ubu_B126 Agglucetin subunit beta-2; platelet inhibiting, ag 5e-15
1ypq_A135 Oxidised low density lipoprotein (lectin-like) rec 8e-15
1oz7_B123 Echicetin B-chain; platelet aggregation, dimer, to 8e-15
2bpd_A142 Dectin-1; receptor, beta-glucan, fungal recognitio 1e-14
1j34_B123 Coagulation factor IX-binding protein B chain; mag 1e-14
3bx4_B146 Aggretin beta chain; toxin; 1.70A {Agkistrodon rho 1e-14
2e3x_C122 Coagulation factor X-activating enzyme light CHAI; 2e-14
3c8j_A203 Natural killer cell receptor LY49C; MHC, virus, im 2e-14
3m9z_A139 Killer cell lectin-like receptor subfamily B MEMB; 3e-14
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 3e-14
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 8e-11
3ff7_C112 Killer cell lectin-like receptor subfamily G membe 3e-14
1c3a_B125 Flavocetin-A: beta subunit; C-type lectin-like dom 4e-14
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 5e-14
1umr_C125 Convulxin beta, CVX beta; lectin, C-type lectin, p 6e-14
3ff9_A115 Killer cell lectin-like receptor subfamily G membe 7e-14
2c6u_A122 CLEC1B protein; lectin, rhodocytin, aggretin, C-ty 8e-14
1oz7_A131 Echicetin A-chain; platelet aggregation, dimer, to 2e-13
3g8l_A190 Lectin-related NK cell receptor LY49L1; natural ki 2e-13
2yhf_A118 C-type lectin domain family 5 member A; immune sys 2e-13
3hup_A130 Early activation antigen CD69; C-type lectin-like 2e-13
3g8k_A130 Lectin-related NK cell receptor LY49L1; natural ki 3e-13
3gpr_D124 Rhodocetin subunit delta; disulfide bond, lectin, 4e-13
1ukm_B128 EMS16 B chain, EMS16 subunit B; domain swapping, C 5e-13
1fm5_A199 Early activation antigen CD69; C-type lectin-like 5e-13
1hq8_A123 NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { 2e-12
1mpu_A138 NKG2-D type II integral membrane protein; C-type l 5e-12
3bdw_B120 NKG2-A/NKG2-B type II integral membrane protein; N 6e-12
1gpz_A399 Complement C1R component; hydrolase, activation, i 7e-12
1gpz_A399 Complement C1R component; hydrolase, activation, i 1e-06
1gpz_A399 Complement C1R component; hydrolase, activation, i 4e-05
3rs1_A122 C-type lectin domain family 2 member I; C-type lec 1e-11
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 3e-08
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 4e-06
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 4e-05
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 7e-05
1elv_A 333 Complement C1S component; trypsin-like serin prote 6e-07
1elv_A333 Complement C1S component; trypsin-like serin prote 2e-04
1elv_A333 Complement C1S component; trypsin-like serin prote 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 1e-05
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 4e-05
1md8_A329 C1R complement serine protease; innate immunity, a 2e-04
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
 Score =  224 bits (571), Expect = 3e-68
 Identities = 67/306 (21%), Positives = 105/306 (34%), Gaps = 27/306 (8%)

Query: 220 CGSPDRHLNTTFVGTVNT-KLGSTISYACPEGNMLVGSATR-TCKE-GFWTGVAPTCQYV 276
           C  PD    +T V      + G  I+Y+C  G +  G   +  C   G W      C   
Sbjct: 4   CPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPR 63

Query: 277 DCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFD 336
            C     +E+G V   T    +     ++C+  + L G     C + GKW+   P C   
Sbjct: 64  VCPFAGILENGAVRYTT--FEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPI 121

Query: 337 WCAEPPQISGGIVTTSGRRT------GSVATYSCEPGFILFGSNELKCGLGGDWSGKAPT 390
            C  P   +   +                A + C P   +FG++ + C   G+W+   P 
Sbjct: 122 ICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTK-LPE 180

Query: 391 CKYVDCGSPANIDNGHYSLLNGTT-THGSVAEYTCDDDYWLEAGAMRRQVCMRDGKWSGD 449
           C+ V C  P+  DNG  +     T  +   A + C D Y L+ G      C + G WS  
Sbjct: 181 CREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLD-GPEEI-ECTKLGNWSA- 237

Query: 450 TPSCELITCPEPEVPKGGYVVGYDLNVH----------STLEFHCEPGHLLVGQASLKCT 499
            PSC+  +C  P         G  + +             + F C+              
Sbjct: 238 MPSCK-ASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQC 296

Query: 500 RQGDWD 505
             G  +
Sbjct: 297 IDGTIE 302
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Length = 175 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Length = 147 Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Length = 136 Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Length = 156 Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Length = 182 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Length = 129 Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Length = 129 Back     alignment and structure
>1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Length = 125 Back     alignment and structure
>2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Length = 133 Back     alignment and structure
>2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Length = 156 Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Length = 170 Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177 Back     alignment and structure
>1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Length = 130 Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Length = 140 Back     alignment and structure
>1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* Length = 140 Back     alignment and structure
>1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Length = 137 Back     alignment and structure
>1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Length = 149 Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Length = 175 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Length = 135 Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 141 Back     alignment and structure
>1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 182 Back     alignment and structure
>3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* Length = 157 Back     alignment and structure
>1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Length = 150 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Length = 168 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Length = 148 Back     alignment and structure
>2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* Length = 115 Back     alignment and structure
>1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Length = 144 Back     alignment and structure
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Length = 184 Back     alignment and structure
>1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Length = 113 Back     alignment and structure
>1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Length = 149 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Length = 128 Back     alignment and structure
>1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Length = 117 Back     alignment and structure
>1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 Length = 142 Back     alignment and structure
>2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 134 Back     alignment and structure
>3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A Length = 136 Back     alignment and structure
>1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A Length = 133 Back     alignment and structure
>3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Length = 131 Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Length = 131 Back     alignment and structure
>1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Length = 134 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Length = 129 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Length = 135 Back     alignment and structure
>3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 134 Back     alignment and structure
>3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Length = 132 Back     alignment and structure
>1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B Length = 125 Back     alignment and structure
>1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Length = 135 Back     alignment and structure
>1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B Length = 129 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B Length = 125 Back     alignment and structure
>1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A Length = 133 Back     alignment and structure
>3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Length = 126 Back     alignment and structure
>1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A Length = 135 Back     alignment and structure
>1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 123 Back     alignment and structure
>2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Length = 142 Back     alignment and structure
>1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B Length = 123 Back     alignment and structure
>3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B Length = 146 Back     alignment and structure
>2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 122 Back     alignment and structure
>3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Length = 203 Back     alignment and structure
>3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} PDB: 3t3a_A Length = 139 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} Length = 112 Back     alignment and structure
>1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B Length = 125 Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Length = 123 Back     alignment and structure
>1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B Length = 125 Back     alignment and structure
>3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} PDB: 3ff8_C Length = 115 Back     alignment and structure
>2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Length = 122 Back     alignment and structure
>1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 131 Back     alignment and structure
>3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Length = 190 Back     alignment and structure
>2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Length = 118 Back     alignment and structure
>3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} PDB: 1e87_A 1e8i_A 3cck_A Length = 130 Back     alignment and structure
>3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 124 Back     alignment and structure
>1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* Length = 128 Back     alignment and structure
>1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 Length = 199 Back     alignment and structure
>1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Length = 123 Back     alignment and structure
>1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Length = 138 Back     alignment and structure
>3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Length = 120 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} Length = 122 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Length = 68 Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Length = 68 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query618
1ntj_A320 Complement receptor related protein; immunology, g 100.0
2c8i_E316 CD55, complement decay-accelerating factor; picorn 100.0
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 100.0
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 100.0
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 100.0
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 100.0
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 100.0
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 100.0
3o8e_B252 Membrane cofactor protein; short consensus repeat, 100.0
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 100.0
3o8e_B252 Membrane cofactor protein; short consensus repeat, 100.0
2wii_C277 H factor 1, complement factor H; immune system, su 100.0
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 100.0
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 100.0
2wii_C277 H factor 1, complement factor H; immune system, su 100.0
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 100.0
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 100.0
1rid_A244 Complement control protein; regulation, SCR, immun 100.0
2xrb_A290 Complement regulatory protein CRRY; immune system, 100.0
3iyp_F381 Complement decay-accelerating factor; virus, recep 100.0
3iyp_F381 Complement decay-accelerating factor; virus, recep 100.0
2xrb_A290 Complement regulatory protein CRRY; immune system, 100.0
1rid_A244 Complement control protein; regulation, SCR, immun 100.0
1ntj_A320 Complement receptor related protein; immunology, g 100.0
2c8i_E316 CD55, complement decay-accelerating factor; picorn 100.0
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 100.0
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 100.0
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 100.0
3hrz_D 741 Complement factor B; serine protease, glycosilated 99.96
3sw0_X188 H factor 1, complement factor H; innate immune res 99.95
3sw0_X188 H factor 1, complement factor H; innate immune res 99.95
2uwn_A187 H factor 1, human complement factor H; alternative 99.95
2uwn_A187 H factor 1, human complement factor H; alternative 99.94
3hrz_D 741 Complement factor B; serine protease, glycosilated 99.94
2py2_A136 Antifreeze protein type II; type II antifreeze pro 99.93
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 99.93
1tdq_B130 Aggrecan core protein; extracellular matrix, lecti 99.93
2kv3_A131 Regenerating islet-derived protein 4; GISP, C-type 99.92
2zib_A133 Type II antifreeze protein; thermal hysteresis, le 99.92
1egg_A147 Macrophage mannose receptor; C-type lectin, sugar 99.92
1ypq_A135 Oxidised low density lipoprotein (lectin-like) rec 99.92
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 99.92
1wmz_A140 Lectin CEL-I, N-acetyl-D-galactosamine-specific C- 99.92
3vpp_A132 C-type lectin domain family 9 member A; dendritic 99.92
3alu_A157 Lectin CEL-IV, C-type; C-type lectin, raffinose, s 99.92
1dv8_A128 Asialoglycoprotein receptor 1; C-type lectin CRD, 99.92
1jzn_A135 Galactose-specific lectin; C-type lectin, protein- 99.92
2h2t_B175 Low affinity immunoglobulin epsilon FC receptor ( 99.92
2afp_A129 Protein (SEA raven type II antifreeze protein); re 99.92
3c22_A156 C-type lectin domain family 4 member K; coiled coi 99.92
1qdd_A144 Lithostathine; pancreatic stone inhibitor, metal b 99.92
1tn3_A137 Tetranectin; plasminogen binding, kringle 4, C-typ 99.92
2c6u_A122 CLEC1B protein; lectin, rhodocytin, aggretin, C-ty 99.92
1gz2_A142 Ovocleidin-17, OC-17 ovocleidin; structural protei 99.92
2bpd_A142 Dectin-1; receptor, beta-glucan, fungal recognitio 99.91
1c3a_A135 Flavocetin-A: alpha subunit; C-type lectin-like do 99.91
1uv0_A149 Pancreatitis-associated protein 1; lectin, C-type, 99.91
2e3x_C122 Coagulation factor X-activating enzyme light CHAI; 99.91
1fvu_B125 Botrocetin beta chain; VON WILLBRAND factor modula 99.91
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 99.91
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 99.91
1ukm_A134 EMS16 A chain, EMS16 subunit A; domain swapping, C 99.91
3g8k_A130 Lectin-related NK cell receptor LY49L1; natural ki 99.91
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 99.91
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 99.91
3bx4_A136 Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh 99.91
1umr_A135 Convulxin alpha, CVX alpha; lectin, C-type lectin, 99.91
1jwi_B125 Platelet aggregation inducer; domain swapping, C-t 99.91
1j34_B123 Coagulation factor IX-binding protein B chain; mag 99.91
1umr_C125 Convulxin beta, CVX beta; lectin, C-type lectin, p 99.91
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 99.91
1ukm_B128 EMS16 B chain, EMS16 subunit B; domain swapping, C 99.91
1oz7_B123 Echicetin B-chain; platelet aggregation, dimer, to 99.91
3gpr_C134 Rhodocetin subunit gamma; disulfide bond, lectin, 99.91
3ubu_A131 Agglucetin subunit alpha-1; platelet inhibiting, a 99.91
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 99.9
1c3a_B125 Flavocetin-A: beta subunit; C-type lectin-like dom 99.9
1fvu_A133 Botrocetin alpha chain; VON WILLBRAND factor modul 99.9
1j34_A129 Coagulation factor IX-binding protein A chain; mag 99.9
1hq8_A123 NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { 99.9
1rtm_1149 Mannose-binding protein-A; lectin; 1.80A {Rattus n 99.9
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 99.9
3rs1_A122 C-type lectin domain family 2 member I; C-type lec 99.9
1htn_A182 Tetranectin; plasminogen binding, kringle 4, alpha 99.9
1sb2_A133 Rhodocetin alpha subunit; C-type lectin, domain sw 99.9
1oz7_A131 Echicetin A-chain; platelet aggregation, dimer, to 99.9
2msb_A115 Mannose-binding protein-A; lectin; HET: BMA MAN; 1 99.9
3ff7_C112 Killer cell lectin-like receptor subfamily G membe 99.9
1buu_A168 Protein (mannose-binding protein A); lectin, HOST 99.9
3ubu_B126 Agglucetin subunit beta-2; platelet inhibiting, ag 99.9
2e3x_B134 Coagulation factor X-activating enzyme light CHAI; 99.9
1mpu_A138 NKG2-D type II integral membrane protein; C-type l 99.9
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 99.9
1sb2_B129 Rhodocetin beta subunit; C-type lectin, domain swa 99.9
3bx4_B146 Aggretin beta chain; toxin; 1.70A {Agkistrodon rho 99.9
2ls8_A156 C-type lectin domain family 4 member D; structural 99.83
2yhf_A118 C-type lectin domain family 5 member A; immune sys 99.89
3hup_A130 Early activation antigen CD69; C-type lectin-like 99.89
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 99.89
3gpr_D124 Rhodocetin subunit delta; disulfide bond, lectin, 99.89
1rdl_1113 SUB-MBP-C, mannose-binding protein-C; C-type lecti 99.89
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 99.89
3bdw_B120 NKG2-A/NKG2-B type II integral membrane protein; N 99.89
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 99.89
3m9z_A139 Killer cell lectin-like receptor subfamily B MEMB; 99.89
1h8u_A117 MBP, eosinophil granule major basic protein 1; lec 99.89
2qy0_A159 Complement C1R subcomponent; serine protease, beta 99.89
3ff9_A115 Killer cell lectin-like receptor subfamily G membe 99.89
1wk1_A150 Hypothetical protein YK1067A12; lectin C-type doma 99.88
3pbf_A148 Pulmonary surfactant-associated protein A; collect 99.88
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 99.88
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 99.88
1byf_A125 TC14, protein (polyandrocarpa lectin); C-type lect 99.88
1gkn_A128 Complement receptor type 1; module, SCR, structure 99.88
2qy0_A159 Complement C1R subcomponent; serine protease, beta 99.88
3g8l_A190 Lectin-related NK cell receptor LY49L1; natural ki 99.88
1gkg_A136 Complement receptor type 1; module, SCR, structure 99.88
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 99.87
1gkn_A128 Complement receptor type 1; module, SCR, structure 99.87
3c8j_A203 Natural killer cell receptor LY49C; MHC, virus, im 99.87
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 99.87
1gkg_A136 Complement receptor type 1; module, SCR, structure 99.87
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 99.86
1h03_P125 Complement decay-accelerating factor; immune syste 99.86
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 99.86
1h03_P125 Complement decay-accelerating factor; immune syste 99.86
1fm5_A199 Early activation antigen CD69; C-type lectin-like 99.86
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 99.84
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 99.83
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.83
2aty_A 376 Complement receptor chimeric conjugate CR2-IG; imm 99.82
3r62_A129 H factor 1, complement factor H; immunity, repeati 99.78
3r62_A129 H factor 1, complement factor H; immunity, repeati 99.77
2yby_A124 Complement factor H; immune system, complement reg 99.75
2yby_A124 Complement factor H; immune system, complement reg 99.75
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.72
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 99.71
4ayi_A125 H factor 1, complement factor H; immune system, an 99.7
4ayi_A125 H factor 1, complement factor H; immune system, an 99.7
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 99.54
2b5i_D217 Interleukin-2 receptor alpha chain; four-helix bun 99.52
2b5i_D217 Interleukin-2 receptor alpha chain; four-helix bun 99.51
1gpz_A 399 Complement C1R component; hydrolase, activation, i 99.47
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 99.46
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.45
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 99.4
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 99.4
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 99.24
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 99.21
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 99.2
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 99.15
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 98.96
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 98.86
3k7b_A96 Protein A33; C-type lectin-like domain, homodimer, 98.39
2psm_F78 Interleukin-15 receptor alpha chain; cytokine, gly 97.94
2psm_F78 Interleukin-15 receptor alpha chain; cytokine, gly 97.87
2z3q_B107 Interleukin-15 receptor alpha chain; protein-prote 97.3
2z3q_B107 Interleukin-15 receptor alpha chain; protein-prote 97.26
1elv_A 333 Complement C1S component; trypsin-like serin prote 97.22
1elv_A333 Complement C1S component; trypsin-like serin prote 96.9
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 96.6
3fd4_A191 Glycoprotein GP42; C type lectin, virus entry, mem 96.26
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 95.92
1md8_A329 C1R complement serine protease; innate immunity, a 94.14
1md8_A329 C1R complement serine protease; innate immunity, a 92.37
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 91.12
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 88.87
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 87.67
1o7b_T98 Tumor necrosis factor-inducible protein TSG-6; hya 81.14
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=1.2e-48  Score=404.38  Aligned_cols=290  Identities=25%  Similarity=0.535  Sum_probs=259.6

Q ss_pred             CCCCCCCcccceeeecc---cccccCCEEEEEcCCCceecCCceeEec-CCcccCCCCceeeecCCCCCccCCeeEEecC
Q psy1807         218 ANCGSPDRHLNTTFVGT---VNTKLGSTISYACPEGNMLVGSATRTCK-EGFWTGVAPTCQYVDCGKLEHIEHGTVTLET  293 (618)
Q Consensus       218 ~~C~~p~~~~n~~~~~~---~~~~~G~~~~y~C~~Gy~l~g~~~~~C~-~g~Ws~~~p~C~~~~C~~~~~~~ng~~~~~~  293 (618)
                      ..|..|+.+.|+.+...   ..|.+|++|+|+|++|| +.+...++|+ +|.|+...|.|+.+.|+.|+.+.||.+....
T Consensus         3 ~~C~~Pp~~~~~~~~~~~~~~~~~~g~~~~y~C~~Gy-~~~~~~~~C~~~g~Ws~~~p~C~~~~C~~p~~~~nG~~~~~~   81 (320)
T 1ntj_A            3 GQCPAPPLFPYAKPINPTDESTFPVGTSLKYECRPGY-IKRQFSITCEVNSVWTSPQDVCIRKQCETPLDPQNGIVHVNT   81 (320)
T ss_pred             CcCcCCCcCCcceeccccccccCCCCCEEEEEcCCCC-CCCCCeEEECCCCEECCCCCccccccCcCCCCCCCCEEECCC
Confidence            57999998888876532   36999999999999999 5677889998 8999998999999999999999999987653


Q ss_pred             CCcccCCEEEEEeCCCceecCCCeEEeCCCC---CcCCCCCcccccccCCCCCccccEEEe---cccccCceeeecCCCC
Q psy1807         294 TRTTHGAVAIYACHENYTLIGETRRVCGDGG---KWNGTEPQCLFDWCAEPPQISGGIVTT---SGRRTGSVATYSCEPG  367 (618)
Q Consensus       294 ~~~~~g~~~~~~C~~Gy~l~G~~~~~C~~~G---~Ws~~~p~C~~~~C~~p~~~~~g~~~~---~~~~~g~~~~~~C~~G  367 (618)
                       .+.+|++++|+|++||+|.|...++|+.+|   +|+...|.|+.+.|+.|+.+.||.+..   ..+.+|++|+|+|++|
T Consensus        82 -~~~~g~~~~y~C~~Gy~l~G~~~~~C~~~g~~~~Ws~~~P~C~~~~C~~p~~~~nG~~~~~~~~~~~~g~~v~y~C~~G  160 (320)
T 1ntj_A           82 -DIRFGSSITYTCNEGYRLIGSSSAMCIISDQSVAWDAEAPICESIPCEIPPSIPNGDFFSPNREDFHYGMVVTYQCNTD  160 (320)
T ss_pred             -CcccCCEEEEEcCCCCEECCCCceEEEeCCCCeeeCCCCCcCcCCCCCCCCCCCCCcEecCCCCccccCCEEEEECCCC
Confidence             588999999999999999999999999888   899999999999999999999998765   3578999999999999


Q ss_pred             ------cEEcCCceEEEccC----CeecCCCCceee-ecCCCCCccCCCceEee-cCcccccceEEEEcCCCceeccCCc
Q psy1807         368 ------FILFGSNELKCGLG----GDWSGKAPTCKY-VDCGSPANIDNGHYSLL-NGTTTHGSVAEYTCDDDYWLEAGAM  435 (618)
Q Consensus       368 ------y~l~G~~~~~C~~~----G~Ws~~~p~C~~-~~C~~p~~~~~g~~~~~-~~~~~~g~~~~~~C~~Gy~l~~~G~  435 (618)
                            |.|.|...++|+.+    |+|+++.|.|+. +.|+.| .+.||.+... ...|.+|++|+|+|++||.|.  |+
T Consensus       161 ~~~~~~y~l~G~~~~~C~~~~~~~G~Ws~~~P~C~~~~~C~~p-~~~ng~~~~~~~~~~~~g~~v~f~C~~Gy~l~--G~  237 (320)
T 1ntj_A          161 ARGKKLFNLVGEPSIHCTSIDGQVGVWSGPPPQCIELNKCTPP-HVENAVIVSKNKSLFSLRDMVEFRCQDGFMMK--GD  237 (320)
T ss_pred             CCCcceEEEeCCCceEEecCCCCCCEECCCCccccccCCCCCC-CCCCCeEeCCCCCcccCCCEEEEECCCCCeEC--CC
Confidence                  99999999999987    999999999996 689885 6899988654 346889999999999999999  99


Q ss_pred             ceEEeccCCeeeCCCCceeee-cCCCCC-cCCCcEEEc-ccCCCCcEEEEEcCCCCeeeCCceeEeCcCCc---ccCCCC
Q psy1807         436 RRQVCMRDGKWSGDTPSCELI-TCPEPE-VPKGGYVVG-YDLNVHSTLEFHCEPGHLLVGQASLKCTRQGD---WDNMSP  509 (618)
Q Consensus       436 ~~~~C~~~G~Ws~~~p~C~~~-~C~~p~-~~~~g~~~~-~~~~~g~~v~~~C~~Gy~l~G~~~~~C~~~G~---Ws~~~P  509 (618)
                      ..++|+.+|+|++..|+|+++ .|+.|. .+.||.+.. ..|.+|++|+|.|++||+|.|+..++|+.+|+   |++++|
T Consensus       238 ~~~~C~~~g~Ws~~~P~C~~~~~C~~p~~~~~ng~~~~~~~~~~g~~v~~~C~~Gy~l~G~~~~~C~~~G~~~~Ws~~~P  317 (320)
T 1ntj_A          238 SSVYCRSLNRWEPQLPSCFKVKSCGAFLGELPNGHVFVPQNLQLGAKVTFVCNTGYQLKGNSSSHCVLDGVESIWNSSVP  317 (320)
T ss_pred             CCcEECCCCeECCCCCeeEcccccCCCCCCCCCCeEecCCCcccCCEEEEEcCCCCEECCCCcCEeeCCCCcCccCCCCC
Confidence            999999999999999999986 798874 667777664 46889999999999999999999999999999   999999


Q ss_pred             ceE
Q psy1807         510 QFI  512 (618)
Q Consensus       510 ~C~  512 (618)
                      +|+
T Consensus       318 ~C~  320 (320)
T 1ntj_A          318 VCE  320 (320)
T ss_pred             ccC
Confidence            995
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Back     alignment and structure
>1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Back     alignment and structure
>2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} Back     alignment and structure
>2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Back     alignment and structure
>1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Back     alignment and structure
>1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Back     alignment and structure
>1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* Back     alignment and structure
>3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Back     alignment and structure
>3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* Back     alignment and structure
>1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Back     alignment and structure
>2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Back     alignment and structure
>1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Back     alignment and structure
>1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Back     alignment and structure
>2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Back     alignment and structure
>1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 Back     alignment and structure
>2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Back     alignment and structure
>1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Back     alignment and structure
>1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Back     alignment and structure
>2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Back     alignment and structure
>1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Back     alignment and structure
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A Back     alignment and structure
>1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Back     alignment and structure
>1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B Back     alignment and structure
>1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B Back     alignment and structure
>1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Back     alignment and structure
>1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* Back     alignment and structure
>1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Back     alignment and structure
>3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Back     alignment and structure
>3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B Back     alignment and structure
>1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A Back     alignment and structure
>1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Back     alignment and structure
>1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Back     alignment and structure
>1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Back     alignment and structure
>3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} Back     alignment and structure
>1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A Back     alignment and structure
>1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Back     alignment and structure
>2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* Back     alignment and structure
>3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} SCOP: d.169.1.0 Back     alignment and structure
>1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Back     alignment and structure
>2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Back     alignment and structure
>1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B Back     alignment and structure
>3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B Back     alignment and structure
>2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Back     alignment and structure
>2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Back     alignment and structure
>3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} SCOP: d.169.1.1 PDB: 1e87_A 1e8i_A 3cck_A Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Back     alignment and structure
>3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Back     alignment and structure
>1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Back     alignment and structure
>3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} SCOP: d.169.1.0 PDB: 3t3a_A Back     alignment and structure
>1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Back     alignment and structure
>3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} SCOP: d.169.1.0 PDB: 3ff8_C Back     alignment and structure
>1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Back     alignment and structure
>3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Back     alignment and structure
>1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Back     alignment and structure
>3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Back     alignment and structure
>3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Back     alignment and structure
>1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A* Back     alignment and structure
>2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>3k7b_A Protein A33; C-type lectin-like domain, homodimer, poxvirus, EEV, EV, VIR protein; 2.10A {Vaccinia virus WR} Back     alignment and structure
>2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1 Back     alignment and structure
>2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1 Back     alignment and structure
>2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A Back     alignment and structure
>2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>3fd4_A Glycoprotein GP42; C type lectin, virus entry, membrane fusion, HOST-virus interaction, lectin, membrane, transmembrane, viral protein; 2.40A {Human herpesvirus 4} PDB: 1kg0_C Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>1o7b_T Tumor necrosis factor-inducible protein TSG-6; hyaluronan-binding domain, carbohydrate-binding domain, LINK module, cell adhesion, glycoprotein; NMR {Homo sapiens} SCOP: d.169.1.4 PDB: 1o7c_T 2pf5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 618
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 7e-14
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 1e-11
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 1e-10
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 1e-09
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 1e-09
d1ypqa1131 d.169.1.1 (A:140-270) Oxidised low density lipopro 4e-13
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 7e-13
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 2e-12
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 4e-12
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 4e-09
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 1e-08
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 1e-12
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 2e-07
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 3e-07
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 1e-05
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 0.001
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 2e-12
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 1e-08
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 4e-08
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 7e-07
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 4e-04
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 2e-12
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 4e-11
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 6e-11
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 3e-10
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 8e-10
d1h8ua_115 d.169.1.1 (A:) Eosinophil major basic protein {Hum 3e-12
d1qo3c_133 d.169.1.1 (C:) NK cell receptor {Mouse (Mus muscul 4e-12
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 1e-11
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 4e-11
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 2e-10
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 2e-08
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 8e-08
d1t8da1143 d.169.1.1 (A:1-143) Low affinity immunoglobulin ep 1e-11
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 1e-11
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 7e-11
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 4e-10
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 6e-10
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 1e-07
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 2e-11
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 1e-06
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 2e-06
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 8e-05
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 2e-11
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 7e-10
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 6e-09
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 9e-09
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 1e-08
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 3e-11
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 4e-07
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 3e-06
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 6e-04
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 3e-11
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 2e-10
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 3e-08
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 2e-07
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 1e-06
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 3e-11
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 3e-09
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 1e-08
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 3e-05
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 6e-05
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 3e-11
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 6e-11
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 6e-10
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 2e-08
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 7e-08
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 6e-11
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 1e-10
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 2e-10
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 4e-09
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 1e-08
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 6e-11
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 1e-09
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 2e-09
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 1e-08
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 2e-07
d3c8ja1122 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus 6e-11
d1egga_136 d.169.1.1 (A:) Macrophage mannose receptor, CRD4 { 8e-11
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 1e-10
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 1e-10
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 2e-09
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 5e-09
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 2e-06
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 1e-10
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 3e-10
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 3e-09
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 3e-09
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 7e-07
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 2e-10
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 3e-10
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 2e-09
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 3e-09
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 6e-07
d1e87a_117 d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 3e-10
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 3e-10
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 4e-10
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 2e-09
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 5e-08
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 8e-07
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 4e-10
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 2e-09
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 4e-09
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 1e-08
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 3e-08
d1hq8a_123 d.169.1.1 (A:) NK cell-activating receptor nkg2d { 4e-10
d1pwba1121 d.169.1.1 (A:235-355) Surfactant protein, lectin d 8e-10
d2afpa_129 d.169.1.1 (A:) Type II antifreeze protein {Sea rav 1e-09
d1jzna_135 d.169.1.1 (A:) Galactose-specific C-type lectin {W 2e-09
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 2e-09
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 2e-09
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 4e-08
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 2e-07
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 4e-05
d2msba_112 d.169.1.1 (A:) Mannose-binding protein A, C-lectin 2e-09
d1wk1a_150 d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caeno 2e-09
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 2e-09
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 7e-09
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 7e-09
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 2e-08
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 1e-06
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 3e-09
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 1e-08
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 4e-08
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 5e-08
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 3e-04
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 4e-09
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 3e-07
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 5e-06
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 4e-05
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 6e-04
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 5e-09
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 6e-08
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 6e-06
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 2e-05
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 1e-04
d1qdda_144 d.169.1.1 (A:) Lithostathine, inhibitor of stone f 5e-09
d1tdqb_126 d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus 1e-08
d1r13a1119 d.169.1.1 (A:110-228) Surfactant protein, lectin d 1e-08
d1g1ta1118 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {H 1e-08
d1g1sa1118 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {H 2e-08
d1uv0a_140 d.169.1.1 (A:) Pancreatitis-associated protein 1 { 2e-08
d1fvua_133 d.169.1.1 (A:) Snake coagglutinin alpha chain {Jar 3e-08
d1tn3a_137 d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [ 4e-08
d1v7pa_134 d.169.1.1 (A:) Snake coagglutinin alpha chain {Sna 4e-08
d1rdl1_111 d.169.1.1 (1:) Mannose-binding protein A, C-lectin 7e-08
d3bdwa1121 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [T 8e-08
d1wmza_140 d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [T 1e-07
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 1e-07
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 1e-06
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 2e-06
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 5e-06
d1hupa1117 d.169.1.1 (A:112-228) Mannose-binding protein A, C 2e-07
d1umra_135 d.169.1.1 (A:) Snake coagglutinin alpha chain {Sou 2e-07
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 3e-07
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 4e-05
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 2e-04
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 6e-04
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 0.001
d1xpha1130 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related re 5e-07
d1jwib_123 d.169.1.1 (B:) Snake coagglutinin beta chain {Puff 1e-06
d1gz2a_139 d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gall 1e-06
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 1e-06
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 1e-06
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 1e-06
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 1e-04
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 2e-04
d1j34a_129 d.169.1.1 (A:) Snake coagglutinin alpha chain {Hab 2e-06
d1dv8a_128 d.169.1.1 (A:) H1 subunit of the asialoglycoprotei 4e-06
d1c3aa_135 d.169.1.1 (A:) Snake coagglutinin alpha chain {Hab 6e-06
d1byfa_123 d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocar 7e-06
d1oz7b_123 d.169.1.1 (B:) Snake coagglutinin beta chain {Saw- 8e-06
d1v7pb_127 d.169.1.1 (B:) Snake coagglutinin beta chain {Snak 9e-06
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 1e-05
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 4e-05
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 4e-04
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 0.003
d1oz7a_131 d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw 1e-05
d1sb2a1132 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain 1e-05
d1kg0c_136 d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId 3e-05
d1c3ab_125 d.169.1.1 (B:) Snake coagglutinin beta chain {Habu 7e-05
d2ok5a468 g.18.1.1 (A:9-76) Complement factor B {Human (Homo 0.003
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: Small proteins
fold: Complement control module/SCR domain
superfamily: Complement control module/SCR domain
family: Complement control module/SCR domain
domain: Complement factor B
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.1 bits (156), Expect = 7e-14
 Identities = 20/56 (35%), Positives = 24/56 (42%)

Query: 337 WCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNELKCGLGGDWSGKAPTCK 392
           +C+ P    G     S  R     TY C  G  L GS    C  GG WSG  P+C+
Sbjct: 2   YCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQ 57
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Length = 133 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Length = 129 Back     information, alignment and structure
>d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} Length = 135 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 150 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} Length = 119 Back     information, alignment and structure
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Length = 133 Back     information, alignment and structure
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Length = 134 Back     information, alignment and structure
>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Length = 140 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Length = 135 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Length = 123 Back     information, alignment and structure
>d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 139 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Length = 129 Back     information, alignment and structure
>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Length = 135 Back     information, alignment and structure
>d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} Length = 123 Back     information, alignment and structure
>d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Length = 123 Back     information, alignment and structure
>d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Length = 127 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Length = 131 Back     information, alignment and structure
>d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Length = 132 Back     information, alignment and structure
>d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Length = 136 Back     information, alignment and structure
>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Length = 125 Back     information, alignment and structure
>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query618
d1tdqb_126 Aggrecan core protein {Rat (Rattus norvegicus) [Ta 99.92
d1wmza_140 Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} 99.92
d1jzna_135 Galactose-specific C-type lectin {Western diamondb 99.91
d1egga_136 Macrophage mannose receptor, CRD4 {Human (Homo sap 99.91
d1t8da1143 Low affinity immunoglobulin epsilon Fc receptor {H 99.91
d2afpa_129 Type II antifreeze protein {Sea raven (Hemitripter 99.9
d1qdda_144 Lithostathine, inhibitor of stone formation {Human 99.9
d1gz2a_139 Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 903 99.9
d1xpha1130 DC-SIGNR (DC-SIGN related receptor) {Human (Homo s 99.9
d1tn3a_137 Tetranectin {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1pwba1121 Surfactant protein, lectin domain {Human (Homo sap 99.9
d1dv8a_128 H1 subunit of the asialoglycoprotein receptor {Hum 99.9
d3bdwa1121 CD94 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1c3ab_125 Snake coagglutinin beta chain {Habu snake (Trimere 99.89
d1j34b_123 Snake coagglutinin beta chain {Habu snake (Trimere 99.89
d1oz7b_123 Snake coagglutinin beta chain {Saw-scaled viper (E 99.89
d1c3aa_135 Snake coagglutinin alpha chain {Habu snake (Trimer 99.89
d1ypqa1131 Oxidised low density lipoprotein {Human (Homo sapi 99.89
d1hq8a_123 NK cell-activating receptor nkg2d {Mouse (Mus musc 99.89
d2msba_112 Mannose-binding protein A, C-lectin domain {Rat (R 99.89
d1jwia_124 Snake coagglutinin alpha chain {Puff adder (Bitis 99.89
d1j34a_129 Snake coagglutinin alpha chain {Habu snake (Trimer 99.89
d1umra_135 Snake coagglutinin alpha chain {South american rat 99.89
d1umrc_125 Snake coagglutinin beta chain {South american ratt 99.89
d1fvub_125 Snake coagglutinin beta chain {Jararaca (Bothrops 99.88
d1r13a1119 Surfactant protein, lectin domain {Rat (Rattus nor 99.88
d1fvua_133 Snake coagglutinin alpha chain {Jararaca (Bothrops 99.88
d1rdl1_111 Mannose-binding protein A, C-lectin domain {Rat (R 99.88
d1jwib_123 Snake coagglutinin beta chain {Puff adder (Bitis a 99.88
d1e87a_117 CD69 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d3c8ja1122 NK cell receptor {Mouse (Mus musculus), ly49-c [Ta 99.88
d1v7pb_127 Snake coagglutinin beta chain {Snake (Echis multis 99.88
d1v7pa_134 Snake coagglutinin alpha chain {Snake (Echis multi 99.88
d1qo3c_133 NK cell receptor {Mouse (Mus musculus), ly49-a [Ta 99.88
d1sb2a1132 Snake coagglutinin alpha chain {Malayan pit viper 99.88
d1hupa1117 Mannose-binding protein A, C-lectin domain {Human 99.87
d1uv0a_140 Pancreatitis-associated protein 1 {Human (Homo sap 99.87
d1sb2b1127 Snake coagglutinin beta chain {Malayan pit viper ( 99.87
d1h8ua_115 Eosinophil major basic protein {Human (Homo sapien 99.86
d1oz7a_131 Snake coagglutinin alpha chain {Saw-scaled viper ( 99.85
d1wk1a_150 Hypothetical protein F28B4.3 {Caenorhabditis elega 99.84
d1g1ta1118 E-selectin, C-lectin domain {Human (Homo sapiens) 99.81
d1kg0c_136 EBV gp42 {Epstein-Barr virus [TaxId: 10376]} 99.81
d1g1sa1118 P-selectin, C-lectin domain {Human (Homo sapiens) 99.8
d1byfa_123 Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) 99.72
d1quba258 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.42
d2ok5a262 Complement factor B {Human (Homo sapiens) [TaxId: 99.38
d1quba258 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.34
d2ok5a262 Complement factor B {Human (Homo sapiens) [TaxId: 99.3
d1ly2a263 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.3
d2ok5a361 Complement factor B {Human (Homo sapiens) [TaxId: 99.29
d1g40a262 Complement control protein {Vaccinia virus [TaxId: 99.27
d2ok5a361 Complement factor B {Human (Homo sapiens) [TaxId: 99.27
d1gpza268 Complement C1R protease domains {Human (Homo sapie 99.27
d1quba460 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.27
d1quba460 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.25
d2o39c264 CD46 (membrane cofactor protein, MCP) {Human (Homo 99.25
d1quba363 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.25
d1g40a358 Complement control protein {Vaccinia virus [TaxId: 99.25
d1ly2a167 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.24
d1ppqa_68 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.23
d1g40a262 Complement control protein {Vaccinia virus [TaxId: 99.23
d1gpza268 Complement C1R protease domains {Human (Homo sapie 99.23
d1g40a358 Complement control protein {Vaccinia virus [TaxId: 99.22
d1ppqa_68 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.22
d2o39c264 CD46 (membrane cofactor protein, MCP) {Human (Homo 99.21
d1g40a459 Complement control protein {Vaccinia virus [TaxId: 99.21
d1hcca_59 Factor H, 15th and 16th modules {Human (Homo sapie 99.2
d1hfia_62 Factor H, 15th and 16th modules {Human (Homo sapie 99.2
d1ly2a167 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.19
d1h03p162 Complement decay-accelerating factor (Daf, CD55) { 99.19
d1h03p263 Complement decay-accelerating factor (Daf, CD55) { 99.19
d1q3xa275 Mannan-binding lectin serine protease 2 (MASP-2) d 99.18
d1md8a276 Complement C1R protease domains {Human (Homo sapie 99.18
d1quba363 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.17
d1quba162 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.17
d1h03p263 Complement decay-accelerating factor (Daf, CD55) { 99.17
d1md8a276 Complement C1R protease domains {Human (Homo sapie 99.17
d1hfia_62 Factor H, 15th and 16th modules {Human (Homo sapie 99.16
d1hcca_59 Factor H, 15th and 16th modules {Human (Homo sapie 99.15
d2z3qb178 Interleukin-15 receptor subunit alpha {Human (Homo 99.15
d1ok3a264 Complement decay-accelerating factor (Daf, CD55) { 99.14
d1quba162 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.14
d1ly2a263 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.14
d1ok3a164 Complement decay-accelerating factor (Daf, CD55) { 99.13
d1q3xa275 Mannan-binding lectin serine protease 2 (MASP-2) d 99.13
d1elva268 Complement C1S protease domain {Human (Homo sapien 99.12
d1elva268 Complement C1S protease domain {Human (Homo sapien 99.12
d1gkga270 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.11
d1ok3a264 Complement decay-accelerating factor (Daf, CD55) { 99.1
d1h03p162 Complement decay-accelerating factor (Daf, CD55) { 99.07
d1g40a459 Complement control protein {Vaccinia virus [TaxId: 99.04
d1gkga270 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.03
d2z3qb178 Interleukin-15 receptor subunit alpha {Human (Homo 99.03
d1ok3a164 Complement decay-accelerating factor (Daf, CD55) { 99.03
d1zjka253 Complement C1R protease domains {Human (Homo sapie 99.02
d1gkna164 Complement receptor 1, cr1 {Human (Homo sapiens) [ 98.99
d1gkna164 Complement receptor 1, cr1 {Human (Homo sapiens) [ 98.98
d2o39c162 CD46 (membrane cofactor protein, MCP) {Human (Homo 98.95
d1srza_68 GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 98.95
d1srza_68 GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 98.94
d2o39c162 CD46 (membrane cofactor protein, MCP) {Human (Homo 98.88
d1zjka253 Complement C1R protease domains {Human (Homo sapie 98.87
d2ok5a468 Complement factor B {Human (Homo sapiens) [TaxId: 97.24
d2ok5a468 Complement factor B {Human (Homo sapiens) [TaxId: 97.19
d2b5id263 Interleukin-2 receptor alpha chain {Human (Homo sa 96.68
d2b5id263 Interleukin-2 receptor alpha chain {Human (Homo sa 96.29
d1g40a164 Complement control protein {Vaccinia virus [TaxId: 94.99
d1g40a164 Complement control protein {Vaccinia virus [TaxId: 94.46
d2b5id164 Interleukin-2 receptor alpha chain {Human (Homo sa 89.93
d2b5id164 Interleukin-2 receptor alpha chain {Human (Homo sa 88.29
d2pf5a195 TSG-6, Link module {Human (Homo sapiens) [TaxId: 9 83.69
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: C-type lectin-like
superfamily: C-type lectin-like
family: C-type lectin domain
domain: Aggrecan core protein
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.92  E-value=2.9e-25  Score=194.76  Aligned_cols=120  Identities=25%  Similarity=0.559  Sum_probs=106.5

Q ss_pred             ccceeecceEEEEecCCCCCHHHHHHHHHHcCCeecccCChHHHHHHHHHhhhcccCCCCccEEEeEEeCCCCCcceeEE
Q psy1807          84 AEITSFDRNCYEFNIDKGASFADARSKCQASGGDLVHGFRGITNTFLLGELERRKDRLKTLLVWIGAQKDPGITARTWKW  163 (618)
Q Consensus        84 ~~w~~~~~~CY~~~~~~~~tw~~A~~~C~~~g~~L~~i~s~~e~~fl~~~l~~~~~~~~~~~~WIGl~~~~~~~~~~w~W  163 (618)
                      .||+.|+++||+|+.. .++|.+|+..|+++||+||+|++++|++||..++..        .+||||++..  .++.|+|
T Consensus         5 ~gw~~~~~~CY~~~~~-~~sw~~A~~~C~~~g~~La~i~~~~e~~~l~~~~~~--------~~wigl~~~~--~~~~~~W   73 (126)
T d1tdqb_           5 EGWTKFQGHCYRHFPD-RETWVDAERRCREQQSHLSSIVTPEEQEFVNKNAQD--------YQWIGLNDRT--IEGDFRW   73 (126)
T ss_dssp             TTCEEETTEEEEEEEE-EECHHHHHHHHHHTTCEECCCCSHHHHHHHHHHHCS--------CEEEEEECSS--STTCCEE
T ss_pred             CCCeeeCCEEEEEECc-ccCHHHHHHHHHhhCcEEeEECChhHhhhhhccccc--------eeeeeccccc--CCCccCc
Confidence            9999999999999755 699999999999999999999999999999887632        4899999765  3889999


Q ss_pred             eCCcccccCCCCCCCCCCC-CCccceEEecCCCCceeeccccccccccccccC
Q psy1807         164 VDGEVVTKPSWGKDQPNNY-NGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQH  215 (618)
Q Consensus       164 ~DGs~~~~~~W~~~~P~~~-~~~~~Cv~l~~~~~~~W~d~~C~~~~~~~iC~~  215 (618)
                      +||+++.|++|.+++|++. ...++|+.|......+|++.+|+. ..+||||+
T Consensus        74 ~dg~~~~~~~w~~~~p~~~~~~~~~C~~~~~~~~~~W~~~~C~~-~~~fICek  125 (126)
T d1tdqb_          74 SDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNY-QLPFTCKK  125 (126)
T ss_dssp             TTCCCCCCCCBCTTCCCCCSTTTEEEEEEETTTTTEEEEEETTS-CEEEEEEE
T ss_pred             CCCCCcccccccccCCCccccCCcceEEEEeCCCCeEEecCCCC-CEEEEeee
Confidence            9999999999999999875 346789999766666999999998 67999996
>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} Back     information, alignment and structure
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Back     information, alignment and structure
>d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} Back     information, alignment and structure
>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Back     information, alignment and structure
>d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Back     information, alignment and structure
>d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Back     information, alignment and structure
>d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Back     information, alignment and structure
>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Back     information, alignment and structure
>d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Back     information, alignment and structure
>d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Back     information, alignment and structure
>d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Back     information, alignment and structure
>d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} Back     information, alignment and structure
>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Back     information, alignment and structure
>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} Back     information, alignment and structure
>d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Back     information, alignment and structure
>d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Back     information, alignment and structure
>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Back     information, alignment and structure
>d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Back     information, alignment and structure
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Back     information, alignment and structure
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Back     information, alignment and structure
>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a1 g.18.1.1 (A:1-64) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1g40a1 g.18.1.1 (A:1-64) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pf5a1 d.169.1.4 (A:1-95) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure