Psyllid ID: psy2114

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MLNLELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFKLNLQTVHQ
cccHHHHHHcccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccccEEEEEEcccHHcHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccc
cccHHHHHHHHccHHHHHHHHHccccccccEcccEEEEEEEHHHcHHHHHHHHHHHHccccccccccccccEEEEEEEEEEccEEEEEEEEEEccccccEEEEccccccccEEEEEcccccHHHHHcccccHHEEHHHHHcHHHccc
mlnlelctkhahpvvclssltgLFFSILSSrkdkisvwevdgkrfkpycQNLCLLAKFFLdhktlyddvePFLFYVMTIcdsegchtvgyfskLHYAKFMtwfglktptsrfkihRANHATAALRLVKNPRVLSIFAFKLNLQTVHQ
mlnlelctkhahpvvCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFklnlqtvhq
MLNLELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFKLNLQTVHQ
***LELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFKLNLQ****
MLNLELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPT***********TAALRLVKNPRVLSIFAFKLNLQTV**
MLNLELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFKLNLQTVHQ
MLNLELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFKLNLQT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLELCTKHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLHYAKFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLSIFAFKLNLQTVHQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
Q810T5612 Histone acetyltransferase yes N/A 0.428 0.102 0.777 7e-24
Q5SVQ0613 Histone acetyltransferase yes N/A 0.428 0.102 0.777 7e-24
O95251611 Histone acetyltransferase yes N/A 0.428 0.103 0.777 7e-24
Q9H7Z6458 Histone acetyltransferase no N/A 0.428 0.137 0.730 3e-22
Q5XI06458 Histone acetyltransferase no N/A 0.428 0.137 0.730 4e-22
Q8BRB7 1872 Histone acetyltransferase no N/A 0.428 0.033 0.730 4e-22
Q8WML3 1784 Histone acetyltransferase N/A N/A 0.428 0.035 0.730 4e-22
Q8WYB5 2073 Histone acetyltransferase no N/A 0.428 0.030 0.730 4e-22
Q9D1P2458 Histone acetyltransferase no N/A 0.428 0.137 0.730 4e-22
Q5TKR9 1998 Histone acetyltransferase no N/A 0.428 0.031 0.746 4e-22
>sp|Q810T5|KAT7_RAT Histone acetyltransferase KAT7 OS=Rattus norvegicus GN=Kat7 PE=2 SV=1 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/63 (77%), Positives = 53/63 (84%)

Query: 31  RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
           RK  ISV+EVDGK+ K YCQNLCLLAK FLDHKTLY DVEPFLFYVMT  D+ GCH +GY
Sbjct: 401 RKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGY 460

Query: 91  FSK 93
           FSK
Sbjct: 461 FSK 463
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q5SVQ0|KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus GN=Kat7 PE=2 SV=1 Back     alignment and function description
>sp|O95251|KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens GN=KAT7 PE=1 SV=1 Back     alignment and function description
>sp|Q9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens GN=KAT8 PE=1 SV=2 Back     alignment and function description
>sp|Q5XI06|KAT8_RAT Histone acetyltransferase KAT8 OS=Rattus norvegicus GN=Kat8 PE=2 SV=1 Back     alignment and function description
>sp|Q8BRB7|KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus GN=Kat6b PE=2 SV=3 Back     alignment and function description
>sp|Q8WML3|KAT6B_MACFA Histone acetyltransferase KAT6B OS=Macaca fascicularis GN=KAT6B PE=2 SV=1 Back     alignment and function description
>sp|Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens GN=KAT6B PE=1 SV=3 Back     alignment and function description
>sp|Q9D1P2|KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus GN=Kat8 PE=1 SV=1 Back     alignment and function description
>sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
270013354 823 hypothetical protein TcasGA2_TC011945 [T 0.496 0.088 0.8 4e-30
328787845 920 PREDICTED: hypothetical protein LOC40879 0.700 0.111 0.632 1e-29
189241087 793 PREDICTED: similar to chameau CG5229-PA 0.428 0.079 0.920 2e-29
307181087 875 Histone acetyltransferase MYST2 [Campono 0.578 0.097 0.659 2e-29
332024638 734 Histone acetyltransferase MYST2 [Acromyr 0.435 0.087 0.906 3e-29
322778832 744 hypothetical protein SINV_08771 [Solenop 0.435 0.086 0.906 3e-29
307213696 808 Histone acetyltransferase MYST2 [Harpegn 0.435 0.079 0.906 3e-29
380021733 824 PREDICTED: uncharacterized protein LOC10 0.428 0.076 0.920 3e-29
350403298 887 PREDICTED: hypothetical protein LOC10074 0.428 0.071 0.920 3e-29
340728384 887 PREDICTED: hypothetical protein LOC10064 0.428 0.071 0.920 3e-29
>gi|270013354|gb|EFA09802.1| hypothetical protein TcasGA2_TC011945 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 60/75 (80%), Positives = 66/75 (88%), Gaps = 2/75 (2%)

Query: 31  RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
           RKDKISVWEVDGKR+K YCQNLCLLAKFFLDHKTLY DVEPFLFYVMTI D+EGCHTVGY
Sbjct: 572 RKDKISVWEVDGKRYKQYCQNLCLLAKFFLDHKTLYYDVEPFLFYVMTIVDTEGCHTVGY 631

Query: 91  FSKLHYAKFMTWFGL 105
           FSK+++     W G+
Sbjct: 632 FSKVNH--ITVWDGM 644

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328787845|ref|XP_392324.4| PREDICTED: hypothetical protein LOC408793 [Apis mellifera] Back     alignment and taxonomy information
>gi|189241087|ref|XP_970403.2| PREDICTED: similar to chameau CG5229-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307181087|gb|EFN68832.1| Histone acetyltransferase MYST2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332024638|gb|EGI64835.1| Histone acetyltransferase MYST2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322778832|gb|EFZ09248.1| hypothetical protein SINV_08771 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307213696|gb|EFN89045.1| Histone acetyltransferase MYST2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380021733|ref|XP_003694712.1| PREDICTED: uncharacterized protein LOC100864433 [Apis florea] Back     alignment and taxonomy information
>gi|350403298|ref|XP_003486760.1| PREDICTED: hypothetical protein LOC100743655 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728384|ref|XP_003402505.1| PREDICTED: hypothetical protein LOC100642668 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
FB|FBgn0028387 811 chm "chameau" [Drosophila mela 0.428 0.077 0.777 4.6e-24
UNIPROTKB|E7EUP3425 KAT7 "Histone acetyltransferas 0.428 0.148 0.777 2e-22
UNIPROTKB|G3V125455 KAT7 "MYST histone acetyltrans 0.428 0.138 0.777 2.9e-22
UNIPROTKB|Q08DP5611 MYST2 "Uncharacterized protein 0.428 0.103 0.793 3.6e-22
UNIPROTKB|D4A4Q5522 Myst2 "Protein Myst2" [Rattus 0.428 0.120 0.777 4.9e-22
DICTYBASE|DDB_G0279699657 DDB_G0279699 "HAM group protei 0.428 0.095 0.761 7e-22
UNIPROTKB|F1NGX4606 MYST2 "Uncharacterized protein 0.428 0.103 0.777 7.4e-22
UNIPROTKB|E2RRZ5611 KAT7 "Uncharacterized protein" 0.428 0.103 0.777 7.6e-22
UNIPROTKB|O95251611 KAT7 "Histone acetyltransferas 0.428 0.103 0.777 7.6e-22
UNIPROTKB|F1RTB9611 MYST2 "Uncharacterized protein 0.428 0.103 0.777 7.6e-22
FB|FBgn0028387 chm "chameau" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 4.6e-24, P = 4.6e-24
 Identities = 49/63 (77%), Positives = 56/63 (88%)

Query:    31 RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
             RK K+ VW+VDGKR+K YCQ+LCLLAKFFLDHKTLY DVEPFLFY+MT+ D +GCH VGY
Sbjct:   591 RKGKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGY 650

Query:    91 FSK 93
             FSK
Sbjct:   651 FSK 653
GO:0004402 "histone acetyltransferase activity" evidence=ISS;NAS;TAS
GO:0016458 "gene silencing" evidence=IGI;TAS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0010485 "H4 histone acetyltransferase activity" evidence=IDA
GO:0003713 "transcription coactivator activity" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0008134 "transcription factor binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0048666 "neuron development" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0048190 "wing disc dorsal/ventral pattern formation" evidence=IGI
UNIPROTKB|E7EUP3 KAT7 "Histone acetyltransferase KAT7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V125 KAT7 "MYST histone acetyltransferase 2, isoform CRA_d" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DP5 MYST2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4Q5 Myst2 "Protein Myst2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279699 DDB_G0279699 "HAM group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGX4 MYST2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRZ5 KAT7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95251 KAT7 "Histone acetyltransferase KAT7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTB9 MYST2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6FPH9ESA1_CANGA2, ., 3, ., 1, ., 4, 80.61900.42850.1412yesN/A
Q2UMQ5ESA1_ASPOR2, ., 3, ., 1, ., 4, 80.66660.42850.1245yesN/A
Q810T5KAT7_RAT2, ., 3, ., 1, ., 4, 80.77770.42850.1029yesN/A
Q9FLF7MYST1_ARATH2, ., 3, ., 1, ., 4, 80.60290.46250.1528yesN/A
Q4IEV4ESA1_GIBZE2, ., 3, ., 1, ., 4, 80.65070.42850.1254yesN/A
O94446ESA1_SCHPO2, ., 3, ., 1, ., 4, 80.60310.42850.1360yesN/A
Q08649ESA1_YEAST2, ., 3, ., 1, ., 4, 80.61900.42850.1415yesN/A
Q9TYU5TIP60_CAEEL2, ., 3, ., 1, ., 4, 80.67210.41490.1331yesN/A
Q8LI34MYST1_ORYSJ2, ., 3, ., 1, ., 4, 80.61760.46250.1511yesN/A
O95251KAT7_HUMAN2, ., 3, ., 1, ., 4, 80.77770.42850.1031yesN/A
Q6CKE9ESA1_KLULA2, ., 3, ., 1, ., 4, 80.61900.42850.1435yesN/A
Q75BY2ESA1_ASHGO2, ., 3, ., 1, ., 4, 80.61900.42850.1448yesN/A
Q4WHG1ESA1_ASPFU2, ., 3, ., 1, ., 4, 80.66660.42850.1304yesN/A
Q5SVQ0KAT7_MOUSE2, ., 3, ., 1, ., 4, 80.77770.42850.1027yesN/A
Q6BU95ESA1_DEBHA2, ., 3, ., 1, ., 4, 80.63490.42850.1209yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!
3rd Layer2.3.1.48LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 1e-37
PLN00104450 PLN00104, PLN00104, MYST -like histone acetyltrans 8e-36
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 1e-28
PLN03238290 PLN03238, PLN03238, probable histone acetyltransfe 7e-28
PTZ00064 552 PTZ00064, PTZ00064, histone acetyltransferase; Pro 2e-26
PLN03239351 PLN03239, PLN03239, histone acetyltransferase; Pro 6e-22
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information 
 Score =  126 bits (318), Expect = 1e-37
 Identities = 46/63 (73%), Positives = 52/63 (82%)

Query: 31 RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
          RK  ISV+EVDG++ K YCQNLCLLAK FLDHKTLY DV+PFLFY++T  D  GCH VGY
Sbjct: 11 RKGNISVFEVDGRKQKLYCQNLCLLAKLFLDHKTLYYDVDPFLFYILTETDETGCHIVGY 70

Query: 91 FSK 93
          FSK
Sbjct: 71 FSK 73

This region of these proteins has been suggested to be homologous to acetyltransferases. Length = 189
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 100.0
PLN03238290 probable histone acetyltransferase MYST; Provision 100.0
PLN03239351 histone acetyltransferase; Provisional 100.0
KOG2747|consensus396 100.0
PTZ00064 552 histone acetyltransferase; Provisional 100.0
PLN00104450 MYST -like histone acetyltransferase; Provisional 100.0
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 100.0
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 96.55
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 94.77
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 94.47
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 94.34
PLN02825515 amino-acid N-acetyltransferase 94.07
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 93.71
PRK07757152 acetyltransferase; Provisional 93.59
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 93.56
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 93.39
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 92.89
PHA01807153 hypothetical protein 92.18
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 92.17
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 92.05
COG0456177 RimI Acetyltransferases [General function predicti 91.89
PRK05279441 N-acetylglutamate synthase; Validated 91.89
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 91.87
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 91.59
PRK03624140 putative acetyltransferase; Provisional 91.34
KOG2696|consensus 403 91.05
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 90.92
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 90.76
PRK10514145 putative acetyltransferase; Provisional 90.25
PRK09831147 putative acyltransferase; Provisional 90.08
PRK07922169 N-acetylglutamate synthase; Validated 89.82
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 89.76
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 89.45
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 89.24
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 88.68
PRK10140162 putative acetyltransferase YhhY; Provisional 88.46
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 87.95
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 87.83
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 87.67
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 87.12
PRK13688156 hypothetical protein; Provisional 86.57
PTZ00330147 acetyltransferase; Provisional 86.37
PRK10562145 putative acetyltransferase; Provisional 84.32
PRK10314153 putative acyltransferase; Provisional 81.87
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information 
Probab=100.00  E-value=1e-59  Score=380.00  Aligned_cols=111  Identities=44%  Similarity=0.662  Sum_probs=102.1

Q ss_pred             CCCcceEEecCCeEEEEEeCCcCchhhhhhhhhhhhcccceeeeecCCCeEEEEEEeeCCCCcEEEEEeecee--cC-Cc
Q psy2114          23 LFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGYFSKLH--YA-KF   99 (147)
Q Consensus        23 p~pG~~IYr~~~isIfEVDG~~~k~YCQnLcLlaKLFLdhKtlyyDVd~FlFYVL~e~d~~g~h~vGYFSKEK--~d-nn   99 (147)
                      .|||+||||++++|||||||+++++|||||||||||||||||+|||||+|+|||||+.|+.|+|+||||||||  ++ ||
T Consensus         3 ~PPG~eiYr~~~~sifEVdG~~~~~yCqnLcLlaKLFLd~Ktlyydv~~F~FYVl~e~d~~g~h~vGyFSKEk~s~~~~N   82 (188)
T PF01853_consen    3 HPPGNEIYRDDNISIFEVDGAKHKLYCQNLCLLAKLFLDHKTLYYDVDPFLFYVLTEKDDDGFHIVGYFSKEKESWDNNN   82 (188)
T ss_dssp             S-SSEEEEEETTEEEEEEETTTSHHHHHHHHHHHHTT-SSGCCTT-STTEEEEEEEEEETTEEEEEEEEEEESS-TT-EE
T ss_pred             CCCcCEEEECCCeEEEEEECCcCchHHHHHHHHHHHHhhCeEEEeecCceEEEEEEEecCccceeEEEEEEEecccCCee
Confidence            3589999999999999999999999999999999999999999999999999999999999999999999999  33 79


Q ss_pred             eeEEEEcCccccccccceeeceeeeeeccCCceEE
Q psy2114         100 MTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLS  134 (147)
Q Consensus       100 LaCI~vfPp~Qr~g~G~~~~~~~~~~~~~~~~~~s  134 (147)
                      ||||+|||||||+|+|++| |+|||.||+.+|.+.
T Consensus        83 LsCIl~lP~yQrkGyG~~L-I~fSY~LSr~e~~~G  116 (188)
T PF01853_consen   83 LSCILTLPPYQRKGYGRFL-IDFSYELSRREGKIG  116 (188)
T ss_dssp             ESEEEE-GGGTTSSHHHHH-HHHHHHHHHHTTS-B
T ss_pred             Eeehhhcchhhhcchhhhh-hhhHHHHhhccCcCC
Confidence            9999999999999999999 999999999988653

These proteins were reported to be homologous to acetyltransferases [] but this similarity is not supported by standard sequence analysis.; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3TO6_A 1MJA_A 1MJ9_A 3TO7_A 3TO9_A 1MJB_A 1FY7_A 2OZU_A 2RC4_A 2OU2_A ....
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG2747|consensus Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>KOG2696|consensus Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2rc4_A287 Crystal Structure Of The Hat Domain Of The Human Mo 4e-21
2y0m_A287 Crystal Structure Of The Complex Between Dosage Com 5e-21
4dnc_A289 Crystal Structure Of Human Mof In Complex With Msl1 7e-21
3qah_A304 Crystal Structure Of Apo-Form Human Mof Catalytic D 7e-21
2pq8_A278 Myst Histone Acetyltransferase 1 Length = 278 1e-20
2ozu_A284 Crystal Structure Of Human Myst Histone Acetyltrans 2e-20
2giv_A295 Human Myst Histone Acetyltransferase 1 Length = 295 3e-20
3tob_A270 Human Mof E350q Crystal Structure With Active Site 4e-20
3toa_A266 Human Mof Crystal Structure With Active Site Lysine 5e-20
2ou2_A280 Acetyltransferase Domain Of Human Hiv-1 Tat Interac 5e-18
1mj9_A278 Crystal Structure Of Yeast Esa1(C304s) Mutant Compl 9e-18
1mjb_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 1e-17
1mja_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 1e-17
1fy7_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 1e-17
3to9_A276 Crystal Structure Of Yeast Esa1 E338q Hat Domain Bo 5e-17
3to6_A276 Crystal Structure Of Yeast Esa1 Hat Domain Complexe 5e-17
>pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 Back     alignment and structure 
Iteration: 1

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 51/63 (80%)
Query: 31  RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
           RK+ ISV+EVDG     YCQNLCLLAK FLDHKTLY DVEPFLFYV+T  D +GCH VGY
Sbjct: 72  RKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGY 131
Query: 91  FSK 93
           FSK
Sbjct: 132 FSK 134
>pdb|2Y0M|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Mof Length = 287 Back     alignment and structure
>pdb|4DNC|A Chain A, Crystal Structure Of Human Mof In Complex With Msl1 Length = 289 Back     alignment and structure
>pdb|3QAH|A Chain A, Crystal Structure Of Apo-Form Human Mof Catalytic Domain Length = 304 Back     alignment and structure
>pdb|2PQ8|A Chain A, Myst Histone Acetyltransferase 1 Length = 278 Back     alignment and structure
>pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 Back     alignment and structure
>pdb|2GIV|A Chain A, Human Myst Histone Acetyltransferase 1 Length = 295 Back     alignment and structure
>pdb|2OU2|A Chain A, Acetyltransferase Domain Of Human Hiv-1 Tat Interacting Protein, 60kda, Isoform 3 Length = 280 Back     alignment and structure
>pdb|1MJ9|A Chain A, Crystal Structure Of Yeast Esa1(C304s) Mutant Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|1MJB|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase E338q Mutant Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|1MJA|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|1FY7|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|3TO9|A Chain A, Crystal Structure Of Yeast Esa1 E338q Hat Domain Bound To Coenzyme A With Active Site Lysine Acetylated Length = 276 Back     alignment and structure
>pdb|3TO6|A Chain A, Crystal Structure Of Yeast Esa1 Hat Domain Complexed With H4k16coa Bisubstrate Inhibitor Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
2ou2_A280 Histone acetyltransferase htatip; structural genom 4e-28
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 6e-28
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 7e-27
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 1e-26
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure
 Score =  103 bits (258), Expect = 4e-28
 Identities = 43/63 (68%), Positives = 49/63 (77%)

Query: 31  RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
           RK  IS +E+DG++ K Y QNLCLLAK FLDHKTLY D +PFLFYVMT  D +G H VGY
Sbjct: 69  RKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGY 128

Query: 91  FSK 93
           FSK
Sbjct: 129 FSK 131
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
2ou2_A280 Histone acetyltransferase htatip; structural genom 100.0
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 100.0
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 100.0
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 100.0
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 99.76
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.82
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 96.35
3efa_A147 Putative acetyltransferase; structural genom 2, pr 96.26
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 96.11
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 96.03
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 95.84
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 95.82
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 95.7
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 95.7
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 95.62
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 95.6
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 95.44
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 95.32
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 95.29
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 95.24
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 95.24
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 95.13
3mgd_A157 Predicted acetyltransferase; structural genomics, 95.09
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 95.09
1tiq_A180 Protease synthase and sporulation negative regulat 95.08
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 94.97
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 94.92
1y7r_A133 Hypothetical protein SA2161; structural genomics, 94.84
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 94.84
3owc_A188 Probable acetyltransferase; structural genomics, P 94.83
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 94.75
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 94.75
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 94.74
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 94.7
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 94.69
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 94.68
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 94.68
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 94.65
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 94.5
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 94.5
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 94.49
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 94.47
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 94.45
2fe7_A166 Probable N-acetyltransferase; structural genomics, 94.44
2gan_A190 182AA long hypothetical protein; alpha-beta protei 94.43
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 94.4
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 94.4
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 94.37
1xeb_A150 Hypothetical protein PA0115; midwest center for st 94.34
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 94.32
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 94.31
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 94.31
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 94.29
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 94.26
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 94.18
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 94.18
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 94.16
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 94.14
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 94.1
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 94.09
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 94.07
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 94.04
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 94.03
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 94.02
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 94.01
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 93.91
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 93.88
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 93.87
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 93.81
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 93.8
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 93.65
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 93.64
1z4r_A168 General control of amino acid synthesis protein 5- 93.53
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 93.51
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 93.5
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 93.28
1vkc_A158 Putative acetyl transferase; structural genomics, 93.11
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 93.05
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 92.99
1wwz_A159 Hypothetical protein PH1933; structural genomics, 92.95
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 92.9
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 92.87
2i6c_A160 Putative acetyltransferase; GNAT family, structura 92.86
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 92.85
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 92.8
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 92.76
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 92.75
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 92.55
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 92.53
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 92.41
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 92.35
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 92.31
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 92.23
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 92.18
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 92.16
3kkw_A182 Putative uncharacterized protein; acetyltransferas 92.15
3frm_A254 Uncharacterized conserved protein; APC61048, staph 92.1
2eui_A153 Probable acetyltransferase; dimer, structural geno 92.06
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 92.05
3juw_A175 Probable GNAT-family acetyltransferase; structural 91.95
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 91.88
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 91.87
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 91.53
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 91.47
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 91.36
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 91.32
1nsl_A184 Probable acetyltransferase; structural genomics, h 90.68
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 90.43
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 90.38
2fl4_A149 Spermine/spermidine acetyltransferase; structural 90.3
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 90.14
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 90.1
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 89.72
2aj6_A159 Hypothetical protein MW0638; structural genomics, 89.67
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 89.54
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 89.5
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 89.12
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 88.94
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 88.73
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 88.44
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 88.26
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 88.18
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 88.01
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 87.99
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 87.91
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 87.88
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 87.64
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 87.61
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 87.47
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 87.01
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 86.86
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 86.82
1xmt_A103 Putative acetyltransferase; structural genomics, p 85.82
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 85.21
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 84.7
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 84.62
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 84.52
2qml_A198 BH2621 protein; structural genomics, joint center 84.51
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 83.26
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 82.25
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 81.3
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 81.22
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 81.01
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 80.97
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 80.58
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 80.56
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 80.01
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.4e-61  Score=405.54  Aligned_cols=122  Identities=40%  Similarity=0.529  Sum_probs=115.8

Q ss_pred             hcccccccccCccCCCCcceEEecCCeEEEEEeCCcCchhhhhhhhhhhhcccceeeeecCCCeEEEEEEeeCCCCcEEE
Q psy2114           9 KHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTV   88 (147)
Q Consensus         9 ~~~H~~~C~~~~~~p~pG~~IYr~~~isIfEVDG~~~k~YCQnLcLlaKLFLdhKtlyyDVd~FlFYVL~e~d~~g~h~v   88 (147)
                      +.+|+.+|..+.|   ||+||||++++|||||||+++++|||||||||||||||||+|||||+|+|||||+.|++|+|+|
T Consensus        50 ~~~H~~~C~~r~P---PG~eIYr~~~~svfEVDG~~~k~yCQnLcLlaKLFLdhKtlyyDV~~FlFYVl~e~D~~g~h~v  126 (280)
T 2ou2_A           50 LQRHLTKCDLRHP---PGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIV  126 (280)
T ss_dssp             HHHHHHHCCCSSC---SSEEEEEETTEEEEEEETTTSHHHHHHHHHHHHTTCSCCTTTTCCTTEEEEEEEEEETTEEEEE
T ss_pred             HHHHHhhCCCCCC---CccEEEEcCCEEEEEEeCccchHHHHHHHHHHHHhhccceeeeecCceEEEEEEEecCCCcEEE
Confidence            4579999988743   8999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeecee--cC-CceeEEEEcCccccccccceeeceeeeeeccCCceEE
Q psy2114          89 GYFSKLH--YA-KFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLS  134 (147)
Q Consensus        89 GYFSKEK--~d-nnLaCI~vfPp~Qr~g~G~~~~~~~~~~~~~~~~~~s  134 (147)
                      |||||||  ++ ||||||+|||||||+|+|++| |+|||.||+-||.+.
T Consensus       127 GYFSKEK~s~~~~NLaCIltlP~yQrkGyG~lL-I~fSYeLSr~Eg~~G  174 (280)
T 2ou2_A          127 GYFSKEKESTEDYNVACILTLPPYQRRGYGKLL-IEFSYELSKVEGKTG  174 (280)
T ss_dssp             EEEEEESSCTTCEEESCEEECGGGTTSSHHHHH-HHHHHHHHHHTTCCB
T ss_pred             EEeeccccCccccceEEEEecchHHhcchhHHH-HHHHHHHHHhhCcCC
Confidence            9999999  34 899999999999999999999 999999999998754
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d2ozua1270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 1e-31
d2giva1271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 2e-31
d1fy7a_273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 4e-31
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 4e-12
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Histone acetyltransferase MYST3
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  111 bits (279), Expect = 1e-31
 Identities = 47/63 (74%), Positives = 51/63 (80%)

Query: 31  RKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTVGY 90
           RK+ ISV+EVDG     YCQNLCLLAK FLDHKTLY DVEPFLFYV+T  D +GCH VGY
Sbjct: 66  RKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGY 125

Query: 91  FSK 93
           FSK
Sbjct: 126 FSK 128
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 100.0
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 100.0
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 100.0
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 99.74
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 96.73
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 96.22
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 96.19
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 96.15
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 95.46
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 95.25
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 95.05
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 94.9
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 94.89
d1tiqa_173 Protease synthase and sporulation negative regulat 94.84
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 94.68
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 94.62
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 94.47
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 94.36
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 94.34
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 94.28
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 94.12
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 94.04
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 93.94
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 93.73
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 93.36
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 93.33
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 93.2
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 93.18
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 92.86
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 92.62
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 92.32
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 92.23
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 91.73
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 91.52
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 91.48
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 91.35
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 91.08
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 90.8
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 90.72
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 89.72
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 89.62
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 89.41
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 89.28
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 88.62
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 88.46
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 88.15
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 87.21
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 83.97
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 83.51
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 83.12
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 83.05
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 81.55
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 81.03
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 80.01
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Probable histone acetyltransferase MYST1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.5e-60  Score=394.65  Aligned_cols=122  Identities=43%  Similarity=0.571  Sum_probs=116.0

Q ss_pred             hcccccccccCccCCCCcceEEecCCeEEEEEeCCcCchhhhhhhhhhhhcccceeeeecCCCeEEEEEEeeCCCCcEEE
Q psy2114           9 KHAHPVVCLSSLTGLFFSILSSRKDKISVWEVDGKRFKPYCQNLCLLAKFFLDHKTLYDDVEPFLFYVMTICDSEGCHTV   88 (147)
Q Consensus         9 ~~~H~~~C~~~~~~p~pG~~IYr~~~isIfEVDG~~~k~YCQnLcLlaKLFLdhKtlyyDVd~FlFYVL~e~d~~g~h~v   88 (147)
                      +.+|...|..+.|   ||+||||++++|||||||+++++|||||||||||||||||+|||||+|+|||||+.|++|+|+|
T Consensus        47 ~~~H~~~C~~~~P---PG~eIYr~~~~si~EVDG~~~~~yCqnLcLlaKLFLdhKtl~ydV~~F~FYVl~e~d~~g~h~v  123 (271)
T d2giva1          47 YRFHLGQCQWRQP---PGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIV  123 (271)
T ss_dssp             HHHHHHHCCCCSC---SSEEEEEETTEEEEEEETTTSHHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEECSSCEEEE
T ss_pred             HHHHHHhCCCcCC---CcceEeecCCEEEEEeeCccchhhhhHHHHHHHHhcccceeeecCCceEEEEEEEecCCCceEE
Confidence            5679999988643   8999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeecee--cC-CceeEEEEcCccccccccceeeceeeeeeccCCceEE
Q psy2114          89 GYFSKLH--YA-KFMTWFGLKTPTSRFKIHRANHATAALRLVKNPRVLS  134 (147)
Q Consensus        89 GYFSKEK--~d-nnLaCI~vfPp~Qr~g~G~~~~~~~~~~~~~~~~~~s  134 (147)
                      |||||||  +| ||||||+|||||||+|||++| |+|||-||+-||.++
T Consensus       124 GYFSKEk~s~~~~NLsCIltlP~yQrkGyG~lL-I~fSYeLSr~E~~~G  171 (271)
T d2giva1         124 GYFSKEKESPDGNNVACILTLPPYQRRGYGKFL-IAFSYELSKLESTVG  171 (271)
T ss_dssp             EEEEEESSCTTCEEESCEEECGGGCSSSHHHHH-HHHHHHHHHHTTCCB
T ss_pred             EeeeeEeccCCCceeeeeeccCHHHhcCHhHhH-HhhhhhhhhccCCCC
Confidence            9999999  45 899999999999999999999 999999999998764
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure