Psyllid ID: psy1911
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 342 | ||||||
| 110456454 | 125 | cathepsin B preproprotein-like protein [ | 0.286 | 0.784 | 1.0 | 7e-53 | |
| 22535408 | 347 | cathepsin B-like protease [Nilaparvata l | 0.447 | 0.440 | 0.522 | 1e-39 | |
| 27882093 | 330 | Zgc:55862 [Danio rerio] | 0.543 | 0.563 | 0.463 | 2e-39 | |
| 74179506 | 330 | cathepsin B preproprotein [Cyprinus carp | 0.543 | 0.563 | 0.468 | 2e-39 | |
| 37788265 | 330 | cathepsin B precursor [Fundulus heterocl | 0.543 | 0.563 | 0.463 | 6e-39 | |
| 50540542 | 330 | cathepsin B, a precursor [Danio rerio] g | 0.543 | 0.563 | 0.447 | 3e-38 | |
| 51038793 | 330 | cathepsin B [Paralichthys olivaceus] gi| | 0.543 | 0.563 | 0.453 | 5e-38 | |
| 254746338 | 337 | putative C1A cysteine protease precursor | 0.441 | 0.448 | 0.490 | 1e-37 | |
| 197725747 | 333 | cathepsin B precursor [Epinephelus coioi | 0.444 | 0.456 | 0.503 | 1e-37 | |
| 312374701 | 335 | hypothetical protein AND_15621 [Anophele | 0.444 | 0.453 | 0.490 | 2e-37 |
| >gi|110456454|gb|ABG74712.1| cathepsin B preproprotein-like protein [Diaphorina citri] | Back alignment and taxonomy information |
|---|
Score = 213 bits (543), Expect = 7e-53, Method: Compositional matrix adjust.
Identities = 98/98 (100%), Positives = 98/98 (100%)
Query: 66 KKAHMVPRCNAMRQIYEHGPLVAIFSVYADFLQYKSGVYQHNFGDSIGLHAVRVLGWGVE 125
KKAHMVPRCNAMRQIYEHGPLVAIFSVYADFLQYKSGVYQHNFGDSIGLHAVRVLGWGVE
Sbjct: 19 KKAHMVPRCNAMRQIYEHGPLVAIFSVYADFLQYKSGVYQHNFGDSIGLHAVRVLGWGVE 78
Query: 126 NDIPYWLVANSWNDHWGDHGTFKILRGENEADIEMGFN 163
NDIPYWLVANSWNDHWGDHGTFKILRGENEADIEMGFN
Sbjct: 79 NDIPYWLVANSWNDHWGDHGTFKILRGENEADIEMGFN 116
|
Source: Diaphorina citri Species: Diaphorina citri Genus: Diaphorina Family: Psyllidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|22535408|emb|CAC87118.1| cathepsin B-like protease [Nilaparvata lugens] | Back alignment and taxonomy information |
|---|
| >gi|27882093|gb|AAH44517.1| Zgc:55862 [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|74179506|dbj|BAE44111.1| cathepsin B preproprotein [Cyprinus carpio] | Back alignment and taxonomy information |
|---|
| >gi|37788265|gb|AAO64472.1| cathepsin B precursor [Fundulus heteroclitus] | Back alignment and taxonomy information |
|---|
| >gi|50540542|ref|NP_998501.1| cathepsin B, a precursor [Danio rerio] gi|34784038|gb|AAH56688.1| Cathepsin B, a [Danio rerio] gi|37681773|gb|AAQ97764.1| cathepsin B [Danio rerio] gi|41351445|gb|AAH65589.1| Cathepsin B, a [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|51038793|gb|AAT94175.1| cathepsin B [Paralichthys olivaceus] gi|121053785|gb|ABM47001.1| cathepsin B [Paralichthys olivaceus] | Back alignment and taxonomy information |
|---|
| >gi|254746338|emb|CAX16634.1| putative C1A cysteine protease precursor [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|197725747|gb|ACH73069.1| cathepsin B precursor [Epinephelus coioides] | Back alignment and taxonomy information |
|---|
| >gi|312374701|gb|EFR22198.1| hypothetical protein AND_15621 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 342 | ||||||
| ZFIN|ZDB-GENE-040426-2650 | 330 | ctsba "cathepsin B, a" [Danio | 0.543 | 0.563 | 0.463 | 6.4e-44 | |
| UNIPROTKB|P07858 | 339 | CTSB "Cathepsin B" [Homo sapie | 0.540 | 0.545 | 0.409 | 1.1e-39 | |
| UNIPROTKB|P07688 | 335 | CTSB "Cathepsin B" [Bos taurus | 0.441 | 0.450 | 0.480 | 1.1e-39 | |
| UNIPROTKB|E2R6Q7 | 339 | CTSB "Uncharacterized protein" | 0.619 | 0.625 | 0.381 | 1.8e-39 | |
| UNIPROTKB|A1E295 | 335 | CTSB "Cathepsin B" [Sus scrofa | 0.441 | 0.450 | 0.467 | 4.8e-39 | |
| RGD|621509 | 339 | Ctsb "cathepsin B" [Rattus nor | 0.543 | 0.548 | 0.401 | 4.3e-38 | |
| ZFIN|ZDB-GENE-070323-1 | 326 | ctsbb "capthepsin B, b" [Danio | 0.450 | 0.472 | 0.465 | 4.3e-38 | |
| UNIPROTKB|Q6IN22 | 339 | Ctsb "Cathepsin B" [Rattus nor | 0.470 | 0.474 | 0.445 | 5.5e-38 | |
| MGI|MGI:88561 | 339 | Ctsb "cathepsin B" [Mus muscul | 0.412 | 0.415 | 0.493 | 1.1e-37 | |
| UNIPROTKB|F1N9D7 | 340 | CTSB "Cathepsin B" [Gallus gal | 0.426 | 0.429 | 0.46 | 1.5e-37 |
| ZFIN|ZDB-GENE-040426-2650 ctsba "cathepsin B, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 463 (168.0 bits), Expect = 6.4e-44, P = 6.4e-44
Identities = 89/192 (46%), Positives = 115/192 (59%)
Query: 152 GENEADIEMGFNNRVEANSSEDDDLETMGCQNAKGL--PRNFDAREKWPECPSLRHIADQ 209
G N D++ + R+ + L M Q +GL P+NFDARE+WP CP+L+ I DQ
Sbjct: 43 GHNFRDVDYSYVKRLCGTFLKGPKLPVM-VQYTEGLKLPKNFDAREQWPNCPTLKEIRDQ 101
Query: 210 SNCGSCWAVSVANAISDRLCIASNGYFTGQISAQHIVACTPNC-WGCNGGWPQLAWRFWG 268
+CGSCWA A AISDR+CI SN + +IS+Q ++ C +C GCNGG+P AW FW
Sbjct: 102 GSCGSCWAFGAAEAISDRVCIQSNAKVSVEISSQDLLTCCDSCGMGCNGGYPSAAWDFWT 161
Query: 269 HNGVVTGGDYNSQEGCQPYTLAPCEHHVQGPLQNCTLLGKLKTPECKQNCYNPSYESTYR 328
+G+VTGG YNS GC+PYT+ PCEHHV G CT G TP C C P Y Y+
Sbjct: 162 TDGLVTGGLYNSHIGCRPYTIEPCEHHVNGSRPPCTGEGG-DTPNCDMKC-EPGYSPLYK 219
Query: 329 FDLKKGKKAHMV 340
D GK ++ V
Sbjct: 220 EDKHFGKTSYSV 231
|
|
| UNIPROTKB|P07858 CTSB "Cathepsin B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07688 CTSB "Cathepsin B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6Q7 CTSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1E295 CTSB "Cathepsin B" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|621509 Ctsb "cathepsin B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070323-1 ctsbb "capthepsin B, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6IN22 Ctsb "Cathepsin B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88561 Ctsb "cathepsin B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9D7 CTSB "Cathepsin B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 342 | |||
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 8e-56 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 3e-46 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 1e-29 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 6e-27 | |
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 1e-26 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 8e-22 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-21 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 2e-21 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 2e-16 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 1e-13 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 2e-13 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 8e-12 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 6e-11 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 7e-11 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 1e-10 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-09 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-09 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-09 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-09 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 8e-09 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-08 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 5e-08 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 5e-08 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 7e-08 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 8e-08 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 9e-08 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 1e-07 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-07 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 1e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-07 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-07 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 3e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-07 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 3e-07 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 4e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-07 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 8e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-07 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-07 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 9e-07 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 1e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-06 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 1e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 1e-06 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 2e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-06 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 2e-06 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 2e-06 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 3e-06 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 3e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-06 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 3e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 4e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 4e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-06 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 5e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-06 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 6e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 6e-06 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 6e-06 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 7e-06 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 7e-06 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 7e-06 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 7e-06 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 7e-06 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 9e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 9e-06 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 9e-06 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 1e-05 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 1e-05 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 1e-05 | |
| pfam04935 | 206 | pfam04935, SURF6, Surfeit locus protein 6 | 1e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-05 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| pfam08432 | 182 | pfam08432, DUF1742, Fungal protein of unknown func | 2e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 2e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 2e-05 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 2e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 2e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| pfam12569 | 516 | pfam12569, NARP1, NMDA receptor-regulated protein | 3e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 3e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 3e-05 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-05 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-05 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 4e-05 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 4e-05 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 4e-05 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 4e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-05 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 5e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 5e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 5e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-05 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 5e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 6e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 6e-05 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 6e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 7e-05 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 7e-05 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-05 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 8e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-05 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 8e-05 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 8e-05 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 8e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 9e-05 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 9e-05 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 1e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 1e-04 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 1e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 1e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 1e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 1e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 1e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 1e-04 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 1e-04 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 1e-04 | |
| pfam08208 | 193 | pfam08208, RNA_polI_A34, DNA-directed RNA polymera | 2e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 2e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 2e-04 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 2e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 2e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 2e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 2e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 2e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 2e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 2e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 2e-04 | |
| PTZ00069 | 300 | PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov | 2e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 2e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 3e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 3e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 3e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 3e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 3e-04 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 3e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 3e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 3e-04 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 3e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 4e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 4e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 4e-04 | |
| pfam07890 | 132 | pfam07890, Rrp15p, Rrp15p | 4e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 4e-04 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 4e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 4e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 5e-04 | |
| pfam09428 | 130 | pfam09428, DUF2011, Fungal protein of unknown func | 5e-04 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 5e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 5e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 5e-04 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 5e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 5e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 5e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 5e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 5e-04 | |
| pfam05178 | 99 | pfam05178, Kri1, KRI1-like family | 5e-04 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 5e-04 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 5e-04 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 5e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 6e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 6e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 6e-04 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 6e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 6e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 6e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 6e-04 | |
| pfam07741 | 95 | pfam07741, BRF1, Brf1-like TBP-binding domain | 6e-04 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 6e-04 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-04 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 7e-04 | |
| COG1498 | 395 | COG1498, SIK1, Protein implicated in ribosomal bio | 7e-04 | |
| PTZ00069 | 300 | PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov | 7e-04 | |
| pfam07741 | 95 | pfam07741, BRF1, Brf1-like TBP-binding domain | 7e-04 | |
| pfam14058 | 136 | pfam14058, PcfK, PcfK-like protein | 7e-04 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 7e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 8e-04 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 8e-04 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 8e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 8e-04 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 8e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 8e-04 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 8e-04 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 8e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 9e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.001 | |
| pfam08597 | 242 | pfam08597, eIF3_subunit, Translation initiation fa | 0.001 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.001 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.001 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.001 | |
| pfam07890 | 132 | pfam07890, Rrp15p, Rrp15p | 0.001 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 0.001 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 0.001 | |
| pfam03343 | 603 | pfam03343, SART-1, SART-1 family | 0.001 | |
| pfam14303 | 147 | pfam14303, NAM-associated, No apical meristem-asso | 0.001 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.001 | |
| cd13156 | 152 | cd13156, KOW_RPL6, KOW motif of Ribosomal Protein | 0.001 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.001 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.001 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.002 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.002 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.002 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.002 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.002 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.002 | |
| PTZ00372 | 413 | PTZ00372, PTZ00372, endonuclease 4-like protein; P | 0.002 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.002 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.002 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.002 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 0.002 | |
| PRK07561 | 859 | PRK07561, PRK07561, DNA topoisomerase I subunit om | 0.002 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.002 | |
| pfam08555 | 90 | pfam08555, DUF1754, Eukaryotic family of unknown f | 0.002 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 0.002 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.002 | |
| pfam13904 | 261 | pfam13904, DUF4207, Domain of unknown function (DU | 0.002 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.002 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.002 | |
| cd09270 | 211 | cd09270, RNase_H2-B, Ribonuclease H2-B is a subuni | 0.002 | |
| pfam09756 | 189 | pfam09756, DDRGK, DDRGK domain | 0.002 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 0.002 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.002 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.002 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.002 | |
| PRK14521 | 186 | PRK14521, rpsP, 30S ribosomal protein S16; Provisi | 0.002 | |
| pfam08079 | 71 | pfam08079, Ribosomal_L30_N, Ribosomal L30 N-termin | 0.002 | |
| pfam11947 | 149 | pfam11947, DUF3464, Protein of unknown function (D | 0.002 | |
| pfam03998 | 239 | pfam03998, Utp11, Utp11 protein | 0.002 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.002 | |
| pfam05501 | 122 | pfam05501, DUF755, Domain of unknown function (DUF | 0.002 | |
| PLN02381 | 1066 | PLN02381, PLN02381, valyl-tRNA synthetase | 0.002 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.002 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.003 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.003 | |
| pfam14265 | 125 | pfam14265, DUF4355, Domain of unknown function (DU | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| PTZ00069 | 300 | PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov | 0.003 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.003 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.003 | |
| pfam07741 | 95 | pfam07741, BRF1, Brf1-like TBP-binding domain | 0.003 | |
| pfam09831 | 177 | pfam09831, DUF2058, Uncharacterized protein conser | 0.003 | |
| pfam06102 | 168 | pfam06102, DUF947, Domain of unknown function (DUF | 0.003 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.003 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.003 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.003 | |
| smart00435 | 391 | smart00435, TOPEUc, DNA Topoisomerase I (eukaryota | 0.003 | |
| cd12951 | 129 | cd12951, RRP7_Rrp7A, RRP7 domain ribosomal RNA-pro | 0.003 | |
| pfam08576 | 98 | pfam08576, DUF1764, Eukaryotic protein of unknown | 0.003 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.004 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| TIGR02794 | 346 | TIGR02794, tolA_full, TolA protein | 0.004 | |
| PRK12280 | 158 | PRK12280, rplW, 50S ribosomal protein L23; Reviewe | 0.004 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam09468 | 287 | pfam09468, RNase_H2-Ydr279, Ydr279p protein family | 0.004 | |
| PRK06319 | 860 | PRK06319, PRK06319, DNA topoisomerase I/SWI domain | 0.004 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.004 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 0.004 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.004 | |
| pfam09736 | 141 | pfam09736, Bud13, Pre-mRNA-splicing factor of RES | 0.004 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 0.004 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 0.004 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.004 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.004 | |
| pfam06375 | 561 | pfam06375, BLVR, Bovine leukaemia virus receptor ( | 0.004 | |
| pfam08576 | 98 | pfam08576, DUF1764, Eukaryotic protein of unknown | 0.004 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.004 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.004 | |
| pfam09805 | 134 | pfam09805, Nop25, Nucleolar protein 12 (25kDa) | 0.004 |
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
Score = 181 bits (461), Expect = 8e-56
Identities = 75/151 (49%), Positives = 87/151 (57%), Gaps = 15/151 (9%)
Query: 188 PRNFDAREKWPECPSLRHIADQSNCGSCWAVSVANAISDRLCIASNGYFTGQISAQHIVA 247
P +FDAREKWP C S+ I DQ NCGSCWA S A SDRLCI SNG +SAQ +++
Sbjct: 1 PESFDAREKWPNCISIGEIRDQGNCGSCWAFSAVEAFSDRLCIQSNGKENVLLSAQDLLS 60
Query: 248 CTPNC-WGCNGGWPQLAWRFWGHNGVVTGGDYNSQEGCQPYTLAPCEHHVQGPLQNCTLL 306
C C GCNGG+P AW++ GVVTG GCQPYT+ PC HH +GP C
Sbjct: 61 CCSGCGDGCNGGYPDAAWKYLTTTGVVTG-------GCQPYTIPPCGHHPEGPPPCCG-- 111
Query: 307 GKLKTPECKQNCYNPSYESTYRFDLKKGKKA 337
TP C C + E TY D KGK A
Sbjct: 112 ----TPYCTPKCQDG-CEKTYEEDKHKGKSA 137
|
Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane antibody-mediated interstitial nephritis. It plays a role in renal tubulogenesis and is defective in hereditary tubulointerstitial disorders. TIN-Ag is exclusively expressed in kidney tissues. . Length = 236 |
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
| >gnl|CDD|218336 pfam04935, SURF6, Surfeit locus protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|219621 pfam07890, Rrp15p, Rrp15p | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|220237 pfam09428, DUF2011, Fungal protein of unknown function (DUF2011) | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|218482 pfam05178, Kri1, KRI1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|206228 pfam14058, PcfK, PcfK-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|219621 pfam07890, Rrp15p, Rrp15p | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217502 pfam03343, SART-1, SART-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|222665 pfam14303, NAM-associated, No apical meristem-associated C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240520 cd13156, KOW_RPL6, KOW motif of Ribosomal Protein L6 | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187751 cd09270, RNase_H2-B, Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids | Back alignment and domain information |
|---|
| >gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203848 pfam08079, Ribosomal_L30_N, Ribosomal L30 N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|204792 pfam11947, DUF3464, Protein of unknown function (DUF3464) | Back alignment and domain information |
|---|
| >gnl|CDD|217834 pfam03998, Utp11, Utp11 protein | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|218612 pfam05501, DUF755, Domain of unknown function (DUF755) | Back alignment and domain information |
|---|
| >gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|222636 pfam14265, DUF4355, Domain of unknown function (DUF4355) | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219547 pfam07741, BRF1, Brf1-like TBP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) | Back alignment and domain information |
|---|
| >gnl|CDD|218899 pfam06102, DUF947, Domain of unknown function (DUF947) | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|214661 smart00435, TOPEUc, DNA Topoisomerase I (eukaryota) | Back alignment and domain information |
|---|
| >gnl|CDD|240578 cd12951, RRP7_Rrp7A, RRP7 domain ribosomal RNA-processing protein 7 homolog A (Rrp7A) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|219913 pfam08576, DUF1764, Eukaryotic protein of unknown function (DUF1764) | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234017 TIGR02794, tolA_full, TolA protein | Back alignment and domain information |
|---|
| >gnl|CDD|237035 PRK12280, rplW, 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220252 pfam09468, RNase_H2-Ydr279, Ydr279p protein family (RNase H2 complex component) | Back alignment and domain information |
|---|
| >gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220371 pfam09736, Bud13, Pre-mRNA-splicing factor of RES complex | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) | Back alignment and domain information |
|---|
| >gnl|CDD|219913 pfam08576, DUF1764, Eukaryotic protein of unknown function (DUF1764) | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|220413 pfam09805, Nop25, Nucleolar protein 12 (25kDa) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 342 | |||
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 99.96 | |
| KOG1542|consensus | 372 | 99.95 | ||
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 99.94 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 99.94 | |
| KOG1543|consensus | 325 | 99.94 | ||
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 99.93 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 99.93 | |
| KOG1542|consensus | 372 | 99.92 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 99.92 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 99.92 | |
| KOG1543|consensus | 325 | 99.92 | ||
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 99.92 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 99.91 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 99.91 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 99.91 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 99.91 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 99.9 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.9 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 99.9 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 99.89 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 99.89 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 99.88 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 99.88 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 99.87 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 99.86 | |
| KOG1544|consensus | 470 | 99.82 | ||
| KOG1544|consensus | 470 | 99.81 | ||
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.8 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.8 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.78 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.75 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.69 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.55 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.39 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.8 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 98.49 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 97.08 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 96.89 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 96.76 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 84.03 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 82.53 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 80.78 |
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
Probab=99.96 E-value=5.1e-29 Score=230.58 Aligned_cols=139 Identities=53% Similarity=0.998 Sum_probs=107.6
Q ss_pred CcccccCccCCCCCCCcccccccccchHHHHHhhHHHHHHHHHHhCCccccccCHHHHHhhCCC-CCCCCCCchhhHHHH
Q psy1911 188 PRNFDAREKWPECPSLRHIADQSNCGSCWAVSVANAISDRLCIASNGYFTGQISAQHIVACTPN-CWGCNGGWPQLAWRF 266 (342)
Q Consensus 188 P~sfD~R~~~~~c~~i~~v~dQg~CGsCwAfa~~~~le~r~~i~~~~~~~~~LS~Q~lldC~~~-~~GC~GG~~~~a~~y 266 (342)
|++||||++|++|..|+||+||+.||||||||++++||++++|++++...+.||+|+||||+.. ..||+||++..||+|
T Consensus 1 p~~~DwR~~~~~~~~v~~v~dQg~CGsCwAfa~~~~le~~~~i~~~~~~~~~LS~Q~lidC~~~~~~gC~GG~~~~a~~~ 80 (236)
T cd02620 1 PESFDAREKWPNCISIGEIRDQGNCGSCWAFSAVEAFSDRLCIQSNGKENVLLSAQDLLSCCSGCGDGCNGGYPDAAWKY 80 (236)
T ss_pred CCcccchhhCCCCCCccccCCcccchhHHHHHHHHHHhhHHHHhcCCCCccccCHHHHHhhcCCCCCCCCCCCHHHHHHH
Confidence 8999999999988888999999999999999999999999999988555789999999999876 559999999999999
Q ss_pred hhhcccccCCCCCCCCCcccCCCCCCccCCCCCCccCCCCCccccccccccccccccccccccccccccceeEe
Q psy1911 267 WGHNGVVTGGDYNSQEGCQPYTLAPCEHHVQGPLQNCTLLGKLKTPECKQNCYNPSYESTYRFDLKKGKKAHMV 340 (342)
Q Consensus 267 ~~~~Gi~~e~~Y~~~~~C~PY~~~~c~~~~~~~~~~C~~~~~~~~p~C~~~C~~~~~~~~y~~d~~~~~~~y~~ 340 (342)
|+++||++|.+| ||....|..+.... .+|.. ++.|+..|. ......|..+.++....|.+
T Consensus 81 i~~~G~~~e~~y-------PY~~~~~~~~~~~~-~~~~~-----~~~~~~~C~-~~~~~~~~~~~~~~~~~~~~ 140 (236)
T cd02620 81 LTTTGVVTGGCQ-------PYTIPPCGHHPEGP-PPCCG-----TPYCTPKCQ-DGCEKTYEEDKHKGKSAYSV 140 (236)
T ss_pred HHhcCCCcCCEe-------cCcCCCCccCCCCC-CCCCC-----CCCCCCCCC-cCCccccceeeeeecceeee
Confidence 999999996655 99876665433222 34542 335555665 33222355555555544543
|
Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane |
| >KOG1542|consensus | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >KOG1542|consensus | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 342 | ||||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 2e-37 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 3e-37 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 4e-37 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 4e-37 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 2e-35 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-35 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 4e-35 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 1e-34 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 2e-32 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 5e-32 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 1e-29 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 2e-28 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 3e-17 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 6e-27 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 2e-13 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 4e-23 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 4e-23 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 5e-23 | ||
| 1sp4_A | 48 | Crystal Structure Of Ns-134 In Complex With Bovine | 3e-13 | ||
| 1huc_A | 47 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 5e-13 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 6e-13 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 3e-06 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 2e-12 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 1e-08 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 5e-12 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 9e-12 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 1e-04 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 3e-09 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 9e-09 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 2e-08 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 4e-08 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 5e-08 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 7e-08 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 1e-07 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 7e-05 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 2e-07 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 8e-04 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 5e-07 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 2e-04 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 5e-07 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 5e-07 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 5e-07 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 6e-07 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 6e-07 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 7e-07 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 9e-07 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 9e-07 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 9e-07 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 1e-06 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 2e-06 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 1e-06 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 2e-06 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 2e-06 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 7e-04 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 2e-06 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 6e-04 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 2e-06 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 7e-04 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 3e-06 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 6e-04 | ||
| 1k3b_B | 164 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 3e-06 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 3e-06 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 3e-06 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 5e-06 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 6e-06 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 9e-04 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 6e-06 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 6e-06 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 6e-06 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 4e-05 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 7e-06 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 8e-06 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 7e-05 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 9e-06 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 7e-05 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 9e-06 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 7e-05 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 9e-06 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 9e-06 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 4e-05 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 9e-06 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 8e-04 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 9e-06 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 5e-04 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 1e-05 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 7e-04 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 1e-05 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 5e-04 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 2e-05 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 2e-05 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 2e-05 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 3e-04 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 2e-05 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 2e-05 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 2e-05 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 2e-05 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 4e-04 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 3e-05 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 2e-04 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 3e-05 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 4e-05 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 6e-05 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 4e-05 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 6e-05 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 4e-05 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 6e-05 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 4e-05 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 6e-05 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 4e-05 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 6e-04 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 4e-05 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 5e-04 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 4e-05 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 6e-05 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 4e-05 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 5e-05 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 4e-05 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 5e-04 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 4e-05 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 8e-05 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 4e-05 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 5e-05 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 5e-05 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 3e-04 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 8e-05 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 8e-05 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 8e-05 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 8e-05 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 9e-05 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 2e-04 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 2e-04 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 3e-04 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 3e-04 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 4e-04 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 5e-04 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 6e-04 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 6e-04 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 6e-04 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 7e-04 |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
|
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|1SP4|A Chain A, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 48 | Back alignment and structure |
| >pdb|1HUC|A Chain A, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 47 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 342 | |||
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 99.95 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 99.95 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 99.94 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 99.94 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 99.94 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 99.94 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 99.94 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 99.94 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 99.94 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 99.94 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 99.94 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 99.94 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 99.94 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 99.94 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 99.94 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 99.94 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 99.94 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 99.94 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 99.94 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 99.94 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 99.94 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 99.94 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 99.94 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 99.94 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 99.94 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 99.94 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 99.94 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 99.93 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 99.93 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 99.93 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 99.93 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 99.93 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 99.93 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 99.93 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 99.93 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 99.93 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 99.93 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 99.93 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 99.93 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 99.93 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 99.93 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 99.93 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 99.93 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 99.93 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 99.93 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 99.93 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 99.93 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 99.93 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 99.93 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 99.93 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 99.93 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 99.93 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 99.93 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 99.93 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 99.93 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 99.93 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 99.93 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 99.93 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 99.92 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 99.92 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 99.92 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 99.92 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 99.92 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 99.92 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 99.92 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 99.92 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 99.92 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 99.92 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 99.92 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 99.91 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 99.91 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 99.9 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 99.89 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 99.88 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.85 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.85 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.72 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.72 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.72 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.71 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.69 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.44 |
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-40 Score=315.64 Aligned_cols=155 Identities=47% Similarity=1.043 Sum_probs=143.7
Q ss_pred CCCCCcccccCccCCCCCCCcccccccccchHHHHHhhHHHHHHHHHHhCCccccccCHHHHHhhCC-CC-CCCCCCchh
Q psy1911 184 AKGLPRNFDAREKWPECPSLRHIADQSNCGSCWAVSVANAISDRLCIASNGYFTGQISAQHIVACTP-NC-WGCNGGWPQ 261 (342)
Q Consensus 184 ~~~lP~sfD~R~~~~~c~~i~~v~dQg~CGsCwAfa~~~~le~r~~i~~~~~~~~~LS~Q~lldC~~-~~-~GC~GG~~~ 261 (342)
..+||++||||++||+|+.|+|||||+.||||||||++++||+|++|++++...+.||+|+||||+. .+ .||+||++.
T Consensus 61 ~~~lP~s~DwR~~~~~c~~vtpVkdQg~CGSCWAFsa~~ale~~~~i~~~~~~~~~LSeq~LvdC~~~~~~~GC~GG~~~ 140 (317)
T 3pbh_A 61 DLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA 140 (317)
T ss_dssp CCCCCSSEEHHHHCTTCGGGTCCCBCCSSCCHHHHHHHHHHHHHHHHHTTTSCCCCBCHHHHHHHSCTTTBCGGGCBCHH
T ss_pred ccCCCCCEechhccCCCCCcCCccccCCccchHHHHHHHHHHHHHHHHhCCCCcccCCHHHHHHhccccCCCCCCCCCHH
Confidence 3689999999999999999999999999999999999999999999999876688999999999987 44 499999999
Q ss_pred hHHHHhhhcccccCCCCCCCCCcccCCCCCCccCCCCCCccCCCCCccccccccccccccccccccccccccccceeEee
Q psy1911 262 LAWRFWGHNGVVTGGDYNSQEGCQPYTLAPCEHHVQGPLQNCTLLGKLKTPECKQNCYNPSYESTYRFDLKKGKKAHMVL 341 (342)
Q Consensus 262 ~a~~y~~~~Gi~~e~~Y~~~~~C~PY~~~~c~~~~~~~~~~C~~~~~~~~p~C~~~C~~~~~~~~y~~d~~~~~~~y~~~ 341 (342)
.||+||.++||++|++|++.++|+||++++|.|+..+..++|.... .+|.|..+|. ++|.+.|..|++|+...|.|+
T Consensus 141 ~A~~yi~~~Gi~te~~Y~~~~~c~PY~~~~c~~~~~~~~~~C~~~~--~~~~c~~~c~-~~~~~~~~~~~~~~~~~~~v~ 217 (317)
T 3pbh_A 141 EAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEG--DTPKCSKICE-PGYSPTYKQDKHYGYNSYSVS 217 (317)
T ss_dssp HHHHHHHHTCEEBBCSTTCCCBSSCCCSCCCCCCCTTCCSCCCSCC--CCCCCCCSCC-SSCCSCGGGSEECBCCCEEEC
T ss_pred HHHHHHHHhCCCcchhccCCCCCcCcccCcccccccCcCCCCCCcC--CCCccccccc-CCCccceeeeeeeeeecccCC
Confidence 9999999999999999999999999999999999888889998753 7899999999 889999999999999888874
|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 342 | ||||
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 1e-34 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 2e-24 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-18 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 1e-13 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 1e-18 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 5e-14 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 1e-17 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 3e-16 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 2e-17 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 5e-17 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 5e-17 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 3e-12 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 4e-16 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 2e-14 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 5e-16 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 4e-15 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 5e-16 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 1e-08 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 6e-16 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 4e-14 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 1e-15 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 6e-13 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 1e-15 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 8e-13 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 1e-15 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 3e-15 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 3e-15 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 3e-06 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 3e-15 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 1e-14 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-15 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 2e-14 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 6e-15 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 4e-11 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 2e-14 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 6e-14 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 8e-14 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 3e-12 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 3e-13 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 2e-10 | |
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 2e-04 | |
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 0.002 | |
| d1y2oa1 | 248 | a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain | 0.001 | |
| d1y2oa1 | 248 | a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain | 0.002 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 0.003 | |
| d1sa0e_ | 138 | a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus | 0.004 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Score = 125 bits (313), Expect = 1e-34
Identities = 71/155 (45%), Positives = 100/155 (64%), Gaps = 5/155 (3%)
Query: 187 LPRNFDAREKWPECPSLRHIADQSNCGSCWAVSVANAISDRLCIASNGYFTGQISAQHIV 246
LP +FDARE+WP+CP+++ I DQ +CGSCWA AISDR+CI +N + + ++SA+ ++
Sbjct: 2 LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLL 61
Query: 247 AC--TPNCWGCNGGWPQLAWRFWGHNGVVTGGDYNSQEGCQPYTLAPCEHHVQGPLQNCT 304
C + GCNGG+P AW FW G+V+GG Y S GC+PY++ PCEHHV G CT
Sbjct: 62 TCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCT 121
Query: 305 LLGKLKTPECKQNCYNPSYESTYRFDLKKGKKAHM 339
G+ TP+C + C P Y TY+ D G ++
Sbjct: 122 --GEGDTPKCSKIC-EPGYSPTYKQDKHYGYNSYS 153
|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 342 | |||
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.95 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.92 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 99.92 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 99.92 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 99.91 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 99.91 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 99.9 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.9 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.9 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 99.9 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 99.89 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 99.89 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 99.89 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.89 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.89 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 99.88 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 99.88 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.88 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 99.87 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.87 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 99.87 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 99.87 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.87 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 99.87 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 99.87 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.87 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 99.86 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.86 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.86 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.86 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.85 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 99.85 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.85 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.85 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 99.85 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.84 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 99.84 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.83 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 98.87 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.63 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 97.37 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 97.24 |
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=4.6e-29 Score=227.79 Aligned_cols=146 Identities=49% Similarity=1.094 Sum_probs=125.9
Q ss_pred CCCcccccCccCCCCCCCcccccccccchHHHHHhhHHHHHHHHHHhCCccccccCHHHHHhhCCC--CCCCCCCchhhH
Q psy1911 186 GLPRNFDAREKWPECPSLRHIADQSNCGSCWAVSVANAISDRLCIASNGYFTGQISAQHIVACTPN--CWGCNGGWPQLA 263 (342)
Q Consensus 186 ~lP~sfD~R~~~~~c~~i~~v~dQg~CGsCwAfa~~~~le~r~~i~~~~~~~~~LS~Q~lldC~~~--~~GC~GG~~~~a 263 (342)
.||++||||+.|++|+.|+||+||+.||||||||++++||++++|+++......||+|+|++|+.. +.||.||++..|
T Consensus 1 ~lP~~~D~R~~w~~~~~vtpV~dQg~cGsCwAfA~~~~lEs~~~i~~~~~~~~~lS~~~l~~~~~~~~~~gc~gg~~~~a 80 (254)
T d1gmya_ 1 KLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEA 80 (254)
T ss_dssp CCCSSEEHHHHSTTCGGGGCCCBCCSSCCHHHHHHHHHHHHHHHHHTTTSSCCCBCHHHHHHHSGGGGBCGGGCBCHHHH
T ss_pred CCCcCCcchhhcCCCCCCCCCCCCCCChhHHHHHHHHHHHHHHHHHHCCCCccccchHHHHhhccccCCCCCCCCcHHHH
Confidence 489999999999999999999999999999999999999999999988777789999999999753 349999999999
Q ss_pred HHHhhhcccccCCCCCCCCCcccCCCCCCccCCCCCCccCCCCCccccccccccccccccccccccccccc
Q psy1911 264 WRFWGHNGVVTGGDYNSQEGCQPYTLAPCEHHVQGPLQNCTLLGKLKTPECKQNCYNPSYESTYRFDLKKG 334 (342)
Q Consensus 264 ~~y~~~~Gi~~e~~Y~~~~~C~PY~~~~c~~~~~~~~~~C~~~~~~~~p~C~~~C~~~~~~~~y~~d~~~~ 334 (342)
+.++.+.|+++|..|++...|.+|..+.|........++|.... .+|.....|. ......+...++..
T Consensus 81 ~~~~~~~G~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~-~~~~~~~~~~~~~~ 148 (254)
T d1gmya_ 81 WNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEG--DTPKCSKICE-PGYSPTYKQDKHYG 148 (254)
T ss_dssp HHHHHHTCBCBCCSTTCCCSSSCCCSCCCBSSSCCSSCBCCSCC--CCCCCCCSCC-TTCCSCHHHHCBCB
T ss_pred HHHHHHcCccccccccccccccccccccccccccCccCcccccc--CCcccccccc-CCcccceeeeeeee
Confidence 99999999999999999999999999888887777888888765 6677777776 55555554444433
|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|