Psyllid ID: psy2414


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MFGFKSRYPPTSPIQPFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVDRV
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccc
ccccccccccccccccEEEcccccccccccccccccEEEEccccEEcccHHHcccccccccccccccccEcHHHHHHHHHHHHHccccHHHHHcHHHHHccccccccccccccc
mfgfksrypptspiqpfitrnntdsifypdpaspgmykCVICLKSVRSRWHHLQthfsrnhkcpycesvySRVDTLKLHAKRVHGLGISRYIhglipqllfptphaktspvdrv
mfgfksrypptspiqpfitrnnTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQThfsrnhkcpycESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLlfptphaktspvdrv
MFGFKSRYPPTSPIQPFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVDRV
****************FITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFP************
*************************************KCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKR********************************
********PPTSPIQPFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPH*********
*FGFKSRYPPTSPIQPFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPH*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGFKSRYPPTSPIQPFITRNNTDSIFYPDPASPGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVDRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q8IN81955 Sex determination protein no N/A 0.456 0.054 0.423 2e-07
A1Z9R4 1228 Zinc finger protein 423 h no N/A 0.394 0.036 0.469 0.0003
>sp|Q8IN81|FRU_DROME Sex determination protein fruitless OS=Drosophila melanogaster GN=fru PE=1 SV=1 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 34  PGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHG 85
           P +Y+CV C K V +RWHH   H  ++H+CP C   ++R D +K H K  H 
Sbjct: 891 PTLYRCVSCNKIVSNRWHHANIHRPQSHECPVCGQKFTRRDNMKAHCKIKHA 942




Probably acts as a transcriptional regulator. Part of the somatic sex determination hierarchy; sex determination genes transformer (tra) and transformer-2 (tra-2) switch fru splicing from the male-specific pattern to the female-specific pattern through activation of the female-specific fru 5'-splice site. Vital for the development of males and females. Controls the development of the male specific abdominal muscle of Lawrence. Plays a role in male courtship behavior and sexual orientation. Enhances male-specific expression of takeout in brain-associated fat body.
Drosophila melanogaster (taxid: 7227)
>sp|A1Z9R4|ZN423_DROME Zinc finger protein 423 homolog OS=Drosophila melanogaster GN=Oaz PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
255918098 402 fruitless isoform A [Nasonia vitripennis 0.535 0.151 0.411 1e-07
379324167 355 fruitless zinc-finger C isoform [Triboli 0.552 0.177 0.380 1e-07
383850064 377 PREDICTED: zinc finger and BTB domain-co 0.526 0.159 0.4 2e-07
328780040 387 PREDICTED: hypothetical protein LOC40902 0.526 0.155 0.4 2e-07
255918096 376 fruitless isoform m-C [Nasonia vitripenn 0.517 0.156 0.406 2e-07
255918111 360 fruitless isoform C [Nasonia vitripennis 0.517 0.163 0.406 2e-07
195497672129 GE25194 [Drosophila yakuba] gi|194182301 0.508 0.449 0.413 3e-07
30720237582 Sex determination protein fruitless [Har 0.526 0.731 0.4 4e-07
24647972 789 fruitless, isoform B [Drosophila melanog 0.526 0.076 0.4 5e-07
2773138 776 fruitless class I male isoform [Drosophi 0.526 0.077 0.4 5e-07
>gi|255918098|ref|NP_001157596.1| fruitless isoform A [Nasonia vitripennis] gi|255918105|ref|NP_001157599.1| fruitless isoform A [Nasonia vitripennis] gi|255504407|gb|ACU12194.1| fruitless transcript variant P2-1-A [Nasonia vitripennis] gi|255504413|gb|ACU12197.1| fruitless transcript variant P2-2-A [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 7/68 (10%)

Query: 24  DSIFYPDPASPGM-------YKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTL 76
           DS+F P+             Y C+ C KSV +RWHH++ H S+N +CPYC  V++R D L
Sbjct: 328 DSMFVPEDTIATSTTTASRTYSCLRCGKSVSNRWHHVRAHRSQNCRCPYCNVVFTRSDNL 387

Query: 77  KLHAKRVH 84
           K H +  H
Sbjct: 388 KAHIRSKH 395




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|379324167|gb|AFD01648.1| fruitless zinc-finger C isoform [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383850064|ref|XP_003700637.1| PREDICTED: zinc finger and BTB domain-containing protein 34-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328780040|ref|XP_392552.4| PREDICTED: hypothetical protein LOC409022 isoform 2 [Apis mellifera] gi|380027999|ref|XP_003697699.1| PREDICTED: uncharacterized protein LOC100871989 isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|255918096|ref|NP_001157595.1| fruitless isoform m-C [Nasonia vitripennis] gi|255504405|gb|ACU12193.1| fruitless male-specific transcript variant P1-m-C [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|255918111|ref|NP_001157602.1| fruitless isoform C [Nasonia vitripennis] gi|255918119|ref|NP_001157606.1| fruitless isoform C [Nasonia vitripennis] gi|255504419|gb|ACU12200.1| fruitless transcript variant P2-2-C [Nasonia vitripennis] gi|255504433|gb|ACU12207.1| fruitless transcript variant P5-C [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195497672|ref|XP_002096200.1| GE25194 [Drosophila yakuba] gi|194182301|gb|EDW95912.1| GE25194 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|307202375|gb|EFN81803.1| Sex determination protein fruitless [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|24647972|ref|NP_732344.1| fruitless, isoform B [Drosophila melanogaster] gi|23171643|gb|AAF55562.2| fruitless, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|2773138|gb|AAB96677.1| fruitless class I male isoform [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
FB|FBgn0004652955 fru "fruitless" [Drosophila me 0.526 0.062 0.390 3.9e-10
FB|FBgn0261613 1228 Oaz "O/E-associated zinc finge 0.394 0.036 0.469 2e-05
MGI|MGI:1921747666 Zfp710 "zinc finger protein 71 0.631 0.108 0.329 4.3e-05
UNIPROTKB|F1S638 351 ZBTB41 "Uncharacterized protei 0.438 0.142 0.407 4.4e-05
UNIPROTKB|G4NAV4417 MGG_03133 "Uncharacterized pro 0.438 0.119 0.388 4.6e-05
UNIPROTKB|E2RSZ3664 ZNF710 "Uncharacterized protei 0.473 0.081 0.35 6.9e-05
SGD|S000004674490 MOT3 "Transcriptional represso 0.657 0.153 0.358 7.4e-05
RGD|1306491665 Zfp710 "zinc finger protein 71 0.631 0.108 0.329 8.7e-05
UNIPROTKB|D4A0K8687 Znf710 "Zinc finger protein 71 0.473 0.078 0.35 0.00015
UNIPROTKB|E1C2V5 584 ZBTB17 "Zinc finger and BTB do 0.412 0.080 0.384 0.00015
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 141 (54.7 bits), Expect = 3.9e-10, Sum P(2) = 3.9e-10
 Identities = 25/64 (39%), Positives = 35/64 (54%)

Query:    34 PGMYKCVICLKSVRSRWHHLQTHFSRNHKCPYCESVYSRVDTLKLHAKRVHG----LGIS 89
             P +Y+CV C K V +RWHH   H  ++H+CP C   ++R D +K H K  H        S
Sbjct:   891 PTLYRCVSCNKIVSNRWHHANIHRPQSHECPVCGQKFTRRDNMKAHCKIKHADIKDRFFS 950

Query:    90 RYIH 93
              Y+H
Sbjct:   951 HYVH 954


GO:0016545 "male courtship behavior, veined wing vibration" evidence=IMP
GO:0008049 "male courtship behavior" evidence=NAS;IMP;TAS
GO:0007618 "mating" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;TAS
GO:0045433 "male courtship behavior, veined wing generated song production" evidence=IMP;TAS
GO:0007517 "muscle organ development" evidence=IMP
GO:0007530 "sex determination" evidence=IMP;TAS
GO:0007275 "multicellular organismal development" evidence=IMP
GO:0005634 "nucleus" evidence=NAS
GO:0007617 "mating behavior" evidence=IMP
GO:0016543 "male courtship behavior, orientation prior to leg tapping and wing vibration" evidence=NAS
GO:0007620 "copulation" evidence=NAS;TAS
GO:0007417 "central nervous system development" evidence=IMP;TAS
GO:0046661 "male sex differentiation" evidence=TAS
GO:0048047 "mating behavior, sex discrimination" evidence=IGI;IMP;TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0002118 "aggressive behavior" evidence=IMP
GO:0016199 "axon midline choice point recognition" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
FB|FBgn0261613 Oaz "O/E-associated zinc finger protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1921747 Zfp710 "zinc finger protein 710" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S638 ZBTB41 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G4NAV4 MGG_03133 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSZ3 ZNF710 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
SGD|S000004674 MOT3 "Transcriptional repressor and activator with two C2-H2 zinc fingers" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
RGD|1306491 Zfp710 "zinc finger protein 710" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A0K8 Znf710 "Zinc finger protein 710 (Predicted), isoform CRA_c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2V5 ZBTB17 "Zinc finger and BTB domain-containing protein 17" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG2462|consensus279 99.87
KOG2462|consensus279 99.78
KOG3623|consensus1007 99.43
KOG3623|consensus1007 99.32
KOG3608|consensus 467 99.24
KOG3576|consensus267 99.2
KOG3576|consensus267 99.16
KOG1074|consensus 958 99.08
KOG3608|consensus467 99.08
PHA0276855 hypothetical protein; Provisional 98.95
PHA00733128 hypothetical protein 98.94
PHA00733128 hypothetical protein 98.76
PLN03086567 PRLI-interacting factor K; Provisional 98.66
PHA0276855 hypothetical protein; Provisional 98.64
PHA0073279 hypothetical protein 98.58
KOG1074|consensus 958 98.49
PLN03086567 PRLI-interacting factor K; Provisional 98.4
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.32
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.13
PHA0061644 hypothetical protein 98.04
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.93
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.8
PHA0073279 hypothetical protein 97.68
PHA0061644 hypothetical protein 97.68
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.64
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.62
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.36
smart0035526 ZnF_C2H2 zinc finger. 97.12
KOG3993|consensus500 97.09
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.88
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.61
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.46
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.41
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.37
PRK04860160 hypothetical protein; Provisional 95.84
PRK04860160 hypothetical protein; Provisional 95.78
COG5189423 SFP1 Putative transcriptional repressor regulating 95.73
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.57
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.52
KOG3993|consensus 500 95.49
COG5189423 SFP1 Putative transcriptional repressor regulating 95.2
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.27
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 92.01
KOG2893|consensus 341 90.59
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 88.51
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.39
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.74
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 87.25
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.73
COG1592166 Rubrerythrin [Energy production and conversion] 85.82
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 85.51
COG404965 Uncharacterized protein containing archaeal-type C 85.46
COG5048 467 FOG: Zn-finger [General function prediction only] 84.63
KOG2186|consensus 276 84.39
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 83.81
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 83.49
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 82.99
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 82.63
COG1198 730 PriA Primosomal protein N' (replication factor Y) 81.35
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 80.45
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 80.33
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 80.15
>KOG2462|consensus Back     alignment and domain information
Probab=99.87  E-value=2.1e-23  Score=135.44  Aligned_cols=94  Identities=17%  Similarity=0.293  Sum_probs=82.0

Q ss_pred             CccccCCCCCCCCCCC-------CCCCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHHHHh
Q psy2414          16 PFITRNNTDSIFYPDP-------ASPGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKRVH   84 (114)
Q Consensus        16 ~~~~c~~c~~~f~~~~-------~~~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~~~   84 (114)
                      +...|+.|||++.+..       +..-+++|..||+.|...|-   |+|+|+|| ||.|..|+++|.+.+||+.||++ |
T Consensus       160 ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT-H  238 (279)
T KOG2462|consen  160 KAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT-H  238 (279)
T ss_pred             ccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh-h
Confidence            4456777777776654       56678999999999998886   99999999 99999999999999999999998 6


Q ss_pred             CCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          85 GLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        85 ~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      .+.++  |.|..|+|.|+..+-|.+|.+
T Consensus       239 S~~K~--~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  239 SDVKK--HQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             cCCcc--ccCcchhhHHHHHHHHHHhhh
Confidence            66666  899999999999999999875



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 38.3 bits (90), Expect = 3e-05
 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 37 YKCVICLKSVRSRWHHLQTH-------FSRNHKCPYCESVYSRVDTLKLHAKRVH 84
          Y+C IC     ++   ++ H             CP+C++V +R   L +H ++ H
Sbjct: 16 YECYICHARF-TQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQH 69


>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.79
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.77
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.75
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.75
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.7
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.67
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.67
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.66
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.65
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.65
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.65
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.64
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.63
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.63
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.59
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.58
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.58
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.57
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.57
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.57
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.56
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.56
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.54
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.53
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.52
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.5
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.49
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.49
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.48
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.48
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.47
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.47
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.46
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.45
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.45
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.44
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.43
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.42
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.42
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.41
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.36
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.36
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.34
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.34
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.33
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.33
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.33
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.31
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.27
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.26
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.26
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.24
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.23
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.23
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.23
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.22
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.2
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.01
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.95
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.94
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.9
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.89
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.86
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.85
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.83
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.82
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.81
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.79
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.77
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.74
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.74
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.73
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.73
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.73
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.72
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.72
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.72
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.7
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.7
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.69
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.64
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.63
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.58
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.57
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.52
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.52
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.52
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.51
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.51
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.5
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.5
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.5
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.5
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.49
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.49
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.49
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.49
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.48
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.48
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.48
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.48
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.47
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.47
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.47
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.47
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.47
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.47
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.47
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.46
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.46
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.46
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.45
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.45
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.45
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.45
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.45
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.45
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.44
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.44
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.44
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.44
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.44
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.44
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.44
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.43
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.43
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.43
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.42
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.41
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.39
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.38
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.38
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.37
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.36
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.34
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.33
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.31
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.31
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.3
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.28
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.27
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.25
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.25
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.24
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.24
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.21
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.19
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.19
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.19
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.16
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.15
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.15
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.15
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.12
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.11
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.09
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.08
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.34
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.06
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.06
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.06
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.0
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.25
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.97
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.21
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.91
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.9
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.89
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.88
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.87
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.85
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.85
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.85
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.82
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.78
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.78
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.76
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.74
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.72
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.72
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.72
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.67
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.67
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.63
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.62
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.61
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.61
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.6
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.57
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.56
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.53
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.46
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.56
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.54
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.36
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.3
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.2
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.16
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.63
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.59
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.42
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 94.83
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.92
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 93.84
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.79
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.68
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.34
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 85.82
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 85.66
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 82.04
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 81.04
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 80.11
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=99.79  E-value=2.4e-20  Score=109.54  Aligned_cols=95  Identities=16%  Similarity=0.179  Sum_probs=83.2

Q ss_pred             CCccccCCCCCCCCCCC---------CCCCceecccccccccChhh---HHhh---hcCC-CccCCCCcCcccChhHHHH
Q psy2414          15 QPFITRNNTDSIFYPDP---------ASPGMYKCVICLKSVRSRWH---HLQT---HFSR-NHKCPYCESVYSRVDTLKL   78 (114)
Q Consensus        15 ~~~~~c~~c~~~f~~~~---------~~~~~~~C~~C~~~f~~~~~---h~~~---h~~~-~~~c~~C~~~f~~~~~l~~   78 (114)
                      ...+.|+.|++.|....         .++++|.|+.|++.|.....   |+..   +.++ +|.|..|++.|.....|..
T Consensus         5 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~   84 (124)
T 2dlq_A            5 SSGVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRL   84 (124)
T ss_dssp             CSSCCCTTTCCCCSSHHHHHHHHHHHSSCCSCBCTTTCCBCSSHHHHHHHHHHCCCCSCCCCEECSSSCCEESSHHHHHH
T ss_pred             CCCCCCCCCCCcCCCHHHHHHHHHhCCCCCCeECCCCCchhcCHHHHHHHHhhhhcCCCCCCeECCCCCCccCCHHHHHH
Confidence            45688999999998876         67899999999999988875   8774   4566 9999999999999999999


Q ss_pred             HHHHHhCCCCCCccccCCCCCccCCCCCCCCCCC
Q psy2414          79 HAKRVHGLGISRYIHGLIPQLLFPTPHAKTSPVD  112 (114)
Q Consensus        79 H~~~~~~~~~~~~~~c~~c~~~f~~~~~L~~h~~  112 (114)
                      |+++ |.++++  +.|..|++.|.+...|.+|++
T Consensus        85 H~~~-h~~~~~--~~C~~C~~~f~~~~~l~~H~~  115 (124)
T 2dlq_A           85 HMVS-HTGEMP--YKCSSCSQQFMQKKDLQSHMI  115 (124)
T ss_dssp             HHHH-HSSSCS--EECSSSCCEESSHHHHHHHHH
T ss_pred             HHHH-cCCCCC--ccCCCccchhCCHHHHHHHHH
Confidence            9997 566666  889999999999999999875



>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.48
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.28
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.19
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.17
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.17
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.17
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.99
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.94
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.87
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.74
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.74
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.73
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.71
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.59
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.59
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.57
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.57
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.56
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.51
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.43
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.41
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.3
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.3
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.29
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.28
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.26
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.23
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.15
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.1
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.98
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.98
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.95
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.92
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.91
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.79
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.74
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.74
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.69
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.64
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.55
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.49
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.49
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.48
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.3
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.25
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.22
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.13
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.11
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.04
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.97
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.96
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.74
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.34
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.22
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.2
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.08
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.07
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.06
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.87
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.47
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.43
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.2
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.78
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.6
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.22
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.02
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.8
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.24
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.01
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.95
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 91.73
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.29
d1y0jb136 U-shaped transcription factor, different fingers { 90.94
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.89
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.48
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.7
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 83.56
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.13
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 80.22
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=2.9e-16  Score=78.51  Aligned_cols=48  Identities=25%  Similarity=0.451  Sum_probs=36.3

Q ss_pred             CCceecccccccccChhh---HHhhhcCC-CccCCCCcCcccChhHHHHHHHH
Q psy2414          34 PGMYKCVICLKSVRSRWH---HLQTHFSR-NHKCPYCESVYSRVDTLKLHAKR   82 (114)
Q Consensus        34 ~~~~~C~~C~~~f~~~~~---h~~~h~~~-~~~c~~C~~~f~~~~~l~~H~~~   82 (114)
                      |+||.| .|++.|.....   |+++|+++ ||.|..||+.|...+.|..|+++
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            567778 48877777765   77777777 78888888888888888777764



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure